F453730
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 489 | 290 | 486 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_101173800|Ga0070670_1011738001 |
| Length | 135 |
| Sequence | MSRAPRAVPSRLRRKRVFKQAKGFYGRRKNNITSANAAVDRSMQYAYVGRKLKKRNFRALWIQRINAAVREHGLTYGRFINGLSNLGLEVDRKVLSDIAINDPAGFKALVDKAAAAASSPVAKADADKAKTKKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 2 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 3 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 141 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 143 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 147 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 148 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 150 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 154 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 158 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 161 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 166 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 196 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 197 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 198 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 199 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 200 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 201 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 202 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 203 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 249 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 250 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 280 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 281 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 282 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 283 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 284 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 285 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 286 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 287 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 288 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 289 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.34 |
| Metatranscriptomes | 2.04 |
| Isolates | 0.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.86 |
| Nodule | 0.2 |
| Rhizoplane | 3.07 |
| Rhizosphere | 90.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10130046 | 3300005328 | Bacteria | 1591 |
| 2 | Ga0070683_101731766 | 3300005329 | Bacteria | 601 |
| 3 | Ga0070670_101173800 | 3300005331 | Bacteria | 701 |
| 4 | Ga0070677_10171627 | 3300005333 | Bacteria | 1026 |
| 5 | Ga0068869_100000648 | 3300005334 | Bacteria | 19658 |
| 6 | Ga0068869_101090956 | 3300005334 | Bacteria | 698 |
| 7 | Ga0070680_100367733 | 3300005336 | Bacteria | 1223 |
| 8 | Ga0070682_100013327 | 3300005337 | Bacteria | 4727 |
| 9 | Ga0070682_100455257 | 3300005337 | Bacteria | 981 |
| 10 | Ga0070660_100570507 | 3300005339 | Bacteria | 945 |
| 11 | Ga0070689_100120066 | 3300005340 | Bacteria | 2099 |
| 12 | Ga0070689_100165457 | 3300005340 | Bacteria | 1790 |
| 13 | Ga0070691_10144592 | 3300005341 | Bacteria | 1215 |
| 14 | Ga0070691_10803974 | 3300005341 | Bacteria | 573 |
| 15 | Ga0070687_100463980 | 3300005343 | Bacteria | 845 |
| 16 | Ga0070668_100164246 | 3300005347 | Bacteria | 1804 |
| 17 | Ga0070668_101023573 | 3300005347 | Bacteria | 743 |
| 18 | Ga0070669_101443008 | 3300005353 | Bacteria | 598 |
| 19 | Ga0070673_100155029 | 3300005364 | Bacteria | 1943 |
| 20 | Ga0070659_100036650 | 3300005366 | Bacteria | 3823 |
| 21 | Ga0070659_100715235 | 3300005366 | Bacteria | 867 |
| 22 | Ga0070713_100142738 | 3300005436 | Bacteria | 2123 |
| 23 | Ga0070713_100997337 | 3300005436 | Unclassified | 808 |
| 24 | Ga0070710_10391922 | 3300005437 | Unclassified | 929 |
| 25 | Ga0070710_10746333 | 3300005437 | Bacteria | 695 |
| 26 | Ga0070701_10462779 | 3300005438 | Bacteria | 816 |
| 27 | Ga0070711_100205412 | 3300005439 | Bacteria | 1523 |
| 28 | Ga0070711_100891716 | 3300005439 | Bacteria | 759 |
| 29 | Ga0070711_101271928 | 3300005439 | Bacteria | 638 |
| 30 | Ga0070705_100357516 | 3300005440 | Bacteria | 1067 |
| 31 | Ga0070705_101516788 | 3300005440 | Bacteria | 562 |
| 32 | Ga0070705_101795220 | 3300005440 | Bacteria | 520 |
| 33 | Ga0070700_100924893 | 3300005441 | Bacteria | 712 |
| 34 | Ga0070694_100092791 | 3300005444 | Bacteria | 2121 |
| 35 | Ga0070663_100204061 | 3300005455 | Bacteria | 1544 |
| 36 | Ga0070681_10069044 | 3300005458 | Bacteria | 3501 |
| 37 | Ga0070681_10252062 | 3300005458 | Bacteria | 1677 |
| 38 | Ga0070681_10296565 | 3300005458 | Bacteria | 1526 |
| 39 | Ga0070681_11169241 | 3300005458 | Bacteria | 691 |
| 40 | Ga0068867_100699041 | 3300005459 | Bacteria | 894 |
| 41 | Ga0068867_100895931 | 3300005459 | Bacteria | 798 |
| 42 | Ga0068867_101339499 | 3300005459 | Bacteria | 662 |
| 43 | Ga0070706_100116538 | 3300005467 | Unclassified | 2488 |
| 44 | Ga0070679_100008091 | 3300005530 | Bacteria | 9881 |
| 45 | Ga0070679_100012659 | 3300005530 | Bacteria | 8068 |
| 46 | Ga0070679_100013529 | 3300005530 | Bacteria | 7818 |
| 47 | Ga0070684_102330833 | 3300005535 | Bacteria | 505 |
| 48 | Ga0068853_100005046 | 3300005539 | Bacteria | 10299 |
| 49 | Ga0068853_100051500 | 3300005539 | Bacteria | 3543 |
| 50 | Ga0068853_100304272 | 3300005539 | Bacteria | 1474 |
| 51 | Ga0068853_100666574 | 3300005539 | Bacteria | 991 |
| 52 | Ga0068853_100685740 | 3300005539 | Bacteria | 977 |
| 53 | Ga0070672_100469836 | 3300005543 | Bacteria | 1085 |
| 54 | Ga0070686_100428334 | 3300005544 | Bacteria | 1012 |
| 55 | Ga0070695_100100733 | 3300005545 | Bacteria | 1945 |
| 56 | Ga0070696_100037829 | 3300005546 | Bacteria | 3328 |
| 57 | Ga0070696_100373700 | 3300005546 | Bacteria | 1109 |
| 58 | Ga0070696_101556995 | 3300005546 | Bacteria | 567 |
| 59 | Ga0070693_100007429 | 3300005547 | Bacteria | 5358 |
| 60 | Ga0070665_100120945 | 3300005548 | Bacteria | 2620 |
| 61 | Ga0070665_100170356 | 3300005548 | Bacteria | 2178 |
| 62 | Ga0070665_100695112 | 3300005548 | Bacteria | 1030 |
| 63 | Ga0070665_100777546 | 3300005548 | Bacteria | 970 |
| 64 | Ga0068855_100179349 | 3300005563 | Bacteria | 2395 |
| 65 | Ga0068855_100323590 | 3300005563 | Bacteria | 1704 |
| 66 | Ga0068855_100333336 | 3300005563 | Bacteria | 1674 |
| 67 | Ga0068855_100825687 | 3300005563 | Bacteria | 984 |
| 68 | Ga0070664_100049081 | 3300005564 | Bacteria | 3569 |
| 69 | Ga0070664_100577219 | 3300005564 | Bacteria | 1041 |
| 70 | Ga0070664_101402697 | 3300005564 | Bacteria | 660 |
| 71 | Ga0068857_100083824 | 3300005577 | Bacteria | 2848 |
| 72 | Ga0068857_100703897 | 3300005577 | Bacteria | 960 |
| 73 | Ga0068856_100091537 | 3300005614 | Bacteria | 3025 |
| 74 | Ga0070702_101047230 | 3300005615 | Bacteria | 649 |
| 75 | Ga0068852_101485359 | 3300005616 | Bacteria | 700 |
| 76 | Ga0068859_100279537 | 3300005617 | Bacteria | 1762 |
| 77 | Ga0068859_101003281 | 3300005617 | Bacteria | 917 |
| 78 | Ga0068861_100517401 | 3300005719 | Bacteria | 1082 |
| 79 | Ga0068861_100597262 | 3300005719 | Bacteria | 1012 |
| 80 | Ga0068851_10129678 | 3300005834 | Bacteria | 1363 |
| 81 | Ga0068858_100294439 | 3300005842 | Bacteria | 1547 |
| 82 | Ga0068858_101813003 | 3300005842 | Bacteria | 603 |
| 83 | Ga0068862_100194280 | 3300005844 | Bacteria | 1827 |
| 84 | Ga0068862_101145131 | 3300005844 | Bacteria | 774 |
| 85 | Ga0075365_10158024 | 3300006038 | Bacteria | 1578 |
| 86 | Ga0070716_101251959 | 3300006173 | Bacteria | 598 |
| 87 | Ga0070712_100000260 | 3300006175 | Bacteria | 29575 |
| 88 | Ga0097621_100198373 | 3300006237 | Bacteria | 1741 |
| 89 | Ga0097621_100203980 | 3300006237 | Bacteria | 1718 |
| 90 | Ga0068871_100485462 | 3300006358 | Bacteria | 1112 |
| 91 | Ga0068871_100652051 | 3300006358 | Bacteria | 961 |
| 92 | Ga0068871_101280980 | 3300006358 | Bacteria | 689 |
| 93 | Ga0075428_100821526 | 3300006844 | Bacteria | 987 |
| 94 | Ga0075430_100270451 | 3300006846 | Bacteria | 1406 |
| 95 | Ga0075431_100942606 | 3300006847 | Bacteria | 832 |
| 96 | Ga0068865_100364319 | 3300006881 | Bacteria | 1175 |
| 97 | Ga0075436_101261119 | 3300006914 | Bacteria | 559 |
| 98 | Ga0097620_100279527 | 3300006931 | Bacteria | 1762 |
| 99 | Ga0097620_101003078 | 3300006931 | Bacteria | 917 |
| 100 | Ga0099795_10121865 | 3300007788 | Bacteria | 1044 |
| 101 | Ga0099795_10325531 | 3300007788 | Bacteria | 682 |
| 102 | Ga0111539_10087798 | 3300009094 | Bacteria | 3653 |
| 103 | Ga0111539_11048671 | 3300009094 | Bacteria | 948 |
| 104 | Ga0105245_10012871 | 3300009098 | Bacteria | 7291 |
| 105 | Ga0105245_10857292 | 3300009098 | Bacteria | 949 |
| 106 | Ga0105245_11814621 | 3300009098 | Bacteria | 663 |
| 107 | Ga0105247_10302993 | 3300009101 | Bacteria | 1109 |
| 108 | Ga0105247_10505417 | 3300009101 | Bacteria | 881 |
| 109 | Ga0105243_10842771 | 3300009148 | Bacteria | 907 |
| 110 | Ga0105241_10018566 | 3300009174 | Bacteria | 5117 |
| 111 | Ga0105241_10052353 | 3300009174 | Bacteria | 3116 |
| 112 | Ga0105242_10065815 | 3300009176 | Bacteria | 2991 |
| 113 | Ga0105242_10116976 | 3300009176 | Bacteria | 2282 |
| 114 | Ga0105242_10331546 | 3300009176 | Bacteria | 1399 |
| 115 | Ga0105242_10721450 | 3300009176 | Bacteria | 978 |
| 116 | Ga0105242_11071477 | 3300009176 | Bacteria | 818 |
| 117 | Ga0105248_10754491 | 3300009177 | Bacteria | 1098 |
| 118 | Ga0105248_11165711 | 3300009177 | Bacteria | 871 |
| 119 | Ga0105248_12275855 | 3300009177 | Bacteria | 617 |
| 120 | Ga0105237_10057156 | 3300009545 | Bacteria | 3905 |
| 121 | Ga0105237_10065812 | 3300009545 | Bacteria | 3619 |
| 122 | Ga0105237_10072752 | 3300009545 | Bacteria | 3431 |
| 123 | Ga0105238_10024943 | 3300009551 | Bacteria | 6094 |
| 124 | Ga0105238_10105601 | 3300009551 | Bacteria | 2798 |
| 125 | Ga0105238_10707367 | 3300009551 | Bacteria | 1020 |
| 126 | Ga0105238_12604252 | 3300009551 | Bacteria | 542 |
| 127 | Ga0105249_10677691 | 3300009553 | Bacteria | 1090 |
| 128 | Ga0099796_10035955 | 3300010159 | Bacteria | 1646 |
| 129 | Ga0105239_10295447 | 3300010375 | Bacteria | 1824 |
| 130 | Ga0105239_12911586 | 3300010375 | Bacteria | 558 |
| 131 | Ga0105246_10031393 | 3300011119 | Bacteria | 3515 |
| 132 | Ga0157373_10560911 | 3300013100 | Bacteria | 829 |
| 133 | Ga0157369_10082075 | 3300013105 | Bacteria | 3449 |
| 134 | Ga0157374_10867556 | 3300013296 | Bacteria | 920 |
| 135 | Ga0157378_10042694 | 3300013297 | Bacteria | 4025 |
| 136 | Ga0163162_11137911 | 3300013306 | Bacteria | 885 |
| 137 | Ga0163162_12199975 | 3300013306 | Bacteria | 633 |
| 138 | Ga0157372_12081065 | 3300013307 | Bacteria | 652 |
| 139 | Ga0157375_13461150 | 3300013308 | Bacteria | 525 |
| 140 | Ga0163163_10277109 | 3300014325 | Bacteria | 1728 |
| 141 | Ga0157380_11428033 | 3300014326 | Bacteria | 743 |
| 142 | Ga0157377_10661194 | 3300014745 | Bacteria | 753 |
| 143 | Ga0157379_10118980 | 3300014968 | Bacteria | 2376 |
| 144 | Ga0157379_10534253 | 3300014968 | Bacteria | 1090 |
| 145 | Ga0157379_11351622 | 3300014968 | Bacteria | 689 |
| 146 | Ga0157376_10117239 | 3300014969 | Bacteria | 2354 |
| 147 | Ga0157376_10524184 | 3300014969 | Bacteria | 1168 |
| 148 | Ga0207692_11121205 | 3300025898 | Bacteria | 521 |
| 149 | Ga0207710_10260677 | 3300025900 | Bacteria | 868 |
| 150 | Ga0207688_10152566 | 3300025901 | Bacteria | 1365 |
| 151 | Ga0207647_10426287 | 3300025904 | Bacteria | 745 |
| 152 | Ga0207647_10519964 | 3300025904 | Bacteria | 662 |
| 153 | Ga0207699_10017932 | 3300025906 | Bacteria | 3741 |
| 154 | Ga0207645_10411411 | 3300025907 | Bacteria | 910 |
| 155 | Ga0207705_10197407 | 3300025909 | Bacteria | 1524 |
| 156 | Ga0207705_10406764 | 3300025909 | Bacteria | 1053 |
| 157 | Ga0207684_10145807 | 3300025910 | Bacteria | 2036 |
| 158 | Ga0207654_10113188 | 3300025911 | Bacteria | 1692 |
| 159 | Ga0207654_10157969 | 3300025911 | Bacteria | 1462 |
| 160 | Ga0207654_10676042 | 3300025911 | Bacteria | 741 |
| 161 | Ga0207707_10148459 | 3300025912 | Bacteria | 2050 |
| 162 | Ga0207707_10225867 | 3300025912 | Bacteria | 1629 |
| 163 | Ga0207707_10282634 | 3300025912 | Bacteria | 1437 |
| 164 | Ga0207695_10016369 | 3300025913 | Bacteria | 8678 |
| 165 | Ga0207671_10142134 | 3300025914 | Bacteria | 1850 |
| 166 | Ga0207671_11107428 | 3300025914 | Bacteria | 622 |
| 167 | Ga0207663_10062373 | 3300025916 | Bacteria | 2369 |
| 168 | Ga0207663_10839299 | 3300025916 | Bacteria | 733 |
| 169 | Ga0207663_10910725 | 3300025916 | Bacteria | 703 |
| 170 | Ga0207663_11053921 | 3300025916 | Bacteria | 653 |
| 171 | Ga0207660_10093899 | 3300025917 | Bacteria | 2229 |
| 172 | Ga0207660_10201148 | 3300025917 | Bacteria | 1556 |
| 173 | Ga0207660_10594421 | 3300025917 | Bacteria | 901 |
| 174 | Ga0207657_10080802 | 3300025919 | Bacteria | 2732 |
| 175 | Ga0207657_10270451 | 3300025919 | Bacteria | 1351 |
| 176 | Ga0207649_10783559 | 3300025920 | Bacteria | 743 |
| 177 | Ga0207652_10006625 | 3300025921 | Bacteria | 9331 |
| 178 | Ga0207652_10214845 | 3300025921 | Bacteria | 1732 |
| 179 | Ga0207652_10439439 | 3300025921 | Bacteria | 1176 |
| 180 | Ga0207694_10022041 | 3300025924 | Bacteria | 4831 |
| 181 | Ga0207694_10544568 | 3300025924 | Bacteria | 974 |
| 182 | Ga0207650_10484453 | 3300025925 | Bacteria | 1032 |
| 183 | Ga0207659_11403856 | 3300025926 | Bacteria | 598 |
| 184 | Ga0207687_10011198 | 3300025927 | Bacteria | 5857 |
| 185 | Ga0207687_10542233 | 3300025927 | Bacteria | 975 |
| 186 | Ga0207700_10132116 | 3300025928 | Bacteria | 2040 |
| 187 | Ga0207664_10785487 | 3300025929 | Bacteria | 857 |
| 188 | Ga0207690_10674005 | 3300025932 | Bacteria | 849 |
| 189 | Ga0207706_10070153 | 3300025933 | Bacteria | 3082 |
| 190 | Ga0207706_10838055 | 3300025933 | Bacteria | 779 |
| 191 | Ga0207686_10232000 | 3300025934 | Bacteria | 1339 |
| 192 | Ga0207686_10621796 | 3300025934 | Bacteria | 852 |
| 193 | Ga0207686_10729846 | 3300025934 | Bacteria | 789 |
| 194 | Ga0207686_10945904 | 3300025934 | Bacteria | 697 |
| 195 | Ga0207670_10227156 | 3300025936 | Bacteria | 1432 |
| 196 | Ga0207669_10674826 | 3300025937 | Bacteria | 847 |
| 197 | Ga0207704_10484910 | 3300025938 | Bacteria | 993 |
| 198 | Ga0207665_10079729 | 3300025939 | Bacteria | 2251 |
| 199 | Ga0207691_10813889 | 3300025940 | Bacteria | 785 |
| 200 | Ga0207711_10364780 | 3300025941 | Bacteria | 1339 |
| 201 | Ga0207711_10543755 | 3300025941 | Bacteria | 1083 |
| 202 | Ga0207689_10004086 | 3300025942 | Bacteria | 13272 |
| 203 | Ga0207661_12006348 | 3300025944 | Bacteria | 524 |
| 204 | Ga0207679_10031200 | 3300025945 | Bacteria | 3729 |
| 205 | Ga0207679_10460379 | 3300025945 | Bacteria | 1129 |
| 206 | Ga0207667_10014360 | 3300025949 | Bacteria | 9033 |
| 207 | Ga0207667_10318986 | 3300025949 | Bacteria | 1587 |
| 208 | Ga0207667_11369878 | 3300025949 | Bacteria | 682 |
| 209 | Ga0207712_10571921 | 3300025961 | Bacteria | 974 |
| 210 | Ga0207640_10204133 | 3300025981 | Bacteria | 1500 |
| 211 | Ga0207677_11875554 | 3300026023 | Bacteria | 557 |
| 212 | Ga0207703_10681632 | 3300026035 | Bacteria | 976 |
| 213 | Ga0207703_11634922 | 3300026035 | Bacteria | 620 |
| 214 | Ga0207639_10000110 | 3300026041 | Bacteria | 65128 |
| 215 | Ga0207639_10195786 | 3300026041 | Bacteria | 1730 |
| 216 | Ga0207639_10209383 | 3300026041 | Bacteria | 1677 |
| 217 | Ga0207678_10001937 | 3300026067 | Bacteria | 18896 |
| 218 | Ga0207708_11304606 | 3300026075 | Bacteria | 636 |
| 219 | Ga0207708_11337605 | 3300026075 | Bacteria | 628 |
| 220 | Ga0207702_10447555 | 3300026078 | Bacteria | 1253 |
| 221 | Ga0207648_10583042 | 3300026089 | Bacteria | 1030 |
| 222 | Ga0207648_11438402 | 3300026089 | Bacteria | 648 |
| 223 | Ga0207674_10008622 | 3300026116 | Bacteria | 11753 |
| 224 | Ga0207674_10190454 | 3300026116 | Bacteria | 2001 |
| 225 | Ga0207674_10702733 | 3300026116 | Bacteria | 976 |
| 226 | Ga0207675_100391408 | 3300026118 | Bacteria | 1368 |
| 227 | Ga0207683_10203241 | 3300026121 | Bacteria | 1801 |
| 228 | Ga0207683_10269921 | 3300026121 | Bacteria | 1554 |
| 229 | Ga0207698_11300455 | 3300026142 | Bacteria | 742 |
| 230 | Ga0207428_10333207 | 3300027907 | Bacteria | 1119 |
| 231 | Ga0268266_11285187 | 3300028379 | Bacteria | 707 |
| 232 | Ga0268265_10255091 | 3300028380 | Bacteria | 1556 |
| 233 | Ga0268265_10544954 | 3300028380 | Bacteria | 1100 |
| 234 | Ga0268264_12208457 | 3300028381 | Bacteria | 558 |
| 235 | Ga0265337_1005176 | 3300028556 | Bacteria | 5235 |
| 236 | Ga0265334_10042413 | 3300028573 | Bacteria | 1773 |
| 237 | Ga0307517_10084056 | 3300028786 | Bacteria | 2683 |
| 238 | Ga0265338_10019293 | 3300028800 | Bacteria | 7246 |
| 239 | Ga0265338_10020650 | 3300028800 | Bacteria | 6915 |
| 240 | Ga0265338_11078691 | 3300028800 | Bacteria | 541 |
| 241 | Ga0265330_10076650 | 3300031235 | Bacteria | 1443 |
| 242 | Ga0265332_10245413 | 3300031238 | Bacteria | 741 |
| 243 | Ga0265332_10420741 | 3300031238 | Bacteria | 552 |
| 244 | Ga0265328_10094053 | 3300031239 | Bacteria | 1108 |
| 245 | Ga0265328_10249940 | 3300031239 | Bacteria | 679 |
| 246 | Ga0265325_10065372 | 3300031241 | Bacteria | 1837 |
| 247 | Ga0265325_10297512 | 3300031241 | Bacteria | 721 |
| 248 | Ga0265329_10078473 | 3300031242 | Bacteria | 1045 |
| 249 | Ga0265340_10397983 | 3300031247 | Bacteria | 607 |
| 250 | Ga0265339_10042381 | 3300031249 | Bacteria | 2520 |
| 251 | Ga0265339_10063039 | 3300031249 | Bacteria | 1992 |
| 252 | Ga0265331_10019540 | 3300031250 | Bacteria | 3499 |
| 253 | Ga0265331_10233170 | 3300031250 | Bacteria | 826 |
| 254 | Ga0265316_10318083 | 3300031344 | Bacteria | 1131 |
| 255 | Ga0307509_10521984 | 3300031507 | Bacteria | 869 |
| 256 | Ga0265313_10098103 | 3300031595 | Bacteria | 1304 |
| 257 | Ga0265314_10079171 | 3300031711 | Bacteria | 2173 |
| 258 | Ga0265314_10141679 | 3300031711 | Bacteria | 1485 |
| 259 | Ga0265314_10189779 | 3300031711 | Bacteria | 1224 |
| 260 | Ga0265342_10110177 | 3300031712 | Bacteria | 1559 |
| 261 | Ga0265342_10115446 | 3300031712 | Bacteria | 1516 |
| 262 | Ga0265342_10400187 | 3300031712 | Bacteria | 709 |
| 263 | Ga0316576_10226937 | 3300031727 | Bacteria | 1404 |
| 264 | Ga0316576_10242026 | 3300031727 | Bacteria | 1355 |
| 265 | Ga0316576_10278277 | 3300031727 | Bacteria | 1253 |
| 266 | Ga0316576_11050686 | 3300031727 | Unclassified | 579 |
| 267 | Ga0316578_10082081 | 3300031728 | Bacteria | 1919 |
| 268 | Ga0307415_102041530 | 3300032126 | Bacteria | 559 |
| 269 | Ga0316580_10019816 | 3300032139 | Bacteria | 2069 |
| 270 | Ga0316593_10112166 | 3300032168 | Bacteria | 974 |
| 271 | Ga0316593_10315303 | 3300032168 | Bacteria | 594 |
| 272 | Ga0316592_1051014 | 3300033524 | Unclassified | 924 |
| 273 | Ga0316592_1062170 | 3300033524 | Unclassified | 839 |
| 274 | Ga0316588_1010360 | 3300033528 | Unclassified | 1964 |
| 275 | Ga0316588_1014648 | 3300033528 | Bacteria | 1720 |
| 276 | Ga0316588_1069497 | 3300033528 | Unclassified | 864 |
| 277 | Ga0316588_1087984 | 3300033528 | Bacteria | 773 |
| 278 | Ga0316588_1126729 | 3300033528 | Bacteria | 648 |
| 279 | Ga0316596_1146018 | 3300033541 | Unclassified | 649 |
| 280 | Ga0373938_0123364 | 3300034957 | Bacteria | 670 |
| 281 | Ga0373934_0455890 | 3300035086 | Bacteria | 536 |
| 282 | Ga0373940_0092237 | 3300035088 | Bacteria | 909 |
| 283 | Ga0373944_0363959 | 3300035089 | Bacteria | 552 |
| 284 | Ga0373923_0135039 | 3300035111 | Bacteria | 1112 |
| 285 | Ga0373936_0040723 | 3300035113 | Bacteria | 1862 |
| 286 | Ga0373936_0069948 | 3300035113 | Bacteria | 1445 |
| 287 | Ga0373936_0362569 | 3300035113 | Bacteria | 661 |
| 288 | Ga0373945_0019741 | 3300035116 | Bacteria | 2302 |
| 289 | Ga0373954_0092053 | 3300035118 | Bacteria | 1457 |
| 290 | Ga0373956_0081692 | 3300035119 | Bacteria | 1483 |
| 291 | Ga0373956_0355429 | 3300035119 | Bacteria | 698 |
| 292 | Ga0373943_0001721 | 3300035170 | Bacteria | 9919 |
| 293 | Ga0373943_0520260 | 3300035170 | Bacteria | 696 |
| 294 | Ga0373943_0787683 | 3300035170 | Bacteria | 565 |
| 295 | Ga0373946_0008411 | 3300035171 | Bacteria | 3785 |
| 296 | Ga0373955_0148072 | 3300035172 | Bacteria | 1380 |
| 297 | Ga0373942_0055400 | 3300035207 | Bacteria | 1123 |
| 298 | Ga0373924_0165768 | 3300035410 | Bacteria | 970 |
| 299 | Ga0373931_0014276 | 3300035691 | Bacteria | 3880 |
| 300 | Ga0373931_0725983 | 3300035691 | Bacteria | 658 |
| 301 | Ga0373935_0002369 | 3300035692 | Bacteria | 10764 |
| 302 | Ga0373935_0082987 | 3300035692 | Bacteria | 2086 |
| 303 | Ga0373935_0569882 | 3300035692 | Bacteria | 826 |
| 304 | Ga0373927_0099275 | 3300035695 | Bacteria | 1893 |
| 305 | Ga0373927_0842447 | 3300035695 | Bacteria | 605 |
| 306 | Ga0373933_0217871 | 3300035724 | Bacteria | 1224 |
| 307 | Ga0373947_0095741 | 3300035725 | Bacteria | 1858 |
| 308 | Ga0373947_0134478 | 3300035725 | Bacteria | 1581 |
| 309 | Ga0373937_0004078 | 3300036401 | Bacteria | 12384 |
| 310 | Ga0373937_0150452 | 3300036401 | Bacteria | 2180 |
| 311 | Ga0373937_0178127 | 3300036401 | Bacteria | 1996 |
| 312 | Ga0373937_0254195 | 3300036401 | Bacteria | 1656 |
| 313 | Ga0373937_0476491 | 3300036401 | Bacteria | 1185 |
| 314 | Ga0373925_0164677 | 3300037068 | Bacteria | 1748 |
| 315 | Ga0373925_0177177 | 3300037068 | Bacteria | 1686 |
| 316 | Ga0373925_0286158 | 3300037068 | Bacteria | 1328 |
| 317 | Ga0373925_0297023 | 3300037068 | Bacteria | 1304 |
| 318 | Ga0373925_0327573 | 3300037068 | Bacteria | 1240 |
| 319 | Ga0373925_1263266 | 3300037068 | Bacteria | 606 |
| 320 | Ga0395899_0316229 | 3300037312 | Bacteria | 1053 |
| 321 | Ga0395899_0697649 | 3300037312 | Unclassified | 637 |
| 322 | Ga0395900_0075894 | 3300037418 | Bacteria | 3455 |
| 323 | Ga0395900_0172754 | 3300037418 | Bacteria | 2199 |
| 324 | Ga0395898_0013705 | 3300037466 | Bacteria | 8339 |
| 325 | Ga0395898_0289354 | 3300037466 | Bacteria | 1563 |
| 326 | Ga0395901_0026910 | 3300038443 | Bacteria | 5905 |
| 327 | Ga0395901_0910084 | 3300038443 | Bacteria | 861 |
| 328 | Ga0400490_14970 | 3300038726 | Bacteria | 1367 |
| 329 | Ga0436365_0456767 | 3300039437 | Bacteria | 1143 |
| 330 | Ga0436365_1210184 | 3300039437 | Bacteria | 1157 |
| 331 | Ga0436363_0100275 | 3300039450 | Bacteria | 550 |
| 332 | Ga0451795_1272768 | 3300041456 | Unclassified | 881 |
| 333 | Ga0451804_0440225 | 3300041463 | Bacteria | 878 |
| 334 | Ga0451837_0593073 | 3300041494 | Bacteria | 1197 |
| 335 | Ga0451845_0193759 | 3300041501 | Bacteria | 652 |
| 336 | Ga0451849_1305590 | 3300041505 | Bacteria | 565 |
| 337 | Ga0451843_0962993 | 3300041509 | Bacteria | 1111 |
| 338 | Ga0451855_0553907 | 3300041511 | Bacteria | 974 |
| 339 | Ga0439441_028471 | 3300042001 | Bacteria | 1071 |
| 340 | Ga0439456_172771 | 3300042013 | Bacteria | 508 |
| 341 | Ga0439435_0100865 | 3300042436 | Bacteria | 887 |
| 342 | Ga0466963_1147881 | 3300044694 | Bacteria | 546 |
| 343 | Ga0466959_0958507 | 3300045049 | Bacteria | 570 |
| 344 | Ga0466958_0389526 | 3300045836 | Bacteria | 899 |
| 345 | Ga0495617_264957 | 3300046452 | Bacteria | 528 |
| 346 | Ga0495629_0028360 | 3300046459 | Bacteria | 3975 |
| 347 | Ga0495580_0006870 | 3300046472 | Bacteria | 9201 |
| 348 | Ga0495580_0360451 | 3300046472 | Bacteria | 984 |
| 349 | Ga0495582_0123555 | 3300046473 | Bacteria | 1460 |
| 350 | Ga0495582_0179392 | 3300046473 | Bacteria | 1206 |
| 351 | Ga0495662_0656017 | 3300046476 | Bacteria | 512 |
| 352 | Ga0495664_0928721 | 3300046477 | Bacteria | 508 |
| 353 | Ga0495583_0430853 | 3300046506 | Bacteria | 517 |
| 354 | Ga0495608_0255026 | 3300046511 | Bacteria | 1093 |
| 355 | Ga0495616_0219434 | 3300046513 | Bacteria | 829 |
| 356 | Ga0495618_0609172 | 3300046514 | Bacteria | 649 |
| 357 | Ga0495648_0294483 | 3300046524 | Bacteria | 763 |
| 358 | Ga0495586_0103421 | 3300046535 | Bacteria | 1582 |
| 359 | Ga0495586_0475487 | 3300046535 | Bacteria | 721 |
| 360 | Ga0495587_0017150 | 3300046536 | Bacteria | 4503 |
| 361 | Ga0495587_0139048 | 3300046536 | Bacteria | 1387 |
| 362 | Ga0495621_0077828 | 3300046539 | Bacteria | 1232 |
| 363 | Ga0495645_0455585 | 3300046543 | Bacteria | 806 |
| 364 | Ga0495645_0565759 | 3300046543 | Bacteria | 703 |
| 365 | Ga0495622_0259044 | 3300046557 | Bacteria | 764 |
| 366 | Ga0495635_0396250 | 3300046663 | Bacteria | 917 |
| 367 | Ga0495588_0278961 | 3300046674 | Bacteria | 881 |
| 368 | Ga0495657_0510485 | 3300046675 | Bacteria | 700 |
| 369 | Ga0495657_0739496 | 3300046675 | Bacteria | 564 |
| 370 | Ga0495658_0000505 | 3300046683 | Bacteria | 21469 |
| 371 | Ga0495669_0234581 | 3300046684 | Bacteria | 880 |
| 372 | Ga0495671_0495343 | 3300046692 | Bacteria | 583 |
| 373 | Ga0495600_0283182 | 3300046809 | Bacteria | 1049 |
| 374 | Ga0495581_0333872 | 3300047315 | Bacteria | 885 |
| 375 | Ga0495604_0407286 | 3300047317 | Bacteria | 895 |
| 376 | Ga0495674_0351444 | 3300047319 | Bacteria | 1197 |
| 377 | Ga0495672_0259153 | 3300047320 | Bacteria | 840 |
| 378 | Ga0495675_0245789 | 3300047444 | Bacteria | 1076 |
| 379 | Ga0495675_0507368 | 3300047444 | Bacteria | 692 |
| 380 | Ga0495677_0098611 | 3300047445 | Bacteria | 1105 |
| 381 | Ga0495673_0172394 | 3300047469 | Bacteria | 824 |
| 382 | Ga0495602_0057448 | 3300048088 | Bacteria | 3413 |
| 383 | Ga0495602_0441324 | 3300048088 | Bacteria | 920 |
| 384 | Ga0496101_0012243 | 3300048904 | Bacteria | 5719 |
| 385 | Ga0496102_0157832 | 3300048905 | Bacteria | 2133 |
| 386 | Ga0496103_0128306 | 3300048906 | Bacteria | 1618 |
| 387 | Ga0496103_0202574 | 3300048906 | Bacteria | 1276 |
| 388 | Ga0496104_0052893 | 3300048907 | Bacteria | 3836 |
| 389 | Ga0496105_0449289 | 3300048908 | Bacteria | 1018 |
| 390 | Ga0496106_0015255 | 3300048909 | Bacteria | 5685 |
| 391 | Ga0496107_0121259 | 3300048910 | Bacteria | 1926 |
| 392 | Ga0496107_0722523 | 3300048910 | Bacteria | 732 |
| 393 | Ga0496108_0545237 | 3300048911 | Bacteria | 1012 |
| 394 | Ga0496109_1093934 | 3300048912 | Bacteria | 734 |
| 395 | Ga0496111_0859794 | 3300048914 | Bacteria | 654 |
| 396 | Ga0496113_1015053 | 3300048916 | Bacteria | 653 |
| 397 | Ga0496117_0236185 | 3300048920 | Bacteria | 1007 |
| 398 | Ga0496126_0293496 | 3300048929 | Bacteria | 1344 |
| 399 | Ga0501031_0186704 | 3300049568 | Bacteria | 1354 |
| 400 | Ga0501032_0013776 | 3300049569 | Bacteria | 5737 |
| 401 | Ga0501033_0075523 | 3300049570 | Bacteria | 2473 |
| 402 | Ga0501033_0112343 | 3300049570 | Bacteria | 1982 |
| 403 | Ga0501033_0220877 | 3300049570 | Bacteria | 1349 |
| 404 | Ga0501034_0000068 | 3300049571 | Bacteria | 182904 |
| 405 | Ga0501034_0006843 | 3300049571 | Bacteria | 12198 |
| 406 | Ga0501034_0236902 | 3300049571 | Bacteria | 1772 |
| 407 | Ga0501036_0130420 | 3300049572 | Bacteria | 2122 |
| 408 | Ga0501036_1114971 | 3300049572 | Bacteria | 644 |
| 409 | Ga0501037_0008627 | 3300049573 | Bacteria | 7473 |
| 410 | Ga0501037_0077451 | 3300049573 | Bacteria | 2413 |
| 411 | Ga0501037_0238800 | 3300049573 | Bacteria | 1274 |
| 412 | Ga0501038_0080357 | 3300049574 | Bacteria | 2748 |
| 413 | Ga0501038_0156439 | 3300049574 | Bacteria | 1856 |
| 414 | Ga0501038_0269346 | 3300049574 | Bacteria | 1343 |
| 415 | Ga0501039_0000205 | 3300049575 | Bacteria | 43025 |
| 416 | Ga0501040_0277575 | 3300049576 | Bacteria | 1197 |
| 417 | Ga0501043_0074585 | 3300049579 | Bacteria | 2665 |
| 418 | Ga0501043_0114689 | 3300049579 | Bacteria | 2115 |
| 419 | Ga0501043_0198500 | 3300049579 | Bacteria | 1558 |
| 420 | Ga0501043_0460734 | 3300049579 | Bacteria | 954 |
| 421 | Ga0501046_0007334 | 3300049580 | Bacteria | 9701 |
| 422 | Ga0501046_0030319 | 3300049580 | Bacteria | 4390 |
| 423 | Ga0501046_0438240 | 3300049580 | Bacteria | 940 |
| 424 | Ga0501047_0000152 | 3300049581 | Bacteria | 84703 |
| 425 | Ga0501047_0025453 | 3300049581 | Bacteria | 5689 |
| 426 | Ga0501047_0092493 | 3300049581 | Bacteria | 2903 |
| 427 | Ga0501047_0137513 | 3300049581 | Bacteria | 2323 |
| 428 | Ga0501047_0387396 | 3300049581 | Bacteria | 1231 |
| 429 | Ga0501047_0561366 | 3300049581 | Bacteria | 965 |
| 430 | Ga0501047_0957694 | 3300049581 | Bacteria | 669 |
| 431 | Ga0501048_0002175 | 3300049582 | Bacteria | 14919 |
| 432 | Ga0501048_0305039 | 3300049582 | Bacteria | 1133 |
| 433 | Ga0501067_0018422 | 3300049583 | Bacteria | 3868 |
| 434 | Ga0501067_0020300 | 3300049583 | Bacteria | 3677 |
| 435 | Ga0501070_0005781 | 3300049586 | Bacteria | 10552 |
| 436 | Ga0501070_0035400 | 3300049586 | Bacteria | 4172 |
| 437 | Ga0501070_0206265 | 3300049586 | Bacteria | 1614 |
| 438 | Ga0501070_0209042 | 3300049586 | Bacteria | 1602 |
| 439 | Ga0501070_0562077 | 3300049586 | Bacteria | 912 |
| 440 | Ga0501073_0238742 | 3300049589 | Bacteria | 1255 |
| 441 | Ga0501073_0351539 | 3300049589 | Bacteria | 1018 |
| 442 | Ga0501073_1210338 | 3300049589 | Bacteria | 518 |
| 443 | Ga0501074_0105461 | 3300049590 | Bacteria | 2018 |
| 444 | Ga0501074_0351401 | 3300049590 | Bacteria | 1046 |
| 445 | Ga0501076_1121104 | 3300049592 | Bacteria | 648 |
| 446 | Ga0501080_0000001 | 3300049742 | Bacteria | 241365 |
| 447 | Ga0501080_0403172 | 3300049742 | Bacteria | 1230 |
| 448 | Ga0501080_0655475 | 3300049742 | Bacteria | 929 |
| 449 | Ga0501080_0988812 | 3300049742 | Bacteria | 730 |
| 450 | Ga0501080_0989212 | 3300049742 | Bacteria | 730 |
| 451 | Ga0501080_1000868 | 3300049742 | Bacteria | 725 |
| 452 | Ga0501083_0323502 | 3300049744 | Bacteria | 1003 |
| 453 | Ga0501083_0548933 | 3300049744 | Bacteria | 752 |
| 454 | Ga0501035_0000015 | 3300049822 | Bacteria | 246493 |
| 455 | Ga0501035_0005877 | 3300049822 | Bacteria | 11558 |
| 456 | Ga0501035_0030838 | 3300049822 | Bacteria | 4885 |
| 457 | Ga0501035_0091158 | 3300049822 | Bacteria | 2683 |
| 458 | Ga0501044_0000390 | 3300049823 | Bacteria | 54419 |
| 459 | Ga0501044_0021866 | 3300049823 | Bacteria | 6820 |
| 460 | Ga0501044_0050955 | 3300049823 | Bacteria | 4270 |
| 461 | Ga0501044_0433866 | 3300049823 | Bacteria | 1222 |
| 462 | Ga0501044_0618516 | 3300049823 | Bacteria | 975 |
| 463 | Ga0501045_0142665 | 3300049824 | Bacteria | 1781 |
| 464 | nmdc:mga00v17_116641_c1 | 3300050491 | Bacteria | 1698 |
| 465 | nmdc:mga00v17_7378_c1 | 3300050491 | Bacteria | 5864 |
| 466 | nmdc:mga0qj67_333002_c1 | 3300050509 | Bacteria | 1228 |
| 467 | nmdc:mga08y16_344379_c1 | 3300050511 | Bacteria | 1532 |
| 468 | nmdc:mga08x19_130241_c1 | 3300050514 | Bacteria | 1692 |
| 469 | Ga0495655_0153712 | 3300053083 | Bacteria | 725 |
| 470 | Ga0495619_0213602 | 3300053085 | Bacteria | 1336 |
| 471 | Ga0495619_0996698 | 3300053085 | Bacteria | 560 |
| 472 | Ga0500643_000027 | 3300053087 | Bacteria | 251062 |
| 473 | Ga0500646_0023372 | 3300053090 | Bacteria | 1657 |
| 474 | Ga0500650_0284384 | 3300053098 | Bacteria | 735 |
| 475 | Ga0500595_008628 | 3300053119 | Bacteria | 4158 |
| 476 | Ga0500595_014502 | 3300053119 | Bacteria | 2989 |
| 477 | Ga0500595_127329 | 3300053119 | Bacteria | 718 |
| 478 | Ga0500616_0007417 | 3300053153 | Bacteria | 6978 |
| 479 | Ga0500619_200390 | 3300053154 | Bacteria | 670 |
| 480 | Ga0500639_234766 | 3300053163 | Bacteria | 751 |
| 481 | Ga0500656_036256 | 3300053732 | Bacteria | 675 |
| 482 | Ga0500596_084539 | 3300053735 | Bacteria | 556 |
| 483 | Ga0590075_004675 | 3300059424 | Bacteria | 3240 |
| 484 | Ga0501082_0022902 | 3300060353 | Bacteria | 5382 |
| 485 | Ga0501082_1105874 | 3300060353 | Bacteria | 693 |
| 486 | Ga0530510_1051268 | 3300061734 | Bacteria | 623 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025916 | Ga0207663_10839299 | Ga0207663_108392991 | 111 |
| 2 | iso_pu_bacteria | 2909042592 | 2909046808 | 113 |
| 3 | 3300005539 | Ga0068853_100685740 | Ga0068853_1006857401 | 114 |
| 4 | 3300005617 | Ga0068859_100279537 | Ga0068859_1002795373 | 114 |
| 5 | 3300006931 | Ga0097620_100279527 | Ga0097620_1002795272 | 114 |
| 6 | 3300014326 | Ga0157380_11428033 | Ga0157380_114280331 | 114 |
| 7 | 3300025909 | Ga0207705_10406764 | Ga0207705_104067643 | 114 |
| 8 | iso_pu_bacteria | 2919513703 | 2919516652 | 114 |
| 9 | iso_pu_bacteria | 2919675420 | 2919675595 | 114 |
| 10 | 3300005458 | Ga0070681_11169241 | Ga0070681_111692411 | 115 |
| 11 | 3300006914 | Ga0075436_101261119 | Ga0075436_1012611191 | 115 |
| 12 | 3300009176 | Ga0105242_10065815 | Ga0105242_100658152 | 115 |
| 13 | 3300025929 | Ga0207664_10785487 | Ga0207664_107854871 | 115 |
| 14 | 3300031247 | Ga0265340_10397983 | Ga0265340_103979832 | 115 |
| 15 | 3300031711 | Ga0265314_10141679 | Ga0265314_101416793 | 115 |
| 16 | 3300031712 | Ga0265342_10110177 | Ga0265342_101101772 | 115 |
| 17 | 3300032168 | Ga0316593_10315303 | Ga0316593_103153031 | 115 |
| 18 | 3300033528 | Ga0316588_1126729 | Ga0316588_11267292 | 115 |
| 19 | 3300035089 | Ga0373944_0363959 | Ga0373944_0363959_132_479 | 115 |
| 20 | 3300035113 | Ga0373936_0362569 | Ga0373936_0362569_86_433 | 115 |
| 21 | 3300035116 | Ga0373945_0019741 | Ga0373945_0019741_406_753 | 115 |
| 22 | 3300035170 | Ga0373943_0001721 | Ga0373943_0001721_2801_3148 | 115 |
| 23 | 3300035170 | Ga0373943_0520260 | Ga0373943_0520260_326_673 | 115 |
| 24 | 3300035170 | Ga0373943_0787683 | Ga0373943_0787683_74_421 | 115 |
| 25 | 3300035171 | Ga0373946_0008411 | Ga0373946_0008411_2350_2697 | 115 |
| 26 | 3300035692 | Ga0373935_0002369 | Ga0373935_0002369_5866_6213 | 115 |
| 27 | 3300035695 | Ga0373927_0099275 | Ga0373927_0099275_734_1081 | 115 |
| 28 | 3300035695 | Ga0373927_0842447 | Ga0373927_0842447_167_514 | 115 |
| 29 | 3300035725 | Ga0373947_0134478 | Ga0373947_0134478_898_1245 | 115 |
| 30 | 3300037068 | Ga0373925_0164677 | Ga0373925_0164677_319_666 | 115 |
| 31 | 3300037068 | Ga0373925_0327573 | Ga0373925_0327573_476_823 | 115 |
| 32 | 3300037068 | Ga0373925_1263266 | Ga0373925_1263266_179_526 | 115 |
| 33 | 3300039437 | Ga0436365_1210184 | Ga0436365_1210184_14_361 | 115 |
| 34 | 3300039450 | Ga0436363_0100275 | Ga0436363_0100275_160_507 | 115 |
| 35 | 3300046459 | Ga0495629_0028360 | Ga0495629_0028360_3422_3769 | 115 |
| 36 | 3300046472 | Ga0495580_0006870 | Ga0495580_0006870_50_397 | 115 |
| 37 | 3300046473 | Ga0495582_0179392 | Ga0495582_0179392_750_1097 | 115 |
| 38 | 3300046535 | Ga0495586_0103421 | Ga0495586_0103421_768_1115 | 115 |
| 39 | 3300046543 | Ga0495645_0455585 | Ga0495645_0455585_379_726 | 115 |
| 40 | 3300046663 | Ga0495635_0396250 | Ga0495635_0396250_353_700 | 115 |
| 41 | 3300046683 | Ga0495658_0000505 | Ga0495658_0000505_5261_5608 | 115 |
| 42 | 3300047319 | Ga0495674_0351444 | Ga0495674_0351444_389_736 | 115 |
| 43 | 3300048088 | Ga0495602_0441324 | Ga0495602_0441324_546_893 | 115 |
| 44 | 3300049581 | Ga0501047_0561366 | Ga0501047_0561366_29_376 | 115 |
| 45 | 3300049586 | Ga0501070_0005781 | Ga0501070_0005781_8016_8363 | 115 |
| 46 | 3300049742 | Ga0501080_0403172 | Ga0501080_0403172_346_693 | 115 |
| 47 | 3300049742 | Ga0501080_0989212 | Ga0501080_0989212_347_694 | 115 |
| 48 | 3300049744 | Ga0501083_0548933 | Ga0501083_0548933_356_703 | 115 |
| 49 | 3300050514 | nmdc:mga08x19_130241_c1 | nmdc:mga08x19_130241_c1_1254_1601 | 115 |
| 50 | 3300053732 | Ga0500656_036256 | Ga0500656_036256_267_614 | 115 |
| 51 | 3300060353 | Ga0501082_1105874 | Ga0501082_1105874_292_639 | 115 |
| 52 | 3300005333 | Ga0070677_10171627 | Ga0070677_101716272 | 116 |
| 53 | 3300005340 | Ga0070689_100165457 | Ga0070689_1001654571 | 116 |
| 54 | 3300005353 | Ga0070669_101443008 | Ga0070669_1014430081 | 116 |
| 55 | 3300005439 | Ga0070711_100891716 | Ga0070711_1008917162 | 116 |
| 56 | 3300005459 | Ga0068867_100699041 | Ga0068867_1006990412 | 116 |
| 57 | 3300005535 | Ga0070684_102330833 | Ga0070684_1023308331 | 116 |
| 58 | 3300005548 | Ga0070665_100120945 | Ga0070665_1001209452 | 116 |
| 59 | 3300005563 | Ga0068855_100333336 | Ga0068855_1003333363 | 116 |
| 60 | 3300005719 | Ga0068861_100597262 | Ga0068861_1005972622 | 116 |
| 61 | 3300005844 | Ga0068862_100194280 | Ga0068862_1001942802 | 116 |
| 62 | 3300005844 | Ga0068862_101145131 | Ga0068862_1011451312 | 116 |
| 63 | 3300006881 | Ga0068865_100364319 | Ga0068865_1003643192 | 116 |
| 64 | 3300009098 | Ga0105245_10012871 | Ga0105245_100128714 | 116 |
| 65 | 3300013308 | Ga0157375_13461150 | Ga0157375_134611502 | 116 |
| 66 | 3300025916 | Ga0207663_10910725 | Ga0207663_109107252 | 116 |
| 67 | 3300025927 | Ga0207687_10011198 | Ga0207687_100111985 | 116 |
| 68 | 3300025937 | Ga0207669_10674826 | Ga0207669_106748262 | 116 |
| 69 | 3300025949 | Ga0207667_11369878 | Ga0207667_113698782 | 116 |
| 70 | 3300026116 | Ga0207674_10702733 | Ga0207674_107027332 | 116 |
| 71 | 3300026121 | Ga0207683_10203241 | Ga0207683_102032412 | 116 |
| 72 | 3300028380 | Ga0268265_10544954 | Ga0268265_105449543 | 116 |
| 73 | 3300028786 | Ga0307517_10084056 | Ga0307517_100840563 | 116 |
| 74 | 3300031507 | Ga0307509_10521984 | Ga0307509_105219842 | 116 |
| 75 | 3300031727 | Ga0316576_10242026 | Ga0316576_102420263 | 116 |
| 76 | 3300033528 | Ga0316588_1010360 | Ga0316588_10103604 | 116 |
| 77 | 3300041463 | Ga0451804_0440225 | Ga0451804_0440225_183_533 | 116 |
| 78 | 3300041501 | Ga0451845_0193759 | Ga0451845_0193759_50_400 | 116 |
| 79 | 3300046511 | Ga0495608_0255026 | Ga0495608_0255026_447_797 | 116 |
| 80 | 3300046513 | Ga0495616_0219434 | Ga0495616_0219434_157_507 | 116 |
| 81 | 3300046514 | Ga0495618_0609172 | Ga0495618_0609172_119_469 | 116 |
| 82 | 3300046524 | Ga0495648_0294483 | Ga0495648_0294483_106_456 | 116 |
| 83 | 3300046674 | Ga0495588_0278961 | Ga0495588_0278961_397_747 | 116 |
| 84 | 3300046675 | Ga0495657_0510485 | Ga0495657_0510485_109_459 | 116 |
| 85 | 3300046692 | Ga0495671_0495343 | Ga0495671_0495343_16_366 | 116 |
| 86 | 3300047317 | Ga0495604_0407286 | Ga0495604_0407286_202_552 | 116 |
| 87 | 3300047469 | Ga0495673_0172394 | Ga0495673_0172394_434_784 | 116 |
| 88 | 3300049570 | Ga0501033_0075523 | Ga0501033_0075523_1979_2329 | 116 |
| 89 | 3300049570 | Ga0501033_0112343 | Ga0501033_0112343_837_1187 | 116 |
| 90 | 3300049573 | Ga0501037_0238800 | Ga0501037_0238800_622_972 | 116 |
| 91 | 3300049579 | Ga0501043_0114689 | Ga0501043_0114689_41_391 | 116 |
| 92 | 3300049580 | Ga0501046_0438240 | Ga0501046_0438240_49_399 | 116 |
| 93 | 3300049581 | Ga0501047_0025453 | Ga0501047_0025453_4748_5098 | 116 |
| 94 | 3300049581 | Ga0501047_0957694 | Ga0501047_0957694_51_401 | 116 |
| 95 | 3300049582 | Ga0501048_0305039 | Ga0501048_0305039_266_616 | 116 |
| 96 | 3300049590 | Ga0501074_0351401 | Ga0501074_0351401_522_872 | 116 |
| 97 | 3300049592 | Ga0501076_1121104 | Ga0501076_1121104_258_608 | 116 |
| 98 | 3300049742 | Ga0501080_0655475 | Ga0501080_0655475_210_560 | 116 |
| 99 | 3300049742 | Ga0501080_0988812 | Ga0501080_0988812_358_708 | 116 |
| 100 | 3300049822 | Ga0501035_0005877 | Ga0501035_0005877_7298_7648 | 116 |
| 101 | 3300049823 | Ga0501044_0021866 | Ga0501044_0021866_3340_3690 | 116 |
| 102 | 3300053087 | Ga0500643_000027 | Ga0500643_000027_8907_9257 | 116 |
| 103 | 3300053090 | Ga0500646_0023372 | Ga0500646_0023372_690_1040 | 116 |
| 104 | 3300053119 | Ga0500595_008628 | Ga0500595_008628_190_540 | 116 |
| 105 | 3300053154 | Ga0500619_200390 | Ga0500619_200390_40_390 | 116 |
| 106 | 3300053163 | Ga0500639_234766 | Ga0500639_234766_154_504 | 116 |
| 107 | 3300053735 | Ga0500596_084539 | Ga0500596_084539_148_498 | 116 |
| 108 | 3300059424 | Ga0590075_004675 | Ga0590075_004675_2598_2948 | 116 |
| 109 | 3300005329 | Ga0070683_101731766 | Ga0070683_1017317661 | 117 |
| 110 | 3300005334 | Ga0068869_101090956 | Ga0068869_1010909561 | 117 |
| 111 | 3300005337 | Ga0070682_100455257 | Ga0070682_1004552572 | 117 |
| 112 | 3300005340 | Ga0070689_100120066 | Ga0070689_1001200664 | 117 |
| 113 | 3300005341 | Ga0070691_10803974 | Ga0070691_108039741 | 117 |
| 114 | 3300005343 | Ga0070687_100463980 | Ga0070687_1004639802 | 117 |
| 115 | 3300005364 | Ga0070673_100155029 | Ga0070673_1001550292 | 117 |
| 116 | 3300005436 | Ga0070713_100142738 | Ga0070713_1001427382 | 117 |
| 117 | 3300005436 | Ga0070713_100997337 | Ga0070713_1009973372 | 117 |
| 118 | 3300005437 | Ga0070710_10746333 | Ga0070710_107463332 | 117 |
| 119 | 3300005438 | Ga0070701_10462779 | Ga0070701_104627792 | 117 |
| 120 | 3300005439 | Ga0070711_100205412 | Ga0070711_1002054122 | 117 |
| 121 | 3300005439 | Ga0070711_101271928 | Ga0070711_1012719281 | 117 |
| 122 | 3300005440 | Ga0070705_101795220 | Ga0070705_1017952201 | 117 |
| 123 | 3300005441 | Ga0070700_100924893 | Ga0070700_1009248932 | 117 |
| 124 | 3300005458 | Ga0070681_10252062 | Ga0070681_102520623 | 117 |
| 125 | 3300005530 | Ga0070679_100013529 | Ga0070679_1000135293 | 117 |
| 126 | 3300005539 | Ga0068853_100005046 | Ga0068853_1000050462 | 117 |
| 127 | 3300005543 | Ga0070672_100469836 | Ga0070672_1004698362 | 117 |
| 128 | 3300005544 | Ga0070686_100428334 | Ga0070686_1004283342 | 117 |
| 129 | 3300005546 | Ga0070696_100373700 | Ga0070696_1003737002 | 117 |
| 130 | 3300005546 | Ga0070696_101556995 | Ga0070696_1015569951 | 117 |
| 131 | 3300005564 | Ga0070664_100577219 | Ga0070664_1005772192 | 117 |
| 132 | 3300005564 | Ga0070664_101402697 | Ga0070664_1014026972 | 117 |
| 133 | 3300005617 | Ga0068859_101003281 | Ga0068859_1010032812 | 117 |
| 134 | 3300005842 | Ga0068858_101813003 | Ga0068858_1018130031 | 117 |
| 135 | 3300006173 | Ga0070716_101251959 | Ga0070716_1012519592 | 117 |
| 136 | 3300006175 | Ga0070712_100000260 | Ga0070712_1000002603 | 117 |
| 137 | 3300006237 | Ga0097621_100198373 | Ga0097621_1001983733 | 117 |
| 138 | 3300006358 | Ga0068871_100652051 | Ga0068871_1006520511 | 117 |
| 139 | 3300006844 | Ga0075428_100821526 | Ga0075428_1008215262 | 117 |
| 140 | 3300006846 | Ga0075430_100270451 | Ga0075430_1002704512 | 117 |
| 141 | 3300006847 | Ga0075431_100942606 | Ga0075431_1009426062 | 117 |
| 142 | 3300006931 | Ga0097620_101003078 | Ga0097620_1010030782 | 117 |
| 143 | 3300007788 | Ga0099795_10121865 | Ga0099795_101218652 | 117 |
| 144 | 3300007788 | Ga0099795_10325531 | Ga0099795_103255312 | 117 |
| 145 | 3300009094 | Ga0111539_10087798 | Ga0111539_100877986 | 117 |
| 146 | 3300009094 | Ga0111539_11048671 | Ga0111539_110486712 | 117 |
| 147 | 3300009098 | Ga0105245_10857292 | Ga0105245_108572921 | 117 |
| 148 | 3300009148 | Ga0105243_10842771 | Ga0105243_108427711 | 117 |
| 149 | 3300009176 | Ga0105242_10331546 | Ga0105242_103315463 | 117 |
| 150 | 3300009176 | Ga0105242_11071477 | Ga0105242_110714772 | 117 |
| 151 | 3300009177 | Ga0105248_10754491 | Ga0105248_107544913 | 117 |
| 152 | 3300009551 | Ga0105238_10707367 | Ga0105238_107073672 | 117 |
| 153 | 3300009551 | Ga0105238_12604252 | Ga0105238_126042522 | 117 |
| 154 | 3300010159 | Ga0099796_10035955 | Ga0099796_100359551 | 117 |
| 155 | 3300010375 | Ga0105239_12911586 | Ga0105239_129115862 | 117 |
| 156 | 3300013296 | Ga0157374_10867556 | Ga0157374_108675562 | 117 |
| 157 | 3300013307 | Ga0157372_12081065 | Ga0157372_120810651 | 117 |
| 158 | 3300014968 | Ga0157379_11351622 | Ga0157379_113516221 | 117 |
| 159 | 3300025898 | Ga0207692_11121205 | Ga0207692_111212051 | 117 |
| 160 | 3300025906 | Ga0207699_10017932 | Ga0207699_100179322 | 117 |
| 161 | 3300025912 | Ga0207707_10225867 | Ga0207707_102258673 | 117 |
| 162 | 3300025912 | Ga0207707_10282634 | Ga0207707_102826342 | 117 |
| 163 | 3300025916 | Ga0207663_10062373 | Ga0207663_100623733 | 117 |
| 164 | 3300025916 | Ga0207663_11053921 | Ga0207663_110539212 | 117 |
| 165 | 3300025917 | Ga0207660_10201148 | Ga0207660_102011484 | 117 |
| 166 | 3300025921 | Ga0207652_10006625 | Ga0207652_100066253 | 117 |
| 167 | 3300025924 | Ga0207694_10544568 | Ga0207694_105445682 | 117 |
| 168 | 3300025925 | Ga0207650_10484453 | Ga0207650_104844532 | 117 |
| 169 | 3300025926 | Ga0207659_11403856 | Ga0207659_114038561 | 117 |
| 170 | 3300025927 | Ga0207687_10542233 | Ga0207687_105422331 | 117 |
| 171 | 3300025928 | Ga0207700_10132116 | Ga0207700_101321162 | 117 |
| 172 | 3300025934 | Ga0207686_10729846 | Ga0207686_107298461 | 117 |
| 173 | 3300025934 | Ga0207686_10945904 | Ga0207686_109459042 | 117 |
| 174 | 3300025936 | Ga0207670_10227156 | Ga0207670_102271562 | 117 |
| 175 | 3300025939 | Ga0207665_10079729 | Ga0207665_100797292 | 117 |
| 176 | 3300025940 | Ga0207691_10813889 | Ga0207691_108138891 | 117 |
| 177 | 3300025941 | Ga0207711_10543755 | Ga0207711_105437553 | 117 |
| 178 | 3300025944 | Ga0207661_12006348 | Ga0207661_120063481 | 117 |
| 179 | 3300025945 | Ga0207679_10460379 | Ga0207679_104603792 | 117 |
| 180 | 3300025949 | Ga0207667_10318986 | Ga0207667_103189862 | 117 |
| 181 | 3300025961 | Ga0207712_10571921 | Ga0207712_105719212 | 117 |
| 182 | 3300026035 | Ga0207703_11634922 | Ga0207703_116349222 | 117 |
| 183 | 3300026041 | Ga0207639_10000110 | Ga0207639_100001103 | 117 |
| 184 | 3300026075 | Ga0207708_11304606 | Ga0207708_113046061 | 117 |
| 185 | 3300026075 | Ga0207708_11337605 | Ga0207708_113376051 | 117 |
| 186 | 3300027907 | Ga0207428_10333207 | Ga0207428_103332072 | 117 |
| 187 | 3300028380 | Ga0268265_10255091 | Ga0268265_102550912 | 117 |
| 188 | 3300028800 | Ga0265338_10019293 | Ga0265338_100192934 | 117 |
| 189 | 3300031238 | Ga0265332_10420741 | Ga0265332_104207412 | 117 |
| 190 | 3300031239 | Ga0265328_10249940 | Ga0265328_102499402 | 117 |
| 191 | 3300031241 | Ga0265325_10065372 | Ga0265325_100653723 | 117 |
| 192 | 3300031250 | Ga0265331_10233170 | Ga0265331_102331701 | 117 |
| 193 | 3300031344 | Ga0265316_10318083 | Ga0265316_103180833 | 117 |
| 194 | 3300031711 | Ga0265314_10079171 | Ga0265314_100791712 | 117 |
| 195 | 3300031712 | Ga0265342_10400187 | Ga0265342_104001872 | 117 |
| 196 | 3300031727 | Ga0316576_11050686 | Ga0316576_110506861 | 117 |
| 197 | 3300032168 | Ga0316593_10112166 | Ga0316593_101121662 | 117 |
| 198 | 3300033524 | Ga0316592_1062170 | Ga0316592_10621702 | 117 |
| 199 | 3300033528 | Ga0316588_1014648 | Ga0316588_10146482 | 117 |
| 200 | 3300033528 | Ga0316588_1069497 | Ga0316588_10694972 | 117 |
| 201 | 3300033528 | Ga0316588_1087984 | Ga0316588_10879842 | 117 |
| 202 | 3300033541 | Ga0316596_1146018 | Ga0316596_11460181 | 117 |
| 203 | 3300034957 | Ga0373938_0123364 | Ga0373938_0123364_141_494 | 117 |
| 204 | 3300035086 | Ga0373934_0455890 | Ga0373934_0455890_49_402 | 117 |
| 205 | 3300035088 | Ga0373940_0092237 | Ga0373940_0092237_435_788 | 117 |
| 206 | 3300035111 | Ga0373923_0135039 | Ga0373923_0135039_577_930 | 117 |
| 207 | 3300035113 | Ga0373936_0069948 | Ga0373936_0069948_987_1340 | 117 |
| 208 | 3300035118 | Ga0373954_0092053 | Ga0373954_0092053_268_621 | 117 |
| 209 | 3300035119 | Ga0373956_0081692 | Ga0373956_0081692_913_1266 | 117 |
| 210 | 3300035119 | Ga0373956_0355429 | Ga0373956_0355429_309_662 | 117 |
| 211 | 3300035172 | Ga0373955_0148072 | Ga0373955_0148072_27_380 | 117 |
| 212 | 3300035207 | Ga0373942_0055400 | Ga0373942_0055400_225_578 | 117 |
| 213 | 3300035410 | Ga0373924_0165768 | Ga0373924_0165768_560_913 | 117 |
| 214 | 3300035691 | Ga0373931_0014276 | Ga0373931_0014276_2995_3348 | 117 |
| 215 | 3300035691 | Ga0373931_0725983 | Ga0373931_0725983_230_583 | 117 |
| 216 | 3300035692 | Ga0373935_0082987 | Ga0373935_0082987_265_618 | 117 |
| 217 | 3300035692 | Ga0373935_0569882 | Ga0373935_0569882_446_799 | 117 |
| 218 | 3300035724 | Ga0373933_0217871 | Ga0373933_0217871_69_422 | 117 |
| 219 | 3300035725 | Ga0373947_0095741 | Ga0373947_0095741_255_608 | 117 |
| 220 | 3300036401 | Ga0373937_0004078 | Ga0373937_0004078_10687_11040 | 117 |
| 221 | 3300036401 | Ga0373937_0150452 | Ga0373937_0150452_1049_1402 | 117 |
| 222 | 3300036401 | Ga0373937_0254195 | Ga0373937_0254195_347_700 | 117 |
| 223 | 3300036401 | Ga0373937_0476491 | Ga0373937_0476491_593_946 | 117 |
| 224 | 3300037068 | Ga0373925_0177177 | Ga0373925_0177177_608_961 | 117 |
| 225 | 3300037068 | Ga0373925_0286158 | Ga0373925_0286158_66_419 | 117 |
| 226 | 3300037068 | Ga0373925_0297023 | Ga0373925_0297023_388_741 | 117 |
| 227 | 3300041456 | Ga0451795_1272768 | Ga0451795_1272768_165_518 | 117 |
| 228 | 3300041511 | Ga0451855_0553907 | Ga0451855_0553907_519_872 | 117 |
| 229 | 3300042001 | Ga0439441_028471 | Ga0439441_028471_340_693 | 117 |
| 230 | 3300042013 | Ga0439456_172771 | Ga0439456_172771_87_440 | 117 |
| 231 | 3300042436 | Ga0439435_0100865 | Ga0439435_0100865_215_568 | 117 |
| 232 | 3300046472 | Ga0495580_0360451 | Ga0495580_0360451_530_883 | 117 |
| 233 | 3300046473 | Ga0495582_0123555 | Ga0495582_0123555_507_860 | 117 |
| 234 | 3300046535 | Ga0495586_0475487 | Ga0495586_0475487_34_387 | 117 |
| 235 | 3300046536 | Ga0495587_0139048 | Ga0495587_0139048_108_461 | 117 |
| 236 | 3300046539 | Ga0495621_0077828 | Ga0495621_0077828_563_916 | 117 |
| 237 | 3300046543 | Ga0495645_0565759 | Ga0495645_0565759_328_681 | 117 |
| 238 | 3300046684 | Ga0495669_0234581 | Ga0495669_0234581_84_437 | 117 |
| 239 | 3300046809 | Ga0495600_0283182 | Ga0495600_0283182_244_597 | 117 |
| 240 | 3300047315 | Ga0495581_0333872 | Ga0495581_0333872_43_396 | 117 |
| 241 | 3300047320 | Ga0495672_0259153 | Ga0495672_0259153_266_619 | 117 |
| 242 | 3300047444 | Ga0495675_0245789 | Ga0495675_0245789_127_480 | 117 |
| 243 | 3300047444 | Ga0495675_0507368 | Ga0495675_0507368_23_376 | 117 |
| 244 | 3300047445 | Ga0495677_0098611 | Ga0495677_0098611_329_682 | 117 |
| 245 | 3300049571 | Ga0501034_0236902 | Ga0501034_0236902_1153_1506 | 117 |
| 246 | 3300050509 | nmdc:mga0qj67_333002_c1 | nmdc:mga0qj67_333002_c1_688_1041 | 117 |
| 247 | 3300050511 | nmdc:mga08y16_344379_c1 | nmdc:mga08y16_344379_c1_565_918 | 117 |
| 248 | 3300053085 | Ga0495619_0213602 | Ga0495619_0213602_668_1021 | 117 |
| 249 | 3300053085 | Ga0495619_0996698 | Ga0495619_0996698_74_427 | 117 |
| 250 | 3300061734 | Ga0530510_1051268 | Ga0530510_1051268_79_432 | 117 |
| 251 | 3300005328 | Ga0070676_10130046 | Ga0070676_101300462 | 118 |
| 252 | 3300005331 | Ga0070670_101173800 | Ga0070670_1011738001 | 118 |
| 253 | 3300005334 | Ga0068869_100000648 | Ga0068869_10000064817 | 118 |
| 254 | 3300005336 | Ga0070680_100367733 | Ga0070680_1003677333 | 118 |
| 255 | 3300005337 | Ga0070682_100013327 | Ga0070682_1000133274 | 118 |
| 256 | 3300005339 | Ga0070660_100570507 | Ga0070660_1005705072 | 118 |
| 257 | 3300005341 | Ga0070691_10144592 | Ga0070691_101445922 | 118 |
| 258 | 3300005347 | Ga0070668_100164246 | Ga0070668_1001642463 | 118 |
| 259 | 3300005347 | Ga0070668_101023573 | Ga0070668_1010235731 | 118 |
| 260 | 3300005366 | Ga0070659_100036650 | Ga0070659_1000366503 | 118 |
| 261 | 3300005366 | Ga0070659_100715235 | Ga0070659_1007152352 | 118 |
| 262 | 3300005437 | Ga0070710_10391922 | Ga0070710_103919222 | 118 |
| 263 | 3300005440 | Ga0070705_100357516 | Ga0070705_1003575161 | 118 |
| 264 | 3300005440 | Ga0070705_101516788 | Ga0070705_1015167881 | 118 |
| 265 | 3300005444 | Ga0070694_100092791 | Ga0070694_1000927914 | 118 |
| 266 | 3300005455 | Ga0070663_100204061 | Ga0070663_1002040611 | 118 |
| 267 | 3300005458 | Ga0070681_10069044 | Ga0070681_100690443 | 118 |
| 268 | 3300005458 | Ga0070681_10296565 | Ga0070681_102965652 | 118 |
| 269 | 3300005459 | Ga0068867_100895931 | Ga0068867_1008959311 | 118 |
| 270 | 3300005459 | Ga0068867_101339499 | Ga0068867_1013394991 | 118 |
| 271 | 3300005467 | Ga0070706_100116538 | Ga0070706_1001165385 | 118 |
| 272 | 3300005530 | Ga0070679_100008091 | Ga0070679_10000809113 | 118 |
| 273 | 3300005530 | Ga0070679_100012659 | Ga0070679_10001265914 | 118 |
| 274 | 3300005539 | Ga0068853_100051500 | Ga0068853_1000515002 | 118 |
| 275 | 3300005539 | Ga0068853_100304272 | Ga0068853_1003042724 | 118 |
| 276 | 3300005539 | Ga0068853_100666574 | Ga0068853_1006665741 | 118 |
| 277 | 3300005545 | Ga0070695_100100733 | Ga0070695_1001007333 | 118 |
| 278 | 3300005546 | Ga0070696_100037829 | Ga0070696_1000378293 | 118 |
| 279 | 3300005547 | Ga0070693_100007429 | Ga0070693_1000074297 | 118 |
| 280 | 3300005548 | Ga0070665_100170356 | Ga0070665_1001703563 | 118 |
| 281 | 3300005548 | Ga0070665_100695112 | Ga0070665_1006951123 | 118 |
| 282 | 3300005548 | Ga0070665_100777546 | Ga0070665_1007775461 | 118 |
| 283 | 3300005563 | Ga0068855_100179349 | Ga0068855_1001793493 | 118 |
| 284 | 3300005563 | Ga0068855_100323590 | Ga0068855_1003235903 | 118 |
| 285 | 3300005563 | Ga0068855_100825687 | Ga0068855_1008256871 | 118 |
| 286 | 3300005564 | Ga0070664_100049081 | Ga0070664_1000490813 | 118 |
| 287 | 3300005577 | Ga0068857_100083824 | Ga0068857_1000838242 | 118 |
| 288 | 3300005577 | Ga0068857_100703897 | Ga0068857_1007038973 | 118 |
| 289 | 3300005614 | Ga0068856_100091537 | Ga0068856_1000915376 | 118 |
| 290 | 3300005615 | Ga0070702_101047230 | Ga0070702_1010472301 | 118 |
| 291 | 3300005616 | Ga0068852_101485359 | Ga0068852_1014853591 | 118 |
| 292 | 3300005719 | Ga0068861_100517401 | Ga0068861_1005174012 | 118 |
| 293 | 3300005834 | Ga0068851_10129678 | Ga0068851_101296781 | 118 |
| 294 | 3300005842 | Ga0068858_100294439 | Ga0068858_1002944393 | 118 |
| 295 | 3300006038 | Ga0075365_10158024 | Ga0075365_101580243 | 118 |
| 296 | 3300006237 | Ga0097621_100203980 | Ga0097621_1002039802 | 118 |
| 297 | 3300006358 | Ga0068871_100485462 | Ga0068871_1004854622 | 118 |
| 298 | 3300006358 | Ga0068871_101280980 | Ga0068871_1012809802 | 118 |
| 299 | 3300009098 | Ga0105245_11814621 | Ga0105245_118146211 | 118 |
| 300 | 3300009101 | Ga0105247_10302993 | Ga0105247_103029932 | 118 |
| 301 | 3300009101 | Ga0105247_10505417 | Ga0105247_105054171 | 118 |
| 302 | 3300009174 | Ga0105241_10018566 | Ga0105241_100185663 | 118 |
| 303 | 3300009174 | Ga0105241_10052353 | Ga0105241_100523532 | 118 |
| 304 | 3300009176 | Ga0105242_10116976 | Ga0105242_101169761 | 118 |
| 305 | 3300009176 | Ga0105242_10721450 | Ga0105242_107214502 | 118 |
| 306 | 3300009177 | Ga0105248_11165711 | Ga0105248_111657111 | 118 |
| 307 | 3300009177 | Ga0105248_12275855 | Ga0105248_122758552 | 118 |
| 308 | 3300009545 | Ga0105237_10057156 | Ga0105237_100571562 | 118 |
| 309 | 3300009545 | Ga0105237_10065812 | Ga0105237_100658124 | 118 |
| 310 | 3300009545 | Ga0105237_10072752 | Ga0105237_100727522 | 118 |
| 311 | 3300009551 | Ga0105238_10024943 | Ga0105238_1002494311 | 118 |
| 312 | 3300009551 | Ga0105238_10105601 | Ga0105238_101056013 | 118 |
| 313 | 3300009553 | Ga0105249_10677691 | Ga0105249_106776912 | 118 |
| 314 | 3300010375 | Ga0105239_10295447 | Ga0105239_102954472 | 118 |
| 315 | 3300011119 | Ga0105246_10031393 | Ga0105246_100313933 | 118 |
| 316 | 3300013100 | Ga0157373_10560911 | Ga0157373_105609112 | 118 |
| 317 | 3300013105 | Ga0157369_10082075 | Ga0157369_100820753 | 118 |
| 318 | 3300013297 | Ga0157378_10042694 | Ga0157378_100426942 | 118 |
| 319 | 3300013306 | Ga0163162_11137911 | Ga0163162_111379112 | 118 |
| 320 | 3300013306 | Ga0163162_12199975 | Ga0163162_121999752 | 118 |
| 321 | 3300014325 | Ga0163163_10277109 | Ga0163163_102771092 | 118 |
| 322 | 3300014745 | Ga0157377_10661194 | Ga0157377_106611943 | 118 |
| 323 | 3300014968 | Ga0157379_10118980 | Ga0157379_101189802 | 118 |
| 324 | 3300014968 | Ga0157379_10534253 | Ga0157379_105342533 | 118 |
| 325 | 3300014969 | Ga0157376_10117239 | Ga0157376_101172394 | 118 |
| 326 | 3300014969 | Ga0157376_10524184 | Ga0157376_105241842 | 118 |
| 327 | 3300025900 | Ga0207710_10260677 | Ga0207710_102606771 | 118 |
| 328 | 3300025901 | Ga0207688_10152566 | Ga0207688_101525662 | 118 |
| 329 | 3300025904 | Ga0207647_10426287 | Ga0207647_104262871 | 118 |
| 330 | 3300025904 | Ga0207647_10519964 | Ga0207647_105199641 | 118 |
| 331 | 3300025907 | Ga0207645_10411411 | Ga0207645_104114111 | 118 |
| 332 | 3300025909 | Ga0207705_10197407 | Ga0207705_101974074 | 118 |
| 333 | 3300025910 | Ga0207684_10145807 | Ga0207684_101458072 | 118 |
| 334 | 3300025911 | Ga0207654_10113188 | Ga0207654_101131884 | 118 |
| 335 | 3300025911 | Ga0207654_10157969 | Ga0207654_101579691 | 118 |
| 336 | 3300025911 | Ga0207654_10676042 | Ga0207654_106760422 | 118 |
| 337 | 3300025912 | Ga0207707_10148459 | Ga0207707_101484592 | 118 |
| 338 | 3300025913 | Ga0207695_10016369 | Ga0207695_100163693 | 118 |
| 339 | 3300025914 | Ga0207671_10142134 | Ga0207671_101421342 | 118 |
| 340 | 3300025914 | Ga0207671_11107428 | Ga0207671_111074281 | 118 |
| 341 | 3300025917 | Ga0207660_10093899 | Ga0207660_100938992 | 118 |
| 342 | 3300025917 | Ga0207660_10594421 | Ga0207660_105944212 | 118 |
| 343 | 3300025919 | Ga0207657_10080802 | Ga0207657_100808022 | 118 |
| 344 | 3300025919 | Ga0207657_10270451 | Ga0207657_102704512 | 118 |
| 345 | 3300025920 | Ga0207649_10783559 | Ga0207649_107835591 | 118 |
| 346 | 3300025921 | Ga0207652_10214845 | Ga0207652_102148452 | 118 |
| 347 | 3300025921 | Ga0207652_10439439 | Ga0207652_104394392 | 118 |
| 348 | 3300025924 | Ga0207694_10022041 | Ga0207694_100220412 | 118 |
| 349 | 3300025932 | Ga0207690_10674005 | Ga0207690_106740052 | 118 |
| 350 | 3300025933 | Ga0207706_10070153 | Ga0207706_100701536 | 118 |
| 351 | 3300025933 | Ga0207706_10838055 | Ga0207706_108380552 | 118 |
| 352 | 3300025934 | Ga0207686_10232000 | Ga0207686_102320002 | 118 |
| 353 | 3300025934 | Ga0207686_10621796 | Ga0207686_106217962 | 118 |
| 354 | 3300025938 | Ga0207704_10484910 | Ga0207704_104849102 | 118 |
| 355 | 3300025941 | Ga0207711_10364780 | Ga0207711_103647802 | 118 |
| 356 | 3300025942 | Ga0207689_10004086 | Ga0207689_1000408613 | 118 |
| 357 | 3300025945 | Ga0207679_10031200 | Ga0207679_100312005 | 118 |
| 358 | 3300025949 | Ga0207667_10014360 | Ga0207667_100143606 | 118 |
| 359 | 3300025981 | Ga0207640_10204133 | Ga0207640_102041332 | 118 |
| 360 | 3300026023 | Ga0207677_11875554 | Ga0207677_118755541 | 118 |
| 361 | 3300026035 | Ga0207703_10681632 | Ga0207703_106816321 | 118 |
| 362 | 3300026041 | Ga0207639_10195786 | Ga0207639_101957862 | 118 |
| 363 | 3300026041 | Ga0207639_10209383 | Ga0207639_102093832 | 118 |
| 364 | 3300026067 | Ga0207678_10001937 | Ga0207678_1000193722 | 118 |
| 365 | 3300026078 | Ga0207702_10447555 | Ga0207702_104475552 | 118 |
| 366 | 3300026089 | Ga0207648_10583042 | Ga0207648_105830422 | 118 |
| 367 | 3300026089 | Ga0207648_11438402 | Ga0207648_114384021 | 118 |
| 368 | 3300026116 | Ga0207674_10008622 | Ga0207674_100086222 | 118 |
| 369 | 3300026116 | Ga0207674_10190454 | Ga0207674_101904541 | 118 |
| 370 | 3300026118 | Ga0207675_100391408 | Ga0207675_1003914082 | 118 |
| 371 | 3300026121 | Ga0207683_10269921 | Ga0207683_102699212 | 118 |
| 372 | 3300026142 | Ga0207698_11300455 | Ga0207698_113004551 | 118 |
| 373 | 3300028379 | Ga0268266_11285187 | Ga0268266_112851871 | 118 |
| 374 | 3300028381 | Ga0268264_12208457 | Ga0268264_122084571 | 118 |
| 375 | 3300028556 | Ga0265337_1005176 | Ga0265337_10051764 | 118 |
| 376 | 3300028573 | Ga0265334_10042413 | Ga0265334_100424132 | 118 |
| 377 | 3300028800 | Ga0265338_10020650 | Ga0265338_100206503 | 118 |
| 378 | 3300028800 | Ga0265338_11078691 | Ga0265338_110786912 | 118 |
| 379 | 3300031235 | Ga0265330_10076650 | Ga0265330_100766502 | 118 |
| 380 | 3300031238 | Ga0265332_10245413 | Ga0265332_102454132 | 118 |
| 381 | 3300031239 | Ga0265328_10094053 | Ga0265328_100940533 | 118 |
| 382 | 3300031241 | Ga0265325_10297512 | Ga0265325_102975122 | 118 |
| 383 | 3300031242 | Ga0265329_10078473 | Ga0265329_100784732 | 118 |
| 384 | 3300031249 | Ga0265339_10042381 | Ga0265339_100423814 | 118 |
| 385 | 3300031249 | Ga0265339_10063039 | Ga0265339_100630394 | 118 |
| 386 | 3300031250 | Ga0265331_10019540 | Ga0265331_100195403 | 118 |
| 387 | 3300031595 | Ga0265313_10098103 | Ga0265313_100981032 | 118 |
| 388 | 3300031711 | Ga0265314_10189779 | Ga0265314_101897792 | 118 |
| 389 | 3300031712 | Ga0265342_10115446 | Ga0265342_101154463 | 118 |
| 390 | 3300031727 | Ga0316576_10226937 | Ga0316576_102269372 | 118 |
| 391 | 3300031727 | Ga0316576_10278277 | Ga0316576_102782772 | 118 |
| 392 | 3300031728 | Ga0316578_10082081 | Ga0316578_100820813 | 118 |
| 393 | 3300032126 | Ga0307415_102041530 | Ga0307415_1020415301 | 118 |
| 394 | 3300032139 | Ga0316580_10019816 | Ga0316580_100198164 | 118 |
| 395 | 3300033524 | Ga0316592_1051014 | Ga0316592_10510141 | 118 |
| 396 | 3300035113 | Ga0373936_0040723 | Ga0373936_0040723_707_1063 | 118 |
| 397 | 3300036401 | Ga0373937_0178127 | Ga0373937_0178127_316_672 | 118 |
| 398 | 3300037312 | Ga0395899_0316229 | Ga0395899_0316229_315_671 | 118 |
| 399 | 3300037312 | Ga0395899_0697649 | Ga0395899_0697649_87_458 | 118 |
| 400 | 3300037418 | Ga0395900_0075894 | Ga0395900_0075894_3006_3407 | 118 |
| 401 | 3300037418 | Ga0395900_0172754 | Ga0395900_0172754_364_720 | 118 |
| 402 | 3300037466 | Ga0395898_0013705 | Ga0395898_0013705_6171_6527 | 118 |
| 403 | 3300037466 | Ga0395898_0289354 | Ga0395898_0289354_857_1258 | 118 |
| 404 | 3300038443 | Ga0395901_0026910 | Ga0395901_0026910_723_1079 | 118 |
| 405 | 3300038443 | Ga0395901_0910084 | Ga0395901_0910084_16_417 | 118 |
| 406 | 3300038726 | Ga0400490_14970 | Ga0400490_14970_202_558 | 118 |
| 407 | 3300039437 | Ga0436365_0456767 | Ga0436365_0456767_532_891 | 118 |
| 408 | 3300041494 | Ga0451837_0593073 | Ga0451837_0593073_266_625 | 118 |
| 409 | 3300041505 | Ga0451849_1305590 | Ga0451849_1305590_135_500 | 118 |
| 410 | 3300041509 | Ga0451843_0962993 | Ga0451843_0962993_595_954 | 118 |
| 411 | 3300044694 | Ga0466963_1147881 | Ga0466963_1147881_87_452 | 118 |
| 412 | 3300045049 | Ga0466959_0958507 | Ga0466959_0958507_98_454 | 118 |
| 413 | 3300045836 | Ga0466958_0389526 | Ga0466958_0389526_223_579 | 118 |
| 414 | 3300046452 | Ga0495617_264957 | Ga0495617_264957_62_421 | 118 |
| 415 | 3300046476 | Ga0495662_0656017 | Ga0495662_0656017_44_400 | 118 |
| 416 | 3300046477 | Ga0495664_0928721 | Ga0495664_0928721_97_453 | 118 |
| 417 | 3300046506 | Ga0495583_0430853 | Ga0495583_0430853_77_433 | 118 |
| 418 | 3300046536 | Ga0495587_0017150 | Ga0495587_0017150_2492_2848 | 118 |
| 419 | 3300046557 | Ga0495622_0259044 | Ga0495622_0259044_168_524 | 118 |
| 420 | 3300046675 | Ga0495657_0739496 | Ga0495657_0739496_35_391 | 118 |
| 421 | 3300048088 | Ga0495602_0057448 | Ga0495602_0057448_1308_1664 | 118 |
| 422 | 3300048904 | Ga0496101_0012243 | Ga0496101_0012243_204_611 | 118 |
| 423 | 3300048905 | Ga0496102_0157832 | Ga0496102_0157832_267_674 | 118 |
| 424 | 3300048906 | Ga0496103_0128306 | Ga0496103_0128306_362_769 | 118 |
| 425 | 3300048906 | Ga0496103_0202574 | Ga0496103_0202574_72_479 | 118 |
| 426 | 3300048907 | Ga0496104_0052893 | Ga0496104_0052893_1741_2148 | 118 |
| 427 | 3300048908 | Ga0496105_0449289 | Ga0496105_0449289_380_787 | 118 |
| 428 | 3300048909 | Ga0496106_0015255 | Ga0496106_0015255_1798_2205 | 118 |
| 429 | 3300048910 | Ga0496107_0121259 | Ga0496107_0121259_880_1287 | 118 |
| 430 | 3300048910 | Ga0496107_0722523 | Ga0496107_0722523_270_626 | 118 |
| 431 | 3300048911 | Ga0496108_0545237 | Ga0496108_0545237_257_664 | 118 |
| 432 | 3300048912 | Ga0496109_1093934 | Ga0496109_1093934_210_617 | 118 |
| 433 | 3300048914 | Ga0496111_0859794 | Ga0496111_0859794_138_545 | 118 |
| 434 | 3300048916 | Ga0496113_1015053 | Ga0496113_1015053_83_460 | 118 |
| 435 | 3300048920 | Ga0496117_0236185 | Ga0496117_0236185_36_437 | 118 |
| 436 | 3300048929 | Ga0496126_0293496 | Ga0496126_0293496_370_771 | 118 |
| 437 | 3300049568 | Ga0501031_0186704 | Ga0501031_0186704_670_1071 | 118 |
| 438 | 3300049569 | Ga0501032_0013776 | Ga0501032_0013776_3563_3964 | 118 |
| 439 | 3300049570 | Ga0501033_0220877 | Ga0501033_0220877_418_819 | 118 |
| 440 | 3300049571 | Ga0501034_0000068 | Ga0501034_0000068_6335_6736 | 118 |
| 441 | 3300049571 | Ga0501034_0006843 | Ga0501034_0006843_4839_5240 | 118 |
| 442 | 3300049572 | Ga0501036_0130420 | Ga0501036_0130420_849_1250 | 118 |
| 443 | 3300049572 | Ga0501036_1114971 | Ga0501036_1114971_276_632 | 118 |
| 444 | 3300049573 | Ga0501037_0008627 | Ga0501037_0008627_6583_6984 | 118 |
| 445 | 3300049573 | Ga0501037_0077451 | Ga0501037_0077451_51_407 | 118 |
| 446 | 3300049574 | Ga0501038_0080357 | Ga0501038_0080357_2063_2464 | 118 |
| 447 | 3300049574 | Ga0501038_0156439 | Ga0501038_0156439_877_1278 | 118 |
| 448 | 3300049574 | Ga0501038_0269346 | Ga0501038_0269346_587_943 | 118 |
| 449 | 3300049575 | Ga0501039_0000205 | Ga0501039_0000205_18187_18588 | 118 |
| 450 | 3300049576 | Ga0501040_0277575 | Ga0501040_0277575_736_1137 | 118 |
| 451 | 3300049579 | Ga0501043_0074585 | Ga0501043_0074585_1729_2130 | 118 |
| 452 | 3300049579 | Ga0501043_0198500 | Ga0501043_0198500_995_1351 | 118 |
| 453 | 3300049579 | Ga0501043_0460734 | Ga0501043_0460734_76_477 | 118 |
| 454 | 3300049580 | Ga0501046_0007334 | Ga0501046_0007334_8632_9033 | 118 |
| 455 | 3300049580 | Ga0501046_0030319 | Ga0501046_0030319_1989_2390 | 118 |
| 456 | 3300049581 | Ga0501047_0000152 | Ga0501047_0000152_21345_21746 | 118 |
| 457 | 3300049581 | Ga0501047_0092493 | Ga0501047_0092493_1581_1937 | 118 |
| 458 | 3300049581 | Ga0501047_0137513 | Ga0501047_0137513_1591_1992 | 118 |
| 459 | 3300049581 | Ga0501047_0387396 | Ga0501047_0387396_195_551 | 118 |
| 460 | 3300049582 | Ga0501048_0002175 | Ga0501048_0002175_13011_13388 | 118 |
| 461 | 3300049583 | Ga0501067_0018422 | Ga0501067_0018422_1785_2186 | 118 |
| 462 | 3300049583 | Ga0501067_0020300 | Ga0501067_0020300_1506_1907 | 118 |
| 463 | 3300049586 | Ga0501070_0035400 | Ga0501070_0035400_2996_3397 | 118 |
| 464 | 3300049586 | Ga0501070_0206265 | Ga0501070_0206265_910_1311 | 118 |
| 465 | 3300049586 | Ga0501070_0209042 | Ga0501070_0209042_479_835 | 118 |
| 466 | 3300049586 | Ga0501070_0562077 | Ga0501070_0562077_204_605 | 118 |
| 467 | 3300049589 | Ga0501073_0238742 | Ga0501073_0238742_632_1033 | 118 |
| 468 | 3300049589 | Ga0501073_0351539 | Ga0501073_0351539_345_704 | 118 |
| 469 | 3300049589 | Ga0501073_1210338 | Ga0501073_1210338_58_459 | 118 |
| 470 | 3300049590 | Ga0501074_0105461 | Ga0501074_0105461_889_1290 | 118 |
| 471 | 3300049742 | Ga0501080_0000001 | Ga0501080_0000001_105104_105505 | 118 |
| 472 | 3300049742 | Ga0501080_1000868 | Ga0501080_1000868_46_405 | 118 |
| 473 | 3300049744 | Ga0501083_0323502 | Ga0501083_0323502_423_782 | 118 |
| 474 | 3300049822 | Ga0501035_0000015 | Ga0501035_0000015_186436_186837 | 118 |
| 475 | 3300049822 | Ga0501035_0030838 | Ga0501035_0030838_2166_2522 | 118 |
| 476 | 3300049822 | Ga0501035_0091158 | Ga0501035_0091158_1701_2102 | 118 |
| 477 | 3300049823 | Ga0501044_0000390 | Ga0501044_0000390_25346_25747 | 118 |
| 478 | 3300049823 | Ga0501044_0050955 | Ga0501044_0050955_1045_1401 | 118 |
| 479 | 3300049823 | Ga0501044_0433866 | Ga0501044_0433866_664_1065 | 118 |
| 480 | 3300049823 | Ga0501044_0618516 | Ga0501044_0618516_251_652 | 118 |
| 481 | 3300049824 | Ga0501045_0142665 | Ga0501045_0142665_117_518 | 118 |
| 482 | 3300050491 | nmdc:mga00v17_116641_c1 | nmdc:mga00v17_116641_c1_899_1258 | 118 |
| 483 | 3300050491 | nmdc:mga00v17_7378_c1 | nmdc:mga00v17_7378_c1_3608_3967 | 118 |
| 484 | 3300053083 | Ga0495655_0153712 | Ga0495655_0153712_10_417 | 118 |
| 485 | 3300053098 | Ga0500650_0284384 | Ga0500650_0284384_166_522 | 118 |
| 486 | 3300053119 | Ga0500595_014502 | Ga0500595_014502_190_591 | 118 |
| 487 | 3300053119 | Ga0500595_127329 | Ga0500595_127329_285_641 | 118 |
| 488 | 3300053153 | Ga0500616_0007417 | Ga0500616_0007417_5855_6256 | 118 |
| 489 | 3300060353 | Ga0501082_0022902 | Ga0501082_0022902_3585_3986 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.8809 | 61 | 116 |
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.8318 | 51 | 116 |
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.8168 | 61 | 116 |
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.7998 | 51 | 116 |
| 4v5m-assembly1.cif.gz_BU | trna tranlocation on the 70s ribosome: the pre-translocational translocation intermediate ti(pre) | 0.7148 | 11 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9312 | 53 | 116 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.894 | 55 | 117 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8809 | 61 | 116 | 1.10.1900.20 |
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8529 | 53 | 116 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8431 | 55 | 117 | 1.10.1900.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D8YKH1-F1-model_v4 | deleted | 1.008 | 58 | 116 |
|
| AF-A0A659UR08-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.007 | 57 | 116 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A357L7L9-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.007 | 61 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7G2DR74-F1-model_v4 | Large ribosomal subunit protein bL20c (50S ribosomal protein L20, chloroplastic) | 1.005 | 58 | 116 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-X8FDF3-F1-model_v4 | deleted | 1.005 | 61 | 116 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar