F453730

General Info

Members Datasets Scaffolds Average Seq Length
489 290 486 121

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_101173800|Ga0070670_1011738001
Length 135
Sequence MSRAPRAVPSRLRRKRVFKQAKGFYGRRKNNITSANAAVDRSMQYAYVGRKLKKRNFRALWIQRINAAVREHGLTYGRFINGLSNLGLEVDRKVLSDIAINDPAGFKALVDKAAAAASSPVAKADADKAKTKKAA

Samples

Sample ID Description Type Environment
1 2909042592 Labrys sp. LIt4 Isolate Nodule
2 2919513703 Luteimonas sp. 3794 Isolate Unclassified
3 2919675420 Luteimonas terrae 4099 Isolate Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
161 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
194 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
195 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
196 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
197 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
198 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
199 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
200 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
201 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
202 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
280 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
281 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
282 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
285 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
286 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
287 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
288 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.34
Metatranscriptomes 2.04
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.86
Nodule 0.2
Rhizoplane 3.07
Rhizosphere 90.8
Stem 0
Stem Tuber 0
Unclassified 3.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10130046 3300005328 Bacteria 1591
2 Ga0070683_101731766 3300005329 Bacteria 601
3 Ga0070670_101173800 3300005331 Bacteria 701
4 Ga0070677_10171627 3300005333 Bacteria 1026
5 Ga0068869_100000648 3300005334 Bacteria 19658
6 Ga0068869_101090956 3300005334 Bacteria 698
7 Ga0070680_100367733 3300005336 Bacteria 1223
8 Ga0070682_100013327 3300005337 Bacteria 4727
9 Ga0070682_100455257 3300005337 Bacteria 981
10 Ga0070660_100570507 3300005339 Bacteria 945
11 Ga0070689_100120066 3300005340 Bacteria 2099
12 Ga0070689_100165457 3300005340 Bacteria 1790
13 Ga0070691_10144592 3300005341 Bacteria 1215
14 Ga0070691_10803974 3300005341 Bacteria 573
15 Ga0070687_100463980 3300005343 Bacteria 845
16 Ga0070668_100164246 3300005347 Bacteria 1804
17 Ga0070668_101023573 3300005347 Bacteria 743
18 Ga0070669_101443008 3300005353 Bacteria 598
19 Ga0070673_100155029 3300005364 Bacteria 1943
20 Ga0070659_100036650 3300005366 Bacteria 3823
21 Ga0070659_100715235 3300005366 Bacteria 867
22 Ga0070713_100142738 3300005436 Bacteria 2123
23 Ga0070713_100997337 3300005436 Unclassified 808
24 Ga0070710_10391922 3300005437 Unclassified 929
25 Ga0070710_10746333 3300005437 Bacteria 695
26 Ga0070701_10462779 3300005438 Bacteria 816
27 Ga0070711_100205412 3300005439 Bacteria 1523
28 Ga0070711_100891716 3300005439 Bacteria 759
29 Ga0070711_101271928 3300005439 Bacteria 638
30 Ga0070705_100357516 3300005440 Bacteria 1067
31 Ga0070705_101516788 3300005440 Bacteria 562
32 Ga0070705_101795220 3300005440 Bacteria 520
33 Ga0070700_100924893 3300005441 Bacteria 712
34 Ga0070694_100092791 3300005444 Bacteria 2121
35 Ga0070663_100204061 3300005455 Bacteria 1544
36 Ga0070681_10069044 3300005458 Bacteria 3501
37 Ga0070681_10252062 3300005458 Bacteria 1677
38 Ga0070681_10296565 3300005458 Bacteria 1526
39 Ga0070681_11169241 3300005458 Bacteria 691
40 Ga0068867_100699041 3300005459 Bacteria 894
41 Ga0068867_100895931 3300005459 Bacteria 798
42 Ga0068867_101339499 3300005459 Bacteria 662
43 Ga0070706_100116538 3300005467 Unclassified 2488
44 Ga0070679_100008091 3300005530 Bacteria 9881
45 Ga0070679_100012659 3300005530 Bacteria 8068
46 Ga0070679_100013529 3300005530 Bacteria 7818
47 Ga0070684_102330833 3300005535 Bacteria 505
48 Ga0068853_100005046 3300005539 Bacteria 10299
49 Ga0068853_100051500 3300005539 Bacteria 3543
50 Ga0068853_100304272 3300005539 Bacteria 1474
51 Ga0068853_100666574 3300005539 Bacteria 991
52 Ga0068853_100685740 3300005539 Bacteria 977
53 Ga0070672_100469836 3300005543 Bacteria 1085
54 Ga0070686_100428334 3300005544 Bacteria 1012
55 Ga0070695_100100733 3300005545 Bacteria 1945
56 Ga0070696_100037829 3300005546 Bacteria 3328
57 Ga0070696_100373700 3300005546 Bacteria 1109
58 Ga0070696_101556995 3300005546 Bacteria 567
59 Ga0070693_100007429 3300005547 Bacteria 5358
60 Ga0070665_100120945 3300005548 Bacteria 2620
61 Ga0070665_100170356 3300005548 Bacteria 2178
62 Ga0070665_100695112 3300005548 Bacteria 1030
63 Ga0070665_100777546 3300005548 Bacteria 970
64 Ga0068855_100179349 3300005563 Bacteria 2395
65 Ga0068855_100323590 3300005563 Bacteria 1704
66 Ga0068855_100333336 3300005563 Bacteria 1674
67 Ga0068855_100825687 3300005563 Bacteria 984
68 Ga0070664_100049081 3300005564 Bacteria 3569
69 Ga0070664_100577219 3300005564 Bacteria 1041
70 Ga0070664_101402697 3300005564 Bacteria 660
71 Ga0068857_100083824 3300005577 Bacteria 2848
72 Ga0068857_100703897 3300005577 Bacteria 960
73 Ga0068856_100091537 3300005614 Bacteria 3025
74 Ga0070702_101047230 3300005615 Bacteria 649
75 Ga0068852_101485359 3300005616 Bacteria 700
76 Ga0068859_100279537 3300005617 Bacteria 1762
77 Ga0068859_101003281 3300005617 Bacteria 917
78 Ga0068861_100517401 3300005719 Bacteria 1082
79 Ga0068861_100597262 3300005719 Bacteria 1012
80 Ga0068851_10129678 3300005834 Bacteria 1363
81 Ga0068858_100294439 3300005842 Bacteria 1547
82 Ga0068858_101813003 3300005842 Bacteria 603
83 Ga0068862_100194280 3300005844 Bacteria 1827
84 Ga0068862_101145131 3300005844 Bacteria 774
85 Ga0075365_10158024 3300006038 Bacteria 1578
86 Ga0070716_101251959 3300006173 Bacteria 598
87 Ga0070712_100000260 3300006175 Bacteria 29575
88 Ga0097621_100198373 3300006237 Bacteria 1741
89 Ga0097621_100203980 3300006237 Bacteria 1718
90 Ga0068871_100485462 3300006358 Bacteria 1112
91 Ga0068871_100652051 3300006358 Bacteria 961
92 Ga0068871_101280980 3300006358 Bacteria 689
93 Ga0075428_100821526 3300006844 Bacteria 987
94 Ga0075430_100270451 3300006846 Bacteria 1406
95 Ga0075431_100942606 3300006847 Bacteria 832
96 Ga0068865_100364319 3300006881 Bacteria 1175
97 Ga0075436_101261119 3300006914 Bacteria 559
98 Ga0097620_100279527 3300006931 Bacteria 1762
99 Ga0097620_101003078 3300006931 Bacteria 917
100 Ga0099795_10121865 3300007788 Bacteria 1044
101 Ga0099795_10325531 3300007788 Bacteria 682
102 Ga0111539_10087798 3300009094 Bacteria 3653
103 Ga0111539_11048671 3300009094 Bacteria 948
104 Ga0105245_10012871 3300009098 Bacteria 7291
105 Ga0105245_10857292 3300009098 Bacteria 949
106 Ga0105245_11814621 3300009098 Bacteria 663
107 Ga0105247_10302993 3300009101 Bacteria 1109
108 Ga0105247_10505417 3300009101 Bacteria 881
109 Ga0105243_10842771 3300009148 Bacteria 907
110 Ga0105241_10018566 3300009174 Bacteria 5117
111 Ga0105241_10052353 3300009174 Bacteria 3116
112 Ga0105242_10065815 3300009176 Bacteria 2991
113 Ga0105242_10116976 3300009176 Bacteria 2282
114 Ga0105242_10331546 3300009176 Bacteria 1399
115 Ga0105242_10721450 3300009176 Bacteria 978
116 Ga0105242_11071477 3300009176 Bacteria 818
117 Ga0105248_10754491 3300009177 Bacteria 1098
118 Ga0105248_11165711 3300009177 Bacteria 871
119 Ga0105248_12275855 3300009177 Bacteria 617
120 Ga0105237_10057156 3300009545 Bacteria 3905
121 Ga0105237_10065812 3300009545 Bacteria 3619
122 Ga0105237_10072752 3300009545 Bacteria 3431
123 Ga0105238_10024943 3300009551 Bacteria 6094
124 Ga0105238_10105601 3300009551 Bacteria 2798
125 Ga0105238_10707367 3300009551 Bacteria 1020
126 Ga0105238_12604252 3300009551 Bacteria 542
127 Ga0105249_10677691 3300009553 Bacteria 1090
128 Ga0099796_10035955 3300010159 Bacteria 1646
129 Ga0105239_10295447 3300010375 Bacteria 1824
130 Ga0105239_12911586 3300010375 Bacteria 558
131 Ga0105246_10031393 3300011119 Bacteria 3515
132 Ga0157373_10560911 3300013100 Bacteria 829
133 Ga0157369_10082075 3300013105 Bacteria 3449
134 Ga0157374_10867556 3300013296 Bacteria 920
135 Ga0157378_10042694 3300013297 Bacteria 4025
136 Ga0163162_11137911 3300013306 Bacteria 885
137 Ga0163162_12199975 3300013306 Bacteria 633
138 Ga0157372_12081065 3300013307 Bacteria 652
139 Ga0157375_13461150 3300013308 Bacteria 525
140 Ga0163163_10277109 3300014325 Bacteria 1728
141 Ga0157380_11428033 3300014326 Bacteria 743
142 Ga0157377_10661194 3300014745 Bacteria 753
143 Ga0157379_10118980 3300014968 Bacteria 2376
144 Ga0157379_10534253 3300014968 Bacteria 1090
145 Ga0157379_11351622 3300014968 Bacteria 689
146 Ga0157376_10117239 3300014969 Bacteria 2354
147 Ga0157376_10524184 3300014969 Bacteria 1168
148 Ga0207692_11121205 3300025898 Bacteria 521
149 Ga0207710_10260677 3300025900 Bacteria 868
150 Ga0207688_10152566 3300025901 Bacteria 1365
151 Ga0207647_10426287 3300025904 Bacteria 745
152 Ga0207647_10519964 3300025904 Bacteria 662
153 Ga0207699_10017932 3300025906 Bacteria 3741
154 Ga0207645_10411411 3300025907 Bacteria 910
155 Ga0207705_10197407 3300025909 Bacteria 1524
156 Ga0207705_10406764 3300025909 Bacteria 1053
157 Ga0207684_10145807 3300025910 Bacteria 2036
158 Ga0207654_10113188 3300025911 Bacteria 1692
159 Ga0207654_10157969 3300025911 Bacteria 1462
160 Ga0207654_10676042 3300025911 Bacteria 741
161 Ga0207707_10148459 3300025912 Bacteria 2050
162 Ga0207707_10225867 3300025912 Bacteria 1629
163 Ga0207707_10282634 3300025912 Bacteria 1437
164 Ga0207695_10016369 3300025913 Bacteria 8678
165 Ga0207671_10142134 3300025914 Bacteria 1850
166 Ga0207671_11107428 3300025914 Bacteria 622
167 Ga0207663_10062373 3300025916 Bacteria 2369
168 Ga0207663_10839299 3300025916 Bacteria 733
169 Ga0207663_10910725 3300025916 Bacteria 703
170 Ga0207663_11053921 3300025916 Bacteria 653
171 Ga0207660_10093899 3300025917 Bacteria 2229
172 Ga0207660_10201148 3300025917 Bacteria 1556
173 Ga0207660_10594421 3300025917 Bacteria 901
174 Ga0207657_10080802 3300025919 Bacteria 2732
175 Ga0207657_10270451 3300025919 Bacteria 1351
176 Ga0207649_10783559 3300025920 Bacteria 743
177 Ga0207652_10006625 3300025921 Bacteria 9331
178 Ga0207652_10214845 3300025921 Bacteria 1732
179 Ga0207652_10439439 3300025921 Bacteria 1176
180 Ga0207694_10022041 3300025924 Bacteria 4831
181 Ga0207694_10544568 3300025924 Bacteria 974
182 Ga0207650_10484453 3300025925 Bacteria 1032
183 Ga0207659_11403856 3300025926 Bacteria 598
184 Ga0207687_10011198 3300025927 Bacteria 5857
185 Ga0207687_10542233 3300025927 Bacteria 975
186 Ga0207700_10132116 3300025928 Bacteria 2040
187 Ga0207664_10785487 3300025929 Bacteria 857
188 Ga0207690_10674005 3300025932 Bacteria 849
189 Ga0207706_10070153 3300025933 Bacteria 3082
190 Ga0207706_10838055 3300025933 Bacteria 779
191 Ga0207686_10232000 3300025934 Bacteria 1339
192 Ga0207686_10621796 3300025934 Bacteria 852
193 Ga0207686_10729846 3300025934 Bacteria 789
194 Ga0207686_10945904 3300025934 Bacteria 697
195 Ga0207670_10227156 3300025936 Bacteria 1432
196 Ga0207669_10674826 3300025937 Bacteria 847
197 Ga0207704_10484910 3300025938 Bacteria 993
198 Ga0207665_10079729 3300025939 Bacteria 2251
199 Ga0207691_10813889 3300025940 Bacteria 785
200 Ga0207711_10364780 3300025941 Bacteria 1339
201 Ga0207711_10543755 3300025941 Bacteria 1083
202 Ga0207689_10004086 3300025942 Bacteria 13272
203 Ga0207661_12006348 3300025944 Bacteria 524
204 Ga0207679_10031200 3300025945 Bacteria 3729
205 Ga0207679_10460379 3300025945 Bacteria 1129
206 Ga0207667_10014360 3300025949 Bacteria 9033
207 Ga0207667_10318986 3300025949 Bacteria 1587
208 Ga0207667_11369878 3300025949 Bacteria 682
209 Ga0207712_10571921 3300025961 Bacteria 974
210 Ga0207640_10204133 3300025981 Bacteria 1500
211 Ga0207677_11875554 3300026023 Bacteria 557
212 Ga0207703_10681632 3300026035 Bacteria 976
213 Ga0207703_11634922 3300026035 Bacteria 620
214 Ga0207639_10000110 3300026041 Bacteria 65128
215 Ga0207639_10195786 3300026041 Bacteria 1730
216 Ga0207639_10209383 3300026041 Bacteria 1677
217 Ga0207678_10001937 3300026067 Bacteria 18896
218 Ga0207708_11304606 3300026075 Bacteria 636
219 Ga0207708_11337605 3300026075 Bacteria 628
220 Ga0207702_10447555 3300026078 Bacteria 1253
221 Ga0207648_10583042 3300026089 Bacteria 1030
222 Ga0207648_11438402 3300026089 Bacteria 648
223 Ga0207674_10008622 3300026116 Bacteria 11753
224 Ga0207674_10190454 3300026116 Bacteria 2001
225 Ga0207674_10702733 3300026116 Bacteria 976
226 Ga0207675_100391408 3300026118 Bacteria 1368
227 Ga0207683_10203241 3300026121 Bacteria 1801
228 Ga0207683_10269921 3300026121 Bacteria 1554
229 Ga0207698_11300455 3300026142 Bacteria 742
230 Ga0207428_10333207 3300027907 Bacteria 1119
231 Ga0268266_11285187 3300028379 Bacteria 707
232 Ga0268265_10255091 3300028380 Bacteria 1556
233 Ga0268265_10544954 3300028380 Bacteria 1100
234 Ga0268264_12208457 3300028381 Bacteria 558
235 Ga0265337_1005176 3300028556 Bacteria 5235
236 Ga0265334_10042413 3300028573 Bacteria 1773
237 Ga0307517_10084056 3300028786 Bacteria 2683
238 Ga0265338_10019293 3300028800 Bacteria 7246
239 Ga0265338_10020650 3300028800 Bacteria 6915
240 Ga0265338_11078691 3300028800 Bacteria 541
241 Ga0265330_10076650 3300031235 Bacteria 1443
242 Ga0265332_10245413 3300031238 Bacteria 741
243 Ga0265332_10420741 3300031238 Bacteria 552
244 Ga0265328_10094053 3300031239 Bacteria 1108
245 Ga0265328_10249940 3300031239 Bacteria 679
246 Ga0265325_10065372 3300031241 Bacteria 1837
247 Ga0265325_10297512 3300031241 Bacteria 721
248 Ga0265329_10078473 3300031242 Bacteria 1045
249 Ga0265340_10397983 3300031247 Bacteria 607
250 Ga0265339_10042381 3300031249 Bacteria 2520
251 Ga0265339_10063039 3300031249 Bacteria 1992
252 Ga0265331_10019540 3300031250 Bacteria 3499
253 Ga0265331_10233170 3300031250 Bacteria 826
254 Ga0265316_10318083 3300031344 Bacteria 1131
255 Ga0307509_10521984 3300031507 Bacteria 869
256 Ga0265313_10098103 3300031595 Bacteria 1304
257 Ga0265314_10079171 3300031711 Bacteria 2173
258 Ga0265314_10141679 3300031711 Bacteria 1485
259 Ga0265314_10189779 3300031711 Bacteria 1224
260 Ga0265342_10110177 3300031712 Bacteria 1559
261 Ga0265342_10115446 3300031712 Bacteria 1516
262 Ga0265342_10400187 3300031712 Bacteria 709
263 Ga0316576_10226937 3300031727 Bacteria 1404
264 Ga0316576_10242026 3300031727 Bacteria 1355
265 Ga0316576_10278277 3300031727 Bacteria 1253
266 Ga0316576_11050686 3300031727 Unclassified 579
267 Ga0316578_10082081 3300031728 Bacteria 1919
268 Ga0307415_102041530 3300032126 Bacteria 559
269 Ga0316580_10019816 3300032139 Bacteria 2069
270 Ga0316593_10112166 3300032168 Bacteria 974
271 Ga0316593_10315303 3300032168 Bacteria 594
272 Ga0316592_1051014 3300033524 Unclassified 924
273 Ga0316592_1062170 3300033524 Unclassified 839
274 Ga0316588_1010360 3300033528 Unclassified 1964
275 Ga0316588_1014648 3300033528 Bacteria 1720
276 Ga0316588_1069497 3300033528 Unclassified 864
277 Ga0316588_1087984 3300033528 Bacteria 773
278 Ga0316588_1126729 3300033528 Bacteria 648
279 Ga0316596_1146018 3300033541 Unclassified 649
280 Ga0373938_0123364 3300034957 Bacteria 670
281 Ga0373934_0455890 3300035086 Bacteria 536
282 Ga0373940_0092237 3300035088 Bacteria 909
283 Ga0373944_0363959 3300035089 Bacteria 552
284 Ga0373923_0135039 3300035111 Bacteria 1112
285 Ga0373936_0040723 3300035113 Bacteria 1862
286 Ga0373936_0069948 3300035113 Bacteria 1445
287 Ga0373936_0362569 3300035113 Bacteria 661
288 Ga0373945_0019741 3300035116 Bacteria 2302
289 Ga0373954_0092053 3300035118 Bacteria 1457
290 Ga0373956_0081692 3300035119 Bacteria 1483
291 Ga0373956_0355429 3300035119 Bacteria 698
292 Ga0373943_0001721 3300035170 Bacteria 9919
293 Ga0373943_0520260 3300035170 Bacteria 696
294 Ga0373943_0787683 3300035170 Bacteria 565
295 Ga0373946_0008411 3300035171 Bacteria 3785
296 Ga0373955_0148072 3300035172 Bacteria 1380
297 Ga0373942_0055400 3300035207 Bacteria 1123
298 Ga0373924_0165768 3300035410 Bacteria 970
299 Ga0373931_0014276 3300035691 Bacteria 3880
300 Ga0373931_0725983 3300035691 Bacteria 658
301 Ga0373935_0002369 3300035692 Bacteria 10764
302 Ga0373935_0082987 3300035692 Bacteria 2086
303 Ga0373935_0569882 3300035692 Bacteria 826
304 Ga0373927_0099275 3300035695 Bacteria 1893
305 Ga0373927_0842447 3300035695 Bacteria 605
306 Ga0373933_0217871 3300035724 Bacteria 1224
307 Ga0373947_0095741 3300035725 Bacteria 1858
308 Ga0373947_0134478 3300035725 Bacteria 1581
309 Ga0373937_0004078 3300036401 Bacteria 12384
310 Ga0373937_0150452 3300036401 Bacteria 2180
311 Ga0373937_0178127 3300036401 Bacteria 1996
312 Ga0373937_0254195 3300036401 Bacteria 1656
313 Ga0373937_0476491 3300036401 Bacteria 1185
314 Ga0373925_0164677 3300037068 Bacteria 1748
315 Ga0373925_0177177 3300037068 Bacteria 1686
316 Ga0373925_0286158 3300037068 Bacteria 1328
317 Ga0373925_0297023 3300037068 Bacteria 1304
318 Ga0373925_0327573 3300037068 Bacteria 1240
319 Ga0373925_1263266 3300037068 Bacteria 606
320 Ga0395899_0316229 3300037312 Bacteria 1053
321 Ga0395899_0697649 3300037312 Unclassified 637
322 Ga0395900_0075894 3300037418 Bacteria 3455
323 Ga0395900_0172754 3300037418 Bacteria 2199
324 Ga0395898_0013705 3300037466 Bacteria 8339
325 Ga0395898_0289354 3300037466 Bacteria 1563
326 Ga0395901_0026910 3300038443 Bacteria 5905
327 Ga0395901_0910084 3300038443 Bacteria 861
328 Ga0400490_14970 3300038726 Bacteria 1367
329 Ga0436365_0456767 3300039437 Bacteria 1143
330 Ga0436365_1210184 3300039437 Bacteria 1157
331 Ga0436363_0100275 3300039450 Bacteria 550
332 Ga0451795_1272768 3300041456 Unclassified 881
333 Ga0451804_0440225 3300041463 Bacteria 878
334 Ga0451837_0593073 3300041494 Bacteria 1197
335 Ga0451845_0193759 3300041501 Bacteria 652
336 Ga0451849_1305590 3300041505 Bacteria 565
337 Ga0451843_0962993 3300041509 Bacteria 1111
338 Ga0451855_0553907 3300041511 Bacteria 974
339 Ga0439441_028471 3300042001 Bacteria 1071
340 Ga0439456_172771 3300042013 Bacteria 508
341 Ga0439435_0100865 3300042436 Bacteria 887
342 Ga0466963_1147881 3300044694 Bacteria 546
343 Ga0466959_0958507 3300045049 Bacteria 570
344 Ga0466958_0389526 3300045836 Bacteria 899
345 Ga0495617_264957 3300046452 Bacteria 528
346 Ga0495629_0028360 3300046459 Bacteria 3975
347 Ga0495580_0006870 3300046472 Bacteria 9201
348 Ga0495580_0360451 3300046472 Bacteria 984
349 Ga0495582_0123555 3300046473 Bacteria 1460
350 Ga0495582_0179392 3300046473 Bacteria 1206
351 Ga0495662_0656017 3300046476 Bacteria 512
352 Ga0495664_0928721 3300046477 Bacteria 508
353 Ga0495583_0430853 3300046506 Bacteria 517
354 Ga0495608_0255026 3300046511 Bacteria 1093
355 Ga0495616_0219434 3300046513 Bacteria 829
356 Ga0495618_0609172 3300046514 Bacteria 649
357 Ga0495648_0294483 3300046524 Bacteria 763
358 Ga0495586_0103421 3300046535 Bacteria 1582
359 Ga0495586_0475487 3300046535 Bacteria 721
360 Ga0495587_0017150 3300046536 Bacteria 4503
361 Ga0495587_0139048 3300046536 Bacteria 1387
362 Ga0495621_0077828 3300046539 Bacteria 1232
363 Ga0495645_0455585 3300046543 Bacteria 806
364 Ga0495645_0565759 3300046543 Bacteria 703
365 Ga0495622_0259044 3300046557 Bacteria 764
366 Ga0495635_0396250 3300046663 Bacteria 917
367 Ga0495588_0278961 3300046674 Bacteria 881
368 Ga0495657_0510485 3300046675 Bacteria 700
369 Ga0495657_0739496 3300046675 Bacteria 564
370 Ga0495658_0000505 3300046683 Bacteria 21469
371 Ga0495669_0234581 3300046684 Bacteria 880
372 Ga0495671_0495343 3300046692 Bacteria 583
373 Ga0495600_0283182 3300046809 Bacteria 1049
374 Ga0495581_0333872 3300047315 Bacteria 885
375 Ga0495604_0407286 3300047317 Bacteria 895
376 Ga0495674_0351444 3300047319 Bacteria 1197
377 Ga0495672_0259153 3300047320 Bacteria 840
378 Ga0495675_0245789 3300047444 Bacteria 1076
379 Ga0495675_0507368 3300047444 Bacteria 692
380 Ga0495677_0098611 3300047445 Bacteria 1105
381 Ga0495673_0172394 3300047469 Bacteria 824
382 Ga0495602_0057448 3300048088 Bacteria 3413
383 Ga0495602_0441324 3300048088 Bacteria 920
384 Ga0496101_0012243 3300048904 Bacteria 5719
385 Ga0496102_0157832 3300048905 Bacteria 2133
386 Ga0496103_0128306 3300048906 Bacteria 1618
387 Ga0496103_0202574 3300048906 Bacteria 1276
388 Ga0496104_0052893 3300048907 Bacteria 3836
389 Ga0496105_0449289 3300048908 Bacteria 1018
390 Ga0496106_0015255 3300048909 Bacteria 5685
391 Ga0496107_0121259 3300048910 Bacteria 1926
392 Ga0496107_0722523 3300048910 Bacteria 732
393 Ga0496108_0545237 3300048911 Bacteria 1012
394 Ga0496109_1093934 3300048912 Bacteria 734
395 Ga0496111_0859794 3300048914 Bacteria 654
396 Ga0496113_1015053 3300048916 Bacteria 653
397 Ga0496117_0236185 3300048920 Bacteria 1007
398 Ga0496126_0293496 3300048929 Bacteria 1344
399 Ga0501031_0186704 3300049568 Bacteria 1354
400 Ga0501032_0013776 3300049569 Bacteria 5737
401 Ga0501033_0075523 3300049570 Bacteria 2473
402 Ga0501033_0112343 3300049570 Bacteria 1982
403 Ga0501033_0220877 3300049570 Bacteria 1349
404 Ga0501034_0000068 3300049571 Bacteria 182904
405 Ga0501034_0006843 3300049571 Bacteria 12198
406 Ga0501034_0236902 3300049571 Bacteria 1772
407 Ga0501036_0130420 3300049572 Bacteria 2122
408 Ga0501036_1114971 3300049572 Bacteria 644
409 Ga0501037_0008627 3300049573 Bacteria 7473
410 Ga0501037_0077451 3300049573 Bacteria 2413
411 Ga0501037_0238800 3300049573 Bacteria 1274
412 Ga0501038_0080357 3300049574 Bacteria 2748
413 Ga0501038_0156439 3300049574 Bacteria 1856
414 Ga0501038_0269346 3300049574 Bacteria 1343
415 Ga0501039_0000205 3300049575 Bacteria 43025
416 Ga0501040_0277575 3300049576 Bacteria 1197
417 Ga0501043_0074585 3300049579 Bacteria 2665
418 Ga0501043_0114689 3300049579 Bacteria 2115
419 Ga0501043_0198500 3300049579 Bacteria 1558
420 Ga0501043_0460734 3300049579 Bacteria 954
421 Ga0501046_0007334 3300049580 Bacteria 9701
422 Ga0501046_0030319 3300049580 Bacteria 4390
423 Ga0501046_0438240 3300049580 Bacteria 940
424 Ga0501047_0000152 3300049581 Bacteria 84703
425 Ga0501047_0025453 3300049581 Bacteria 5689
426 Ga0501047_0092493 3300049581 Bacteria 2903
427 Ga0501047_0137513 3300049581 Bacteria 2323
428 Ga0501047_0387396 3300049581 Bacteria 1231
429 Ga0501047_0561366 3300049581 Bacteria 965
430 Ga0501047_0957694 3300049581 Bacteria 669
431 Ga0501048_0002175 3300049582 Bacteria 14919
432 Ga0501048_0305039 3300049582 Bacteria 1133
433 Ga0501067_0018422 3300049583 Bacteria 3868
434 Ga0501067_0020300 3300049583 Bacteria 3677
435 Ga0501070_0005781 3300049586 Bacteria 10552
436 Ga0501070_0035400 3300049586 Bacteria 4172
437 Ga0501070_0206265 3300049586 Bacteria 1614
438 Ga0501070_0209042 3300049586 Bacteria 1602
439 Ga0501070_0562077 3300049586 Bacteria 912
440 Ga0501073_0238742 3300049589 Bacteria 1255
441 Ga0501073_0351539 3300049589 Bacteria 1018
442 Ga0501073_1210338 3300049589 Bacteria 518
443 Ga0501074_0105461 3300049590 Bacteria 2018
444 Ga0501074_0351401 3300049590 Bacteria 1046
445 Ga0501076_1121104 3300049592 Bacteria 648
446 Ga0501080_0000001 3300049742 Bacteria 241365
447 Ga0501080_0403172 3300049742 Bacteria 1230
448 Ga0501080_0655475 3300049742 Bacteria 929
449 Ga0501080_0988812 3300049742 Bacteria 730
450 Ga0501080_0989212 3300049742 Bacteria 730
451 Ga0501080_1000868 3300049742 Bacteria 725
452 Ga0501083_0323502 3300049744 Bacteria 1003
453 Ga0501083_0548933 3300049744 Bacteria 752
454 Ga0501035_0000015 3300049822 Bacteria 246493
455 Ga0501035_0005877 3300049822 Bacteria 11558
456 Ga0501035_0030838 3300049822 Bacteria 4885
457 Ga0501035_0091158 3300049822 Bacteria 2683
458 Ga0501044_0000390 3300049823 Bacteria 54419
459 Ga0501044_0021866 3300049823 Bacteria 6820
460 Ga0501044_0050955 3300049823 Bacteria 4270
461 Ga0501044_0433866 3300049823 Bacteria 1222
462 Ga0501044_0618516 3300049823 Bacteria 975
463 Ga0501045_0142665 3300049824 Bacteria 1781
464 nmdc:mga00v17_116641_c1 3300050491 Bacteria 1698
465 nmdc:mga00v17_7378_c1 3300050491 Bacteria 5864
466 nmdc:mga0qj67_333002_c1 3300050509 Bacteria 1228
467 nmdc:mga08y16_344379_c1 3300050511 Bacteria 1532
468 nmdc:mga08x19_130241_c1 3300050514 Bacteria 1692
469 Ga0495655_0153712 3300053083 Bacteria 725
470 Ga0495619_0213602 3300053085 Bacteria 1336
471 Ga0495619_0996698 3300053085 Bacteria 560
472 Ga0500643_000027 3300053087 Bacteria 251062
473 Ga0500646_0023372 3300053090 Bacteria 1657
474 Ga0500650_0284384 3300053098 Bacteria 735
475 Ga0500595_008628 3300053119 Bacteria 4158
476 Ga0500595_014502 3300053119 Bacteria 2989
477 Ga0500595_127329 3300053119 Bacteria 718
478 Ga0500616_0007417 3300053153 Bacteria 6978
479 Ga0500619_200390 3300053154 Bacteria 670
480 Ga0500639_234766 3300053163 Bacteria 751
481 Ga0500656_036256 3300053732 Bacteria 675
482 Ga0500596_084539 3300053735 Bacteria 556
483 Ga0590075_004675 3300059424 Bacteria 3240
484 Ga0501082_0022902 3300060353 Bacteria 5382
485 Ga0501082_1105874 3300060353 Bacteria 693
486 Ga0530510_1051268 3300061734 Bacteria 623

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025916 Ga0207663_10839299 Ga0207663_108392991 111
2 iso_pu_bacteria 2909042592 2909046808 113
3 3300005539 Ga0068853_100685740 Ga0068853_1006857401 114
4 3300005617 Ga0068859_100279537 Ga0068859_1002795373 114
5 3300006931 Ga0097620_100279527 Ga0097620_1002795272 114
6 3300014326 Ga0157380_11428033 Ga0157380_114280331 114
7 3300025909 Ga0207705_10406764 Ga0207705_104067643 114
8 iso_pu_bacteria 2919513703 2919516652 114
9 iso_pu_bacteria 2919675420 2919675595 114
10 3300005458 Ga0070681_11169241 Ga0070681_111692411 115
11 3300006914 Ga0075436_101261119 Ga0075436_1012611191 115
12 3300009176 Ga0105242_10065815 Ga0105242_100658152 115
13 3300025929 Ga0207664_10785487 Ga0207664_107854871 115
14 3300031247 Ga0265340_10397983 Ga0265340_103979832 115
15 3300031711 Ga0265314_10141679 Ga0265314_101416793 115
16 3300031712 Ga0265342_10110177 Ga0265342_101101772 115
17 3300032168 Ga0316593_10315303 Ga0316593_103153031 115
18 3300033528 Ga0316588_1126729 Ga0316588_11267292 115
19 3300035089 Ga0373944_0363959 Ga0373944_0363959_132_479 115
20 3300035113 Ga0373936_0362569 Ga0373936_0362569_86_433 115
21 3300035116 Ga0373945_0019741 Ga0373945_0019741_406_753 115
22 3300035170 Ga0373943_0001721 Ga0373943_0001721_2801_3148 115
23 3300035170 Ga0373943_0520260 Ga0373943_0520260_326_673 115
24 3300035170 Ga0373943_0787683 Ga0373943_0787683_74_421 115
25 3300035171 Ga0373946_0008411 Ga0373946_0008411_2350_2697 115
26 3300035692 Ga0373935_0002369 Ga0373935_0002369_5866_6213 115
27 3300035695 Ga0373927_0099275 Ga0373927_0099275_734_1081 115
28 3300035695 Ga0373927_0842447 Ga0373927_0842447_167_514 115
29 3300035725 Ga0373947_0134478 Ga0373947_0134478_898_1245 115
30 3300037068 Ga0373925_0164677 Ga0373925_0164677_319_666 115
31 3300037068 Ga0373925_0327573 Ga0373925_0327573_476_823 115
32 3300037068 Ga0373925_1263266 Ga0373925_1263266_179_526 115
33 3300039437 Ga0436365_1210184 Ga0436365_1210184_14_361 115
34 3300039450 Ga0436363_0100275 Ga0436363_0100275_160_507 115
35 3300046459 Ga0495629_0028360 Ga0495629_0028360_3422_3769 115
36 3300046472 Ga0495580_0006870 Ga0495580_0006870_50_397 115
37 3300046473 Ga0495582_0179392 Ga0495582_0179392_750_1097 115
38 3300046535 Ga0495586_0103421 Ga0495586_0103421_768_1115 115
39 3300046543 Ga0495645_0455585 Ga0495645_0455585_379_726 115
40 3300046663 Ga0495635_0396250 Ga0495635_0396250_353_700 115
41 3300046683 Ga0495658_0000505 Ga0495658_0000505_5261_5608 115
42 3300047319 Ga0495674_0351444 Ga0495674_0351444_389_736 115
43 3300048088 Ga0495602_0441324 Ga0495602_0441324_546_893 115
44 3300049581 Ga0501047_0561366 Ga0501047_0561366_29_376 115
45 3300049586 Ga0501070_0005781 Ga0501070_0005781_8016_8363 115
46 3300049742 Ga0501080_0403172 Ga0501080_0403172_346_693 115
47 3300049742 Ga0501080_0989212 Ga0501080_0989212_347_694 115
48 3300049744 Ga0501083_0548933 Ga0501083_0548933_356_703 115
49 3300050514 nmdc:mga08x19_130241_c1 nmdc:mga08x19_130241_c1_1254_1601 115
50 3300053732 Ga0500656_036256 Ga0500656_036256_267_614 115
51 3300060353 Ga0501082_1105874 Ga0501082_1105874_292_639 115
52 3300005333 Ga0070677_10171627 Ga0070677_101716272 116
53 3300005340 Ga0070689_100165457 Ga0070689_1001654571 116
54 3300005353 Ga0070669_101443008 Ga0070669_1014430081 116
55 3300005439 Ga0070711_100891716 Ga0070711_1008917162 116
56 3300005459 Ga0068867_100699041 Ga0068867_1006990412 116
57 3300005535 Ga0070684_102330833 Ga0070684_1023308331 116
58 3300005548 Ga0070665_100120945 Ga0070665_1001209452 116
59 3300005563 Ga0068855_100333336 Ga0068855_1003333363 116
60 3300005719 Ga0068861_100597262 Ga0068861_1005972622 116
61 3300005844 Ga0068862_100194280 Ga0068862_1001942802 116
62 3300005844 Ga0068862_101145131 Ga0068862_1011451312 116
63 3300006881 Ga0068865_100364319 Ga0068865_1003643192 116
64 3300009098 Ga0105245_10012871 Ga0105245_100128714 116
65 3300013308 Ga0157375_13461150 Ga0157375_134611502 116
66 3300025916 Ga0207663_10910725 Ga0207663_109107252 116
67 3300025927 Ga0207687_10011198 Ga0207687_100111985 116
68 3300025937 Ga0207669_10674826 Ga0207669_106748262 116
69 3300025949 Ga0207667_11369878 Ga0207667_113698782 116
70 3300026116 Ga0207674_10702733 Ga0207674_107027332 116
71 3300026121 Ga0207683_10203241 Ga0207683_102032412 116
72 3300028380 Ga0268265_10544954 Ga0268265_105449543 116
73 3300028786 Ga0307517_10084056 Ga0307517_100840563 116
74 3300031507 Ga0307509_10521984 Ga0307509_105219842 116
75 3300031727 Ga0316576_10242026 Ga0316576_102420263 116
76 3300033528 Ga0316588_1010360 Ga0316588_10103604 116
77 3300041463 Ga0451804_0440225 Ga0451804_0440225_183_533 116
78 3300041501 Ga0451845_0193759 Ga0451845_0193759_50_400 116
79 3300046511 Ga0495608_0255026 Ga0495608_0255026_447_797 116
80 3300046513 Ga0495616_0219434 Ga0495616_0219434_157_507 116
81 3300046514 Ga0495618_0609172 Ga0495618_0609172_119_469 116
82 3300046524 Ga0495648_0294483 Ga0495648_0294483_106_456 116
83 3300046674 Ga0495588_0278961 Ga0495588_0278961_397_747 116
84 3300046675 Ga0495657_0510485 Ga0495657_0510485_109_459 116
85 3300046692 Ga0495671_0495343 Ga0495671_0495343_16_366 116
86 3300047317 Ga0495604_0407286 Ga0495604_0407286_202_552 116
87 3300047469 Ga0495673_0172394 Ga0495673_0172394_434_784 116
88 3300049570 Ga0501033_0075523 Ga0501033_0075523_1979_2329 116
89 3300049570 Ga0501033_0112343 Ga0501033_0112343_837_1187 116
90 3300049573 Ga0501037_0238800 Ga0501037_0238800_622_972 116
91 3300049579 Ga0501043_0114689 Ga0501043_0114689_41_391 116
92 3300049580 Ga0501046_0438240 Ga0501046_0438240_49_399 116
93 3300049581 Ga0501047_0025453 Ga0501047_0025453_4748_5098 116
94 3300049581 Ga0501047_0957694 Ga0501047_0957694_51_401 116
95 3300049582 Ga0501048_0305039 Ga0501048_0305039_266_616 116
96 3300049590 Ga0501074_0351401 Ga0501074_0351401_522_872 116
97 3300049592 Ga0501076_1121104 Ga0501076_1121104_258_608 116
98 3300049742 Ga0501080_0655475 Ga0501080_0655475_210_560 116
99 3300049742 Ga0501080_0988812 Ga0501080_0988812_358_708 116
100 3300049822 Ga0501035_0005877 Ga0501035_0005877_7298_7648 116
101 3300049823 Ga0501044_0021866 Ga0501044_0021866_3340_3690 116
102 3300053087 Ga0500643_000027 Ga0500643_000027_8907_9257 116
103 3300053090 Ga0500646_0023372 Ga0500646_0023372_690_1040 116
104 3300053119 Ga0500595_008628 Ga0500595_008628_190_540 116
105 3300053154 Ga0500619_200390 Ga0500619_200390_40_390 116
106 3300053163 Ga0500639_234766 Ga0500639_234766_154_504 116
107 3300053735 Ga0500596_084539 Ga0500596_084539_148_498 116
108 3300059424 Ga0590075_004675 Ga0590075_004675_2598_2948 116
109 3300005329 Ga0070683_101731766 Ga0070683_1017317661 117
110 3300005334 Ga0068869_101090956 Ga0068869_1010909561 117
111 3300005337 Ga0070682_100455257 Ga0070682_1004552572 117
112 3300005340 Ga0070689_100120066 Ga0070689_1001200664 117
113 3300005341 Ga0070691_10803974 Ga0070691_108039741 117
114 3300005343 Ga0070687_100463980 Ga0070687_1004639802 117
115 3300005364 Ga0070673_100155029 Ga0070673_1001550292 117
116 3300005436 Ga0070713_100142738 Ga0070713_1001427382 117
117 3300005436 Ga0070713_100997337 Ga0070713_1009973372 117
118 3300005437 Ga0070710_10746333 Ga0070710_107463332 117
119 3300005438 Ga0070701_10462779 Ga0070701_104627792 117
120 3300005439 Ga0070711_100205412 Ga0070711_1002054122 117
121 3300005439 Ga0070711_101271928 Ga0070711_1012719281 117
122 3300005440 Ga0070705_101795220 Ga0070705_1017952201 117
123 3300005441 Ga0070700_100924893 Ga0070700_1009248932 117
124 3300005458 Ga0070681_10252062 Ga0070681_102520623 117
125 3300005530 Ga0070679_100013529 Ga0070679_1000135293 117
126 3300005539 Ga0068853_100005046 Ga0068853_1000050462 117
127 3300005543 Ga0070672_100469836 Ga0070672_1004698362 117
128 3300005544 Ga0070686_100428334 Ga0070686_1004283342 117
129 3300005546 Ga0070696_100373700 Ga0070696_1003737002 117
130 3300005546 Ga0070696_101556995 Ga0070696_1015569951 117
131 3300005564 Ga0070664_100577219 Ga0070664_1005772192 117
132 3300005564 Ga0070664_101402697 Ga0070664_1014026972 117
133 3300005617 Ga0068859_101003281 Ga0068859_1010032812 117
134 3300005842 Ga0068858_101813003 Ga0068858_1018130031 117
135 3300006173 Ga0070716_101251959 Ga0070716_1012519592 117
136 3300006175 Ga0070712_100000260 Ga0070712_1000002603 117
137 3300006237 Ga0097621_100198373 Ga0097621_1001983733 117
138 3300006358 Ga0068871_100652051 Ga0068871_1006520511 117
139 3300006844 Ga0075428_100821526 Ga0075428_1008215262 117
140 3300006846 Ga0075430_100270451 Ga0075430_1002704512 117
141 3300006847 Ga0075431_100942606 Ga0075431_1009426062 117
142 3300006931 Ga0097620_101003078 Ga0097620_1010030782 117
143 3300007788 Ga0099795_10121865 Ga0099795_101218652 117
144 3300007788 Ga0099795_10325531 Ga0099795_103255312 117
145 3300009094 Ga0111539_10087798 Ga0111539_100877986 117
146 3300009094 Ga0111539_11048671 Ga0111539_110486712 117
147 3300009098 Ga0105245_10857292 Ga0105245_108572921 117
148 3300009148 Ga0105243_10842771 Ga0105243_108427711 117
149 3300009176 Ga0105242_10331546 Ga0105242_103315463 117
150 3300009176 Ga0105242_11071477 Ga0105242_110714772 117
151 3300009177 Ga0105248_10754491 Ga0105248_107544913 117
152 3300009551 Ga0105238_10707367 Ga0105238_107073672 117
153 3300009551 Ga0105238_12604252 Ga0105238_126042522 117
154 3300010159 Ga0099796_10035955 Ga0099796_100359551 117
155 3300010375 Ga0105239_12911586 Ga0105239_129115862 117
156 3300013296 Ga0157374_10867556 Ga0157374_108675562 117
157 3300013307 Ga0157372_12081065 Ga0157372_120810651 117
158 3300014968 Ga0157379_11351622 Ga0157379_113516221 117
159 3300025898 Ga0207692_11121205 Ga0207692_111212051 117
160 3300025906 Ga0207699_10017932 Ga0207699_100179322 117
161 3300025912 Ga0207707_10225867 Ga0207707_102258673 117
162 3300025912 Ga0207707_10282634 Ga0207707_102826342 117
163 3300025916 Ga0207663_10062373 Ga0207663_100623733 117
164 3300025916 Ga0207663_11053921 Ga0207663_110539212 117
165 3300025917 Ga0207660_10201148 Ga0207660_102011484 117
166 3300025921 Ga0207652_10006625 Ga0207652_100066253 117
167 3300025924 Ga0207694_10544568 Ga0207694_105445682 117
168 3300025925 Ga0207650_10484453 Ga0207650_104844532 117
169 3300025926 Ga0207659_11403856 Ga0207659_114038561 117
170 3300025927 Ga0207687_10542233 Ga0207687_105422331 117
171 3300025928 Ga0207700_10132116 Ga0207700_101321162 117
172 3300025934 Ga0207686_10729846 Ga0207686_107298461 117
173 3300025934 Ga0207686_10945904 Ga0207686_109459042 117
174 3300025936 Ga0207670_10227156 Ga0207670_102271562 117
175 3300025939 Ga0207665_10079729 Ga0207665_100797292 117
176 3300025940 Ga0207691_10813889 Ga0207691_108138891 117
177 3300025941 Ga0207711_10543755 Ga0207711_105437553 117
178 3300025944 Ga0207661_12006348 Ga0207661_120063481 117
179 3300025945 Ga0207679_10460379 Ga0207679_104603792 117
180 3300025949 Ga0207667_10318986 Ga0207667_103189862 117
181 3300025961 Ga0207712_10571921 Ga0207712_105719212 117
182 3300026035 Ga0207703_11634922 Ga0207703_116349222 117
183 3300026041 Ga0207639_10000110 Ga0207639_100001103 117
184 3300026075 Ga0207708_11304606 Ga0207708_113046061 117
185 3300026075 Ga0207708_11337605 Ga0207708_113376051 117
186 3300027907 Ga0207428_10333207 Ga0207428_103332072 117
187 3300028380 Ga0268265_10255091 Ga0268265_102550912 117
188 3300028800 Ga0265338_10019293 Ga0265338_100192934 117
189 3300031238 Ga0265332_10420741 Ga0265332_104207412 117
190 3300031239 Ga0265328_10249940 Ga0265328_102499402 117
191 3300031241 Ga0265325_10065372 Ga0265325_100653723 117
192 3300031250 Ga0265331_10233170 Ga0265331_102331701 117
193 3300031344 Ga0265316_10318083 Ga0265316_103180833 117
194 3300031711 Ga0265314_10079171 Ga0265314_100791712 117
195 3300031712 Ga0265342_10400187 Ga0265342_104001872 117
196 3300031727 Ga0316576_11050686 Ga0316576_110506861 117
197 3300032168 Ga0316593_10112166 Ga0316593_101121662 117
198 3300033524 Ga0316592_1062170 Ga0316592_10621702 117
199 3300033528 Ga0316588_1014648 Ga0316588_10146482 117
200 3300033528 Ga0316588_1069497 Ga0316588_10694972 117
201 3300033528 Ga0316588_1087984 Ga0316588_10879842 117
202 3300033541 Ga0316596_1146018 Ga0316596_11460181 117
203 3300034957 Ga0373938_0123364 Ga0373938_0123364_141_494 117
204 3300035086 Ga0373934_0455890 Ga0373934_0455890_49_402 117
205 3300035088 Ga0373940_0092237 Ga0373940_0092237_435_788 117
206 3300035111 Ga0373923_0135039 Ga0373923_0135039_577_930 117
207 3300035113 Ga0373936_0069948 Ga0373936_0069948_987_1340 117
208 3300035118 Ga0373954_0092053 Ga0373954_0092053_268_621 117
209 3300035119 Ga0373956_0081692 Ga0373956_0081692_913_1266 117
210 3300035119 Ga0373956_0355429 Ga0373956_0355429_309_662 117
211 3300035172 Ga0373955_0148072 Ga0373955_0148072_27_380 117
212 3300035207 Ga0373942_0055400 Ga0373942_0055400_225_578 117
213 3300035410 Ga0373924_0165768 Ga0373924_0165768_560_913 117
214 3300035691 Ga0373931_0014276 Ga0373931_0014276_2995_3348 117
215 3300035691 Ga0373931_0725983 Ga0373931_0725983_230_583 117
216 3300035692 Ga0373935_0082987 Ga0373935_0082987_265_618 117
217 3300035692 Ga0373935_0569882 Ga0373935_0569882_446_799 117
218 3300035724 Ga0373933_0217871 Ga0373933_0217871_69_422 117
219 3300035725 Ga0373947_0095741 Ga0373947_0095741_255_608 117
220 3300036401 Ga0373937_0004078 Ga0373937_0004078_10687_11040 117
221 3300036401 Ga0373937_0150452 Ga0373937_0150452_1049_1402 117
222 3300036401 Ga0373937_0254195 Ga0373937_0254195_347_700 117
223 3300036401 Ga0373937_0476491 Ga0373937_0476491_593_946 117
224 3300037068 Ga0373925_0177177 Ga0373925_0177177_608_961 117
225 3300037068 Ga0373925_0286158 Ga0373925_0286158_66_419 117
226 3300037068 Ga0373925_0297023 Ga0373925_0297023_388_741 117
227 3300041456 Ga0451795_1272768 Ga0451795_1272768_165_518 117
228 3300041511 Ga0451855_0553907 Ga0451855_0553907_519_872 117
229 3300042001 Ga0439441_028471 Ga0439441_028471_340_693 117
230 3300042013 Ga0439456_172771 Ga0439456_172771_87_440 117
231 3300042436 Ga0439435_0100865 Ga0439435_0100865_215_568 117
232 3300046472 Ga0495580_0360451 Ga0495580_0360451_530_883 117
233 3300046473 Ga0495582_0123555 Ga0495582_0123555_507_860 117
234 3300046535 Ga0495586_0475487 Ga0495586_0475487_34_387 117
235 3300046536 Ga0495587_0139048 Ga0495587_0139048_108_461 117
236 3300046539 Ga0495621_0077828 Ga0495621_0077828_563_916 117
237 3300046543 Ga0495645_0565759 Ga0495645_0565759_328_681 117
238 3300046684 Ga0495669_0234581 Ga0495669_0234581_84_437 117
239 3300046809 Ga0495600_0283182 Ga0495600_0283182_244_597 117
240 3300047315 Ga0495581_0333872 Ga0495581_0333872_43_396 117
241 3300047320 Ga0495672_0259153 Ga0495672_0259153_266_619 117
242 3300047444 Ga0495675_0245789 Ga0495675_0245789_127_480 117
243 3300047444 Ga0495675_0507368 Ga0495675_0507368_23_376 117
244 3300047445 Ga0495677_0098611 Ga0495677_0098611_329_682 117
245 3300049571 Ga0501034_0236902 Ga0501034_0236902_1153_1506 117
246 3300050509 nmdc:mga0qj67_333002_c1 nmdc:mga0qj67_333002_c1_688_1041 117
247 3300050511 nmdc:mga08y16_344379_c1 nmdc:mga08y16_344379_c1_565_918 117
248 3300053085 Ga0495619_0213602 Ga0495619_0213602_668_1021 117
249 3300053085 Ga0495619_0996698 Ga0495619_0996698_74_427 117
250 3300061734 Ga0530510_1051268 Ga0530510_1051268_79_432 117
251 3300005328 Ga0070676_10130046 Ga0070676_101300462 118
252 3300005331 Ga0070670_101173800 Ga0070670_1011738001 118
253 3300005334 Ga0068869_100000648 Ga0068869_10000064817 118
254 3300005336 Ga0070680_100367733 Ga0070680_1003677333 118
255 3300005337 Ga0070682_100013327 Ga0070682_1000133274 118
256 3300005339 Ga0070660_100570507 Ga0070660_1005705072 118
257 3300005341 Ga0070691_10144592 Ga0070691_101445922 118
258 3300005347 Ga0070668_100164246 Ga0070668_1001642463 118
259 3300005347 Ga0070668_101023573 Ga0070668_1010235731 118
260 3300005366 Ga0070659_100036650 Ga0070659_1000366503 118
261 3300005366 Ga0070659_100715235 Ga0070659_1007152352 118
262 3300005437 Ga0070710_10391922 Ga0070710_103919222 118
263 3300005440 Ga0070705_100357516 Ga0070705_1003575161 118
264 3300005440 Ga0070705_101516788 Ga0070705_1015167881 118
265 3300005444 Ga0070694_100092791 Ga0070694_1000927914 118
266 3300005455 Ga0070663_100204061 Ga0070663_1002040611 118
267 3300005458 Ga0070681_10069044 Ga0070681_100690443 118
268 3300005458 Ga0070681_10296565 Ga0070681_102965652 118
269 3300005459 Ga0068867_100895931 Ga0068867_1008959311 118
270 3300005459 Ga0068867_101339499 Ga0068867_1013394991 118
271 3300005467 Ga0070706_100116538 Ga0070706_1001165385 118
272 3300005530 Ga0070679_100008091 Ga0070679_10000809113 118
273 3300005530 Ga0070679_100012659 Ga0070679_10001265914 118
274 3300005539 Ga0068853_100051500 Ga0068853_1000515002 118
275 3300005539 Ga0068853_100304272 Ga0068853_1003042724 118
276 3300005539 Ga0068853_100666574 Ga0068853_1006665741 118
277 3300005545 Ga0070695_100100733 Ga0070695_1001007333 118
278 3300005546 Ga0070696_100037829 Ga0070696_1000378293 118
279 3300005547 Ga0070693_100007429 Ga0070693_1000074297 118
280 3300005548 Ga0070665_100170356 Ga0070665_1001703563 118
281 3300005548 Ga0070665_100695112 Ga0070665_1006951123 118
282 3300005548 Ga0070665_100777546 Ga0070665_1007775461 118
283 3300005563 Ga0068855_100179349 Ga0068855_1001793493 118
284 3300005563 Ga0068855_100323590 Ga0068855_1003235903 118
285 3300005563 Ga0068855_100825687 Ga0068855_1008256871 118
286 3300005564 Ga0070664_100049081 Ga0070664_1000490813 118
287 3300005577 Ga0068857_100083824 Ga0068857_1000838242 118
288 3300005577 Ga0068857_100703897 Ga0068857_1007038973 118
289 3300005614 Ga0068856_100091537 Ga0068856_1000915376 118
290 3300005615 Ga0070702_101047230 Ga0070702_1010472301 118
291 3300005616 Ga0068852_101485359 Ga0068852_1014853591 118
292 3300005719 Ga0068861_100517401 Ga0068861_1005174012 118
293 3300005834 Ga0068851_10129678 Ga0068851_101296781 118
294 3300005842 Ga0068858_100294439 Ga0068858_1002944393 118
295 3300006038 Ga0075365_10158024 Ga0075365_101580243 118
296 3300006237 Ga0097621_100203980 Ga0097621_1002039802 118
297 3300006358 Ga0068871_100485462 Ga0068871_1004854622 118
298 3300006358 Ga0068871_101280980 Ga0068871_1012809802 118
299 3300009098 Ga0105245_11814621 Ga0105245_118146211 118
300 3300009101 Ga0105247_10302993 Ga0105247_103029932 118
301 3300009101 Ga0105247_10505417 Ga0105247_105054171 118
302 3300009174 Ga0105241_10018566 Ga0105241_100185663 118
303 3300009174 Ga0105241_10052353 Ga0105241_100523532 118
304 3300009176 Ga0105242_10116976 Ga0105242_101169761 118
305 3300009176 Ga0105242_10721450 Ga0105242_107214502 118
306 3300009177 Ga0105248_11165711 Ga0105248_111657111 118
307 3300009177 Ga0105248_12275855 Ga0105248_122758552 118
308 3300009545 Ga0105237_10057156 Ga0105237_100571562 118
309 3300009545 Ga0105237_10065812 Ga0105237_100658124 118
310 3300009545 Ga0105237_10072752 Ga0105237_100727522 118
311 3300009551 Ga0105238_10024943 Ga0105238_1002494311 118
312 3300009551 Ga0105238_10105601 Ga0105238_101056013 118
313 3300009553 Ga0105249_10677691 Ga0105249_106776912 118
314 3300010375 Ga0105239_10295447 Ga0105239_102954472 118
315 3300011119 Ga0105246_10031393 Ga0105246_100313933 118
316 3300013100 Ga0157373_10560911 Ga0157373_105609112 118
317 3300013105 Ga0157369_10082075 Ga0157369_100820753 118
318 3300013297 Ga0157378_10042694 Ga0157378_100426942 118
319 3300013306 Ga0163162_11137911 Ga0163162_111379112 118
320 3300013306 Ga0163162_12199975 Ga0163162_121999752 118
321 3300014325 Ga0163163_10277109 Ga0163163_102771092 118
322 3300014745 Ga0157377_10661194 Ga0157377_106611943 118
323 3300014968 Ga0157379_10118980 Ga0157379_101189802 118
324 3300014968 Ga0157379_10534253 Ga0157379_105342533 118
325 3300014969 Ga0157376_10117239 Ga0157376_101172394 118
326 3300014969 Ga0157376_10524184 Ga0157376_105241842 118
327 3300025900 Ga0207710_10260677 Ga0207710_102606771 118
328 3300025901 Ga0207688_10152566 Ga0207688_101525662 118
329 3300025904 Ga0207647_10426287 Ga0207647_104262871 118
330 3300025904 Ga0207647_10519964 Ga0207647_105199641 118
331 3300025907 Ga0207645_10411411 Ga0207645_104114111 118
332 3300025909 Ga0207705_10197407 Ga0207705_101974074 118
333 3300025910 Ga0207684_10145807 Ga0207684_101458072 118
334 3300025911 Ga0207654_10113188 Ga0207654_101131884 118
335 3300025911 Ga0207654_10157969 Ga0207654_101579691 118
336 3300025911 Ga0207654_10676042 Ga0207654_106760422 118
337 3300025912 Ga0207707_10148459 Ga0207707_101484592 118
338 3300025913 Ga0207695_10016369 Ga0207695_100163693 118
339 3300025914 Ga0207671_10142134 Ga0207671_101421342 118
340 3300025914 Ga0207671_11107428 Ga0207671_111074281 118
341 3300025917 Ga0207660_10093899 Ga0207660_100938992 118
342 3300025917 Ga0207660_10594421 Ga0207660_105944212 118
343 3300025919 Ga0207657_10080802 Ga0207657_100808022 118
344 3300025919 Ga0207657_10270451 Ga0207657_102704512 118
345 3300025920 Ga0207649_10783559 Ga0207649_107835591 118
346 3300025921 Ga0207652_10214845 Ga0207652_102148452 118
347 3300025921 Ga0207652_10439439 Ga0207652_104394392 118
348 3300025924 Ga0207694_10022041 Ga0207694_100220412 118
349 3300025932 Ga0207690_10674005 Ga0207690_106740052 118
350 3300025933 Ga0207706_10070153 Ga0207706_100701536 118
351 3300025933 Ga0207706_10838055 Ga0207706_108380552 118
352 3300025934 Ga0207686_10232000 Ga0207686_102320002 118
353 3300025934 Ga0207686_10621796 Ga0207686_106217962 118
354 3300025938 Ga0207704_10484910 Ga0207704_104849102 118
355 3300025941 Ga0207711_10364780 Ga0207711_103647802 118
356 3300025942 Ga0207689_10004086 Ga0207689_1000408613 118
357 3300025945 Ga0207679_10031200 Ga0207679_100312005 118
358 3300025949 Ga0207667_10014360 Ga0207667_100143606 118
359 3300025981 Ga0207640_10204133 Ga0207640_102041332 118
360 3300026023 Ga0207677_11875554 Ga0207677_118755541 118
361 3300026035 Ga0207703_10681632 Ga0207703_106816321 118
362 3300026041 Ga0207639_10195786 Ga0207639_101957862 118
363 3300026041 Ga0207639_10209383 Ga0207639_102093832 118
364 3300026067 Ga0207678_10001937 Ga0207678_1000193722 118
365 3300026078 Ga0207702_10447555 Ga0207702_104475552 118
366 3300026089 Ga0207648_10583042 Ga0207648_105830422 118
367 3300026089 Ga0207648_11438402 Ga0207648_114384021 118
368 3300026116 Ga0207674_10008622 Ga0207674_100086222 118
369 3300026116 Ga0207674_10190454 Ga0207674_101904541 118
370 3300026118 Ga0207675_100391408 Ga0207675_1003914082 118
371 3300026121 Ga0207683_10269921 Ga0207683_102699212 118
372 3300026142 Ga0207698_11300455 Ga0207698_113004551 118
373 3300028379 Ga0268266_11285187 Ga0268266_112851871 118
374 3300028381 Ga0268264_12208457 Ga0268264_122084571 118
375 3300028556 Ga0265337_1005176 Ga0265337_10051764 118
376 3300028573 Ga0265334_10042413 Ga0265334_100424132 118
377 3300028800 Ga0265338_10020650 Ga0265338_100206503 118
378 3300028800 Ga0265338_11078691 Ga0265338_110786912 118
379 3300031235 Ga0265330_10076650 Ga0265330_100766502 118
380 3300031238 Ga0265332_10245413 Ga0265332_102454132 118
381 3300031239 Ga0265328_10094053 Ga0265328_100940533 118
382 3300031241 Ga0265325_10297512 Ga0265325_102975122 118
383 3300031242 Ga0265329_10078473 Ga0265329_100784732 118
384 3300031249 Ga0265339_10042381 Ga0265339_100423814 118
385 3300031249 Ga0265339_10063039 Ga0265339_100630394 118
386 3300031250 Ga0265331_10019540 Ga0265331_100195403 118
387 3300031595 Ga0265313_10098103 Ga0265313_100981032 118
388 3300031711 Ga0265314_10189779 Ga0265314_101897792 118
389 3300031712 Ga0265342_10115446 Ga0265342_101154463 118
390 3300031727 Ga0316576_10226937 Ga0316576_102269372 118
391 3300031727 Ga0316576_10278277 Ga0316576_102782772 118
392 3300031728 Ga0316578_10082081 Ga0316578_100820813 118
393 3300032126 Ga0307415_102041530 Ga0307415_1020415301 118
394 3300032139 Ga0316580_10019816 Ga0316580_100198164 118
395 3300033524 Ga0316592_1051014 Ga0316592_10510141 118
396 3300035113 Ga0373936_0040723 Ga0373936_0040723_707_1063 118
397 3300036401 Ga0373937_0178127 Ga0373937_0178127_316_672 118
398 3300037312 Ga0395899_0316229 Ga0395899_0316229_315_671 118
399 3300037312 Ga0395899_0697649 Ga0395899_0697649_87_458 118
400 3300037418 Ga0395900_0075894 Ga0395900_0075894_3006_3407 118
401 3300037418 Ga0395900_0172754 Ga0395900_0172754_364_720 118
402 3300037466 Ga0395898_0013705 Ga0395898_0013705_6171_6527 118
403 3300037466 Ga0395898_0289354 Ga0395898_0289354_857_1258 118
404 3300038443 Ga0395901_0026910 Ga0395901_0026910_723_1079 118
405 3300038443 Ga0395901_0910084 Ga0395901_0910084_16_417 118
406 3300038726 Ga0400490_14970 Ga0400490_14970_202_558 118
407 3300039437 Ga0436365_0456767 Ga0436365_0456767_532_891 118
408 3300041494 Ga0451837_0593073 Ga0451837_0593073_266_625 118
409 3300041505 Ga0451849_1305590 Ga0451849_1305590_135_500 118
410 3300041509 Ga0451843_0962993 Ga0451843_0962993_595_954 118
411 3300044694 Ga0466963_1147881 Ga0466963_1147881_87_452 118
412 3300045049 Ga0466959_0958507 Ga0466959_0958507_98_454 118
413 3300045836 Ga0466958_0389526 Ga0466958_0389526_223_579 118
414 3300046452 Ga0495617_264957 Ga0495617_264957_62_421 118
415 3300046476 Ga0495662_0656017 Ga0495662_0656017_44_400 118
416 3300046477 Ga0495664_0928721 Ga0495664_0928721_97_453 118
417 3300046506 Ga0495583_0430853 Ga0495583_0430853_77_433 118
418 3300046536 Ga0495587_0017150 Ga0495587_0017150_2492_2848 118
419 3300046557 Ga0495622_0259044 Ga0495622_0259044_168_524 118
420 3300046675 Ga0495657_0739496 Ga0495657_0739496_35_391 118
421 3300048088 Ga0495602_0057448 Ga0495602_0057448_1308_1664 118
422 3300048904 Ga0496101_0012243 Ga0496101_0012243_204_611 118
423 3300048905 Ga0496102_0157832 Ga0496102_0157832_267_674 118
424 3300048906 Ga0496103_0128306 Ga0496103_0128306_362_769 118
425 3300048906 Ga0496103_0202574 Ga0496103_0202574_72_479 118
426 3300048907 Ga0496104_0052893 Ga0496104_0052893_1741_2148 118
427 3300048908 Ga0496105_0449289 Ga0496105_0449289_380_787 118
428 3300048909 Ga0496106_0015255 Ga0496106_0015255_1798_2205 118
429 3300048910 Ga0496107_0121259 Ga0496107_0121259_880_1287 118
430 3300048910 Ga0496107_0722523 Ga0496107_0722523_270_626 118
431 3300048911 Ga0496108_0545237 Ga0496108_0545237_257_664 118
432 3300048912 Ga0496109_1093934 Ga0496109_1093934_210_617 118
433 3300048914 Ga0496111_0859794 Ga0496111_0859794_138_545 118
434 3300048916 Ga0496113_1015053 Ga0496113_1015053_83_460 118
435 3300048920 Ga0496117_0236185 Ga0496117_0236185_36_437 118
436 3300048929 Ga0496126_0293496 Ga0496126_0293496_370_771 118
437 3300049568 Ga0501031_0186704 Ga0501031_0186704_670_1071 118
438 3300049569 Ga0501032_0013776 Ga0501032_0013776_3563_3964 118
439 3300049570 Ga0501033_0220877 Ga0501033_0220877_418_819 118
440 3300049571 Ga0501034_0000068 Ga0501034_0000068_6335_6736 118
441 3300049571 Ga0501034_0006843 Ga0501034_0006843_4839_5240 118
442 3300049572 Ga0501036_0130420 Ga0501036_0130420_849_1250 118
443 3300049572 Ga0501036_1114971 Ga0501036_1114971_276_632 118
444 3300049573 Ga0501037_0008627 Ga0501037_0008627_6583_6984 118
445 3300049573 Ga0501037_0077451 Ga0501037_0077451_51_407 118
446 3300049574 Ga0501038_0080357 Ga0501038_0080357_2063_2464 118
447 3300049574 Ga0501038_0156439 Ga0501038_0156439_877_1278 118
448 3300049574 Ga0501038_0269346 Ga0501038_0269346_587_943 118
449 3300049575 Ga0501039_0000205 Ga0501039_0000205_18187_18588 118
450 3300049576 Ga0501040_0277575 Ga0501040_0277575_736_1137 118
451 3300049579 Ga0501043_0074585 Ga0501043_0074585_1729_2130 118
452 3300049579 Ga0501043_0198500 Ga0501043_0198500_995_1351 118
453 3300049579 Ga0501043_0460734 Ga0501043_0460734_76_477 118
454 3300049580 Ga0501046_0007334 Ga0501046_0007334_8632_9033 118
455 3300049580 Ga0501046_0030319 Ga0501046_0030319_1989_2390 118
456 3300049581 Ga0501047_0000152 Ga0501047_0000152_21345_21746 118
457 3300049581 Ga0501047_0092493 Ga0501047_0092493_1581_1937 118
458 3300049581 Ga0501047_0137513 Ga0501047_0137513_1591_1992 118
459 3300049581 Ga0501047_0387396 Ga0501047_0387396_195_551 118
460 3300049582 Ga0501048_0002175 Ga0501048_0002175_13011_13388 118
461 3300049583 Ga0501067_0018422 Ga0501067_0018422_1785_2186 118
462 3300049583 Ga0501067_0020300 Ga0501067_0020300_1506_1907 118
463 3300049586 Ga0501070_0035400 Ga0501070_0035400_2996_3397 118
464 3300049586 Ga0501070_0206265 Ga0501070_0206265_910_1311 118
465 3300049586 Ga0501070_0209042 Ga0501070_0209042_479_835 118
466 3300049586 Ga0501070_0562077 Ga0501070_0562077_204_605 118
467 3300049589 Ga0501073_0238742 Ga0501073_0238742_632_1033 118
468 3300049589 Ga0501073_0351539 Ga0501073_0351539_345_704 118
469 3300049589 Ga0501073_1210338 Ga0501073_1210338_58_459 118
470 3300049590 Ga0501074_0105461 Ga0501074_0105461_889_1290 118
471 3300049742 Ga0501080_0000001 Ga0501080_0000001_105104_105505 118
472 3300049742 Ga0501080_1000868 Ga0501080_1000868_46_405 118
473 3300049744 Ga0501083_0323502 Ga0501083_0323502_423_782 118
474 3300049822 Ga0501035_0000015 Ga0501035_0000015_186436_186837 118
475 3300049822 Ga0501035_0030838 Ga0501035_0030838_2166_2522 118
476 3300049822 Ga0501035_0091158 Ga0501035_0091158_1701_2102 118
477 3300049823 Ga0501044_0000390 Ga0501044_0000390_25346_25747 118
478 3300049823 Ga0501044_0050955 Ga0501044_0050955_1045_1401 118
479 3300049823 Ga0501044_0433866 Ga0501044_0433866_664_1065 118
480 3300049823 Ga0501044_0618516 Ga0501044_0618516_251_652 118
481 3300049824 Ga0501045_0142665 Ga0501045_0142665_117_518 118
482 3300050491 nmdc:mga00v17_116641_c1 nmdc:mga00v17_116641_c1_899_1258 118
483 3300050491 nmdc:mga00v17_7378_c1 nmdc:mga00v17_7378_c1_3608_3967 118
484 3300053083 Ga0495655_0153712 Ga0495655_0153712_10_417 118
485 3300053098 Ga0500650_0284384 Ga0500650_0284384_166_522 118
486 3300053119 Ga0500595_014502 Ga0500595_014502_190_591 118
487 3300053119 Ga0500595_127329 Ga0500595_127329_285_641 118
488 3300053153 Ga0500616_0007417 Ga0500616_0007417_5855_6256 118
489 3300060353 Ga0501082_0022902 Ga0501082_0022902_3585_3986 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

3

109

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8809 61 116
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8318 51 116
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8168 61 116
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.7998 51 116
4v5m-assembly1.cif.gz_BU trna tranlocation on the 70s ribosome: the pre-translocational translocation intermediate ti(pre) 0.7148 11 118
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9312 53 116 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.894 55 117 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8809 61 116 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8529 53 116 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8431 55 117 1.10.1900.20
ID Description Score Start End GO Terms
AF-A0A2D8YKH1-F1-model_v4 deleted 1.008 58 116
AF-A0A659UR08-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.007 57 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A357L7L9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.007 61 117 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7G2DR74-F1-model_v4 Large ribosomal subunit protein bL20c (50S ribosomal protein L20, chloroplastic) 1.005 58 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-X8FDF3-F1-model_v4 deleted 1.005 61 116

Feature Viewer

pLDDT pTM Quality
82.98 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map