F453651

General Info

Members Datasets Scaffolds Average Seq Length
488 280 976 239

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0409383|Ga0466967_0409383_501_1286
Length 261
Sequence MASAEGTDEGICLMDRLSVRHLEVRYGDLIGVADVSLDVPLGSVVALVGSNGAGKTTTLNAIAGLVPPSGGAIEWQGQTITRQPAYAIVSRGLALSPEGWQLFVSQTVEQNLRLGTTSLRDRSRAASLFERVYTLFPRLKERRNQLAGTLSGGERQMLAVGRALMSEPKLLMLDEPSLGLAPAVVETLYETLHRLHDEGLTLLLAEQSLELAFDIADYAYVLQTGRTVLEGPPAELEKNEQVQEIYLGISKGGAAATGNQA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.41
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.53
Rhizosphere 90.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0409383 3300045976 Bacteria 1320
2 Ga0065712_10035637 3300005290 Bacteria 1303
3 Ga0065715_10037957 3300005293 Bacteria 1459
4 Ga0070676_10036234 3300005328 Bacteria 2841
5 Ga0070683_100004460 3300005329 Bacteria 11548
6 Ga0070683_100079984 3300005329 Bacteria 3059
7 Ga0070683_100262235 3300005329 Bacteria 1644
8 Ga0070690_100018336 3300005330 Bacteria 4226
9 Ga0070690_100046270 3300005330 Bacteria 2766
10 Ga0070690_100076510 3300005330 Bacteria 2183
11 Ga0070690_100176561 3300005330 Bacteria 1473
12 Ga0070670_100131721 3300005331 Bacteria 2159
13 Ga0070677_10001786 3300005333 Bacteria 6805
14 Ga0070666_10548225 3300005335 Bacteria 841
15 Ga0070682_100005127 3300005337 Bacteria 7288
16 Ga0070689_100318794 3300005340 Bacteria 1298
17 Ga0070687_100214645 3300005343 Bacteria 1174
18 Ga0070674_100012863 3300005356 Bacteria 5152
19 Ga0070674_100087433 3300005356 Bacteria 2241
20 Ga0070674_100119794 3300005356 Bacteria 1947
21 Ga0070674_100301732 3300005356 Bacteria 1277
22 Ga0070673_100224402 3300005364 Bacteria 1627
23 Ga0070673_100257355 3300005364 Bacteria 1524
24 Ga0070688_100047946 3300005365 Bacteria 2652
25 Ga0070659_100100233 3300005366 Bacteria 2331
26 Ga0070667_100121498 3300005367 Bacteria 2272
27 Ga0070709_10002380 3300005434 Bacteria 10180
28 Ga0070709_10007915 3300005434 Bacteria 5836
29 Ga0070709_10024139 3300005434 Bacteria 3577
30 Ga0070714_100004035 3300005435 Bacteria 11037
31 Ga0070714_100046612 3300005435 Bacteria 3678
32 Ga0070714_100218494 3300005435 Bacteria 1750
33 Ga0070714_100399957 3300005435 Bacteria 1298
34 Ga0070714_100421144 3300005435 Bacteria 1265
35 Ga0070713_100023978 3300005436 Bacteria 4745
36 Ga0070713_100035848 3300005436 Bacteria 3997
37 Ga0070713_100045762 3300005436 Bacteria 3588
38 Ga0070713_100104221 3300005436 Bacteria 2462
39 Ga0070713_100133645 3300005436 Bacteria 2190
40 Ga0070710_10001831 3300005437 Bacteria 10020
41 Ga0070710_10192360 3300005437 Bacteria 1284
42 Ga0070711_100003229 3300005439 Bacteria 9465
43 Ga0070711_100045939 3300005439 Bacteria 2973
44 Ga0070700_100131414 3300005441 Bacteria 1690
45 Ga0070678_100042970 3300005456 Bacteria 3216
46 Ga0070662_100825228 3300005457 Bacteria 789
47 Ga0070681_10005331 3300005458 Bacteria 12409
48 Ga0070685_10112781 3300005466 Bacteria 1677
49 Ga0070679_100007272 3300005530 Bacteria 10338
50 Ga0070679_100093673 3300005530 Bacteria 2991
51 Ga0070684_100010952 3300005535 Bacteria 7209
52 Ga0070684_100021912 3300005535 Bacteria 5323
53 Ga0068853_100737339 3300005539 Bacteria 941
54 Ga0070672_100594038 3300005543 Bacteria 964
55 Ga0070686_100674155 3300005544 Bacteria 822
56 Ga0070665_100221010 3300005548 Bacteria 1895
57 Ga0070704_100390322 3300005549 Bacteria 1185
58 Ga0068855_100158498 3300005563 Bacteria 2570
59 Ga0068855_100761430 3300005563 Bacteria 1032
60 Ga0070664_100041659 3300005564 Bacteria 3875
61 Ga0068857_100526417 3300005577 Bacteria 1111
62 Ga0068854_100188801 3300005578 Bacteria 1613
63 Ga0068854_100318300 3300005578 Bacteria 1264
64 Ga0068856_100066208 3300005614 Bacteria 3570
65 Ga0068856_100696044 3300005614 Bacteria 1037
66 Ga0068852_100045874 3300005616 Bacteria 3720
67 Ga0068852_100428342 3300005616 Bacteria 1306
68 Ga0068864_100087463 3300005618 Bacteria 2743
69 Ga0068864_100544678 3300005618 Bacteria 1121
70 Ga0068866_10241800 3300005718 Bacteria 1100
71 Ga0068861_100868819 3300005719 Bacteria 852
72 Ga0068863_100666411 3300005841 Bacteria 1032
73 Ga0068858_100250045 3300005842 Bacteria 1684
74 Ga0068860_100204211 3300005843 Bacteria 1916
75 Ga0068862_100377831 3300005844 Bacteria 1321
76 Ga0081455_10005026 3300005937 Bacteria 14629
77 Ga0081455_10032500 3300005937 Bacteria 4701
78 Ga0081538_10028784 3300005981 Bacteria 3811
79 Ga0070717_10002140 3300006028 Bacteria 13847
80 Ga0070717_10030126 3300006028 Bacteria 4359
81 Ga0070716_100011810 3300006173 Bacteria 4406
82 Ga0070712_100187387 3300006175 Bacteria 1616
83 Ga0097621_100712903 3300006237 Bacteria 924
84 Ga0068871_100024757 3300006358 Bacteria 4659
85 Ga0075428_100001065 3300006844 Bacteria 29134
86 Ga0075428_100163436 3300006844 Bacteria 2415
87 Ga0075433_10244998 3300006852 Bacteria 1591
88 Ga0075434_100126021 3300006871 Bacteria 2578
89 Ga0075434_100482188 3300006871 Bacteria 1261
90 Ga0075429_100000221 3300006880 Bacteria 38578
91 Ga0068865_100218437 3300006881 Bacteria 1489
92 Ga0075436_100332329 3300006914 Bacteria 1093
93 Ga0105240_10110236 3300009093 Bacteria 3332
94 Ga0105240_10226075 3300009093 Bacteria 2177
95 Ga0105240_10248681 3300009093 Bacteria 2058
96 Ga0111539_10021705 3300009094 Bacteria 7896
97 Ga0111539_10200618 3300009094 Bacteria 2326
98 Ga0111539_10696852 3300009094 Bacteria 1182
99 Ga0105245_11109729 3300009098 Bacteria 837
100 Ga0114129_10000015 3300009147 Bacteria 129075
101 Ga0105241_10071994 3300009174 Bacteria 2685
102 Ga0105241_10342479 3300009174 Bacteria 1296
103 Ga0105242_10236006 3300009176 Bacteria 1641
104 Ga0105242_11093321 3300009176 Bacteria 811
105 Ga0105248_10007295 3300009177 Bacteria 12130
106 Ga0105248_10091256 3300009177 Bacteria 3431
107 Ga0105248_10779633 3300009177 Bacteria 1079
108 Ga0105237_10258308 3300009545 Bacteria 1745
109 Ga0105238_10219574 3300009551 Bacteria 1877
110 Ga0105238_10228934 3300009551 Bacteria 1836
111 Ga0105239_10564289 3300010375 Bacteria 1297
112 Ga0105239_10643026 3300010375 Bacteria 1211
113 Ga0105246_10134493 3300011119 Bacteria 1851
114 Ga0105246_10508694 3300011119 Bacteria 1024
115 Ga0157369_10017597 3300013105 Bacteria 8032
116 Ga0157369_10027195 3300013105 Bacteria 6343
117 Ga0157369_10579699 3300013105 Bacteria 1159
118 Ga0157378_10141449 3300013297 Bacteria 2234
119 Ga0163162_10049242 3300013306 Bacteria 4223
120 Ga0157372_10005880 3300013307 Bacteria 13059
121 Ga0157372_10514269 3300013307 Bacteria 1396
122 Ga0157372_10527297 3300013307 Bacteria 1377
123 Ga0157372_10752852 3300013307 Bacteria 1133
124 Ga0163163_10014585 3300014325 Bacteria 7229
125 Ga0163163_10323002 3300014325 Bacteria 1597
126 Ga0157380_10033167 3300014326 Bacteria 3976
127 Ga0182008_10052711 3300014497 Bacteria 2016
128 Ga0157377_10343640 3300014745 Bacteria 999
129 Ga0157379_10056463 3300014968 Bacteria 3508
130 Ga0157379_10119739 3300014968 Bacteria 2368
131 Ga0157376_10075689 3300014969 Bacteria 2873
132 Ga0163161_10009358 3300017792 Bacteria 6779
133 Ga0206353_10883993 3300020082 Bacteria 900
134 Ga0206353_11580630 3300020082 Bacteria 2530
135 Ga0213874_10018679 3300021377 Bacteria 1876
136 Ga0213876_10013698 3300021384 Bacteria 4298
137 Ga0213876_10016604 3300021384 Bacteria 3890
138 Ga0213876_10095037 3300021384 Bacteria 1579
139 Ga0213876_10109574 3300021384 Bacteria 1465
140 Ga0213875_10001241 3300021388 Bacteria 17201
141 Ga0213875_10005591 3300021388 Bacteria 6722
142 Ga0224572_1003681 3300024225 Bacteria 2606
143 Ga0224572_1007965 3300024225 Bacteria 1952
144 Ga0207697_10178539 3300025315 Bacteria 930
145 Ga0207682_10003542 3300025893 Bacteria 6754
146 Ga0207692_10001838 3300025898 Bacteria 8062
147 Ga0207688_10098081 3300025901 Bacteria 1689
148 Ga0207680_10176267 3300025903 Bacteria 1443
149 Ga0207699_10005803 3300025906 Bacteria 5940
150 Ga0207699_10013937 3300025906 Bacteria 4130
151 Ga0207699_10044961 3300025906 Bacteria 2574
152 Ga0207699_10545955 3300025906 Bacteria 840
153 Ga0207645_10014012 3300025907 Bacteria 5378
154 Ga0207643_10028025 3300025908 Bacteria 3125
155 Ga0207654_10387045 3300025911 Bacteria 970
156 Ga0207707_10000642 3300025912 Bacteria 34523
157 Ga0207707_10013022 3300025912 Bacteria 7241
158 Ga0207707_10075094 3300025912 Bacteria 2949
159 Ga0207695_10053857 3300025913 Bacteria 4205
160 Ga0207695_10151368 3300025913 Bacteria 2259
161 Ga0207695_10176814 3300025913 Bacteria 2057
162 Ga0207695_10219740 3300025913 Bacteria 1808
163 Ga0207671_10544110 3300025914 Bacteria 926
164 Ga0207693_10000581 3300025915 Bacteria 32715
165 Ga0207693_10133453 3300025915 Bacteria 1952
166 Ga0207693_10778721 3300025915 Bacteria 738
167 Ga0207663_10000084 3300025916 Bacteria 44454
168 Ga0207663_10037195 3300025916 Bacteria 2933
169 Ga0207660_10355950 3300025917 Bacteria 1174
170 Ga0207662_10232840 3300025918 Bacteria 1204
171 Ga0207657_10237777 3300025919 Bacteria 1455
172 Ga0207649_10088518 3300025920 Bacteria 2022
173 Ga0207649_10354518 3300025920 Bacteria 1087
174 Ga0207652_10140320 3300025921 Bacteria 2161
175 Ga0207694_10407951 3300025924 Bacteria 1130
176 Ga0207694_10552537 3300025924 Bacteria 966
177 Ga0207659_10280378 3300025926 Bacteria 1362
178 Ga0207687_10490986 3300025927 Bacteria 1024
179 Ga0207664_10010621 3300025929 Bacteria 6509
180 Ga0207664_10103704 3300025929 Bacteria 2354
181 Ga0207664_10375812 3300025929 Bacteria 1261
182 Ga0207644_10346143 3300025931 Bacteria 1206
183 Ga0207706_10059760 3300025933 Bacteria 3357
184 Ga0207706_10641187 3300025933 Bacteria 910
185 Ga0207670_10249644 3300025936 Bacteria 1371
186 Ga0207669_10014985 3300025937 Bacteria 3898
187 Ga0207665_10001451 3300025939 Bacteria 15944
188 Ga0207665_10150292 3300025939 Bacteria 1668
189 Ga0207691_10003165 3300025940 Bacteria 16089
190 Ga0207711_10029672 3300025941 Bacteria 4614
191 Ga0207689_10011420 3300025942 Bacteria 7612
192 Ga0207661_10006741 3300025944 Bacteria 8129
193 Ga0207661_10034996 3300025944 Bacteria 3911
194 Ga0207661_10044242 3300025944 Bacteria 3518
195 Ga0207661_10377616 3300025944 Bacteria 1282
196 Ga0207679_10132723 3300025945 Bacteria 2000
197 Ga0207679_10500123 3300025945 Bacteria 1084
198 Ga0207667_10035113 3300025949 Bacteria 5380
199 Ga0207651_10311404 3300025960 Bacteria 1313
200 Ga0207640_10049257 3300025981 Bacteria 2727
201 Ga0207640_10081610 3300025981 Bacteria 2212
202 Ga0207640_10661366 3300025981 Bacteria 891
203 Ga0207658_10091586 3300025986 Bacteria 2359
204 Ga0207677_10102313 3300026023 Bacteria 2112
205 Ga0207703_10209854 3300026035 Bacteria 1736
206 Ga0207639_10090539 3300026041 Bacteria 2447
207 Ga0207678_10093141 3300026067 Bacteria 2575
208 Ga0207678_10219160 3300026067 Bacteria 1629
209 Ga0207678_10859231 3300026067 Bacteria 802
210 Ga0207708_10296779 3300026075 Bacteria 1313
211 Ga0207708_10825054 3300026075 Bacteria 799
212 Ga0207702_10305479 3300026078 Bacteria 1511
213 Ga0207702_10697890 3300026078 Bacteria 1000
214 Ga0207641_10297350 3300026088 Bacteria 1524
215 Ga0207648_10014698 3300026089 Bacteria 7224
216 Ga0207648_10045528 3300026089 Bacteria 3848
217 Ga0207676_10119530 3300026095 Bacteria 2219
218 Ga0207674_10081044 3300026116 Bacteria 3248
219 Ga0207674_10102352 3300026116 Bacteria 2844
220 Ga0207674_10441292 3300026116 Bacteria 1258
221 Ga0207675_100766287 3300026118 Bacteria 977
222 Ga0207683_10006991 3300026121 Bacteria 9675
223 Ga0207683_10030616 3300026121 Bacteria 4664
224 Ga0207683_10100665 3300026121 Bacteria 2580
225 Ga0207698_10016337 3300026142 Bacteria 5000
226 Ga0207698_10346905 3300026142 Bacteria 1401
227 Ga0207428_10002176 3300027907 Bacteria 19675
228 Ga0268266_10110119 3300028379 Bacteria 2439
229 Ga0268265_10252127 3300028380 Bacteria 1564
230 Ga0265318_10031037 3300028577 Bacteria 2076
231 Ga0265338_10197520 3300028800 Bacteria 1519
232 Ga0265320_10008692 3300031240 Bacteria 6187
233 Ga0265325_10002671 3300031241 Bacteria 11936
234 Ga0265325_10170202 3300031241 Bacteria 1020
235 Ga0265339_10003924 3300031249 Bacteria 10292
236 Ga0265327_10127298 3300031251 Bacteria 1201
237 Ga0307513_10491631 3300031456 Bacteria 945
238 Ga0265313_10012286 3300031595 Bacteria 5240
239 Ga0307508_10034118 3300031616 Bacteria 4589
240 Ga0265314_10007016 3300031711 Bacteria 9843
241 Ga0307413_10250408 3300031824 Bacteria 1314
242 Ga0307406_10037728 3300031901 Bacteria 2987
243 Ga0307416_100060998 3300032002 Bacteria 3075
244 Ga0373930_0022009 3300034816 Bacteria 1257
245 Ga0373938_0053104 3300034957 Bacteria 930
246 Ga0373928_0045334 3300035084 Bacteria 1023
247 Ga0373940_0022137 3300035088 Bacteria 1631
248 Ga0373944_0093791 3300035089 Bacteria 1006
249 Ga0373949_0002057 3300035090 Bacteria 5327
250 Ga0373951_0009202 3300035091 Bacteria 2225
251 Ga0373923_0002745 3300035111 Bacteria 5495
252 Ga0373932_0006206 3300035112 Bacteria 2824
253 Ga0373939_0005876 3300035114 Bacteria 2936
254 Ga0373941_0051122 3300035115 Bacteria 1314
255 Ga0373941_0116757 3300035115 Bacteria 947
256 Ga0373953_0134526 3300035117 Bacteria 1055
257 Ga0373954_0137858 3300035118 Bacteria 1189
258 Ga0373960_0028335 3300035121 Bacteria 1545
259 Ga0373946_0003973 3300035171 Bacteria 5259
260 Ga0373955_0008088 3300035172 Bacteria 4864
261 Ga0373942_0011294 3300035207 Bacteria 2116
262 Ga0373961_0062197 3300035241 Bacteria 1136
263 Ga0373924_0004585 3300035410 Bacteria 4834
264 Ga0373931_0001654 3300035691 Bacteria 9644
265 Ga0373931_0186127 3300035691 Bacteria 1232
266 Ga0373927_0232411 3300035695 Bacteria 1211
267 Ga0373933_0217026 3300035724 Bacteria 1226
268 Ga0373947_0005034 3300035725 Bacteria 7738
269 Ga0373937_0070933 3300036401 Bacteria 3213
270 Ga0373925_0003867 3300037068 Bacteria 11456
271 Ga0373925_0096855 3300037068 Bacteria 2262
272 Ga0395899_0002058 3300037312 Bacteria 16557
273 Ga0395899_0034475 3300037312 Bacteria 3801
274 Ga0395899_0041076 3300037312 Bacteria 3457
275 Ga0395899_0072912 3300037312 Bacteria 2512
276 Ga0395899_0296237 3300037312 Bacteria 1096
277 Ga0395899_0415447 3300037312 Bacteria 887
278 Ga0395900_0010224 3300037418 Bacteria 9596
279 Ga0395900_0012284 3300037418 Bacteria 8757
280 Ga0395900_0016562 3300037418 Bacteria 7520
281 Ga0395900_0032920 3300037418 Bacteria 5333
282 Ga0395900_0091984 3300037418 Bacteria 3116
283 Ga0395900_0182970 3300037418 Bacteria 2128
284 Ga0395900_0277511 3300037418 Bacteria 1669
285 Ga0395900_0409636 3300037418 Bacteria 1318
286 Ga0395898_0010168 3300037466 Bacteria 9848
287 Ga0395898_0044597 3300037466 Bacteria 4362
288 Ga0395898_0045833 3300037466 Bacteria 4296
289 Ga0395898_0092839 3300037466 Bacteria 2902
290 Ga0395898_0134593 3300037466 Bacteria 2366
291 Ga0395905_0000237 3300037471 Bacteria 83220
292 Ga0395905_0001574 3300037471 Bacteria 27238
293 Ga0395905_0131854 3300037471 Bacteria 2350
294 Ga0395905_0469144 3300037471 Bacteria 1157
295 Ga0395905_0635693 3300037471 Bacteria 969
296 Ga0436364_1206713 3300037853 Bacteria 32706
297 Ga0436364_1278600 3300037853 Bacteria 14505
298 Ga0395901_0001024 3300038443 Bacteria 30233
299 Ga0395901_0017632 3300038443 Bacteria 7290
300 Ga0395901_0026167 3300038443 Bacteria 5990
301 Ga0395901_0070639 3300038443 Bacteria 3638
302 Ga0395901_0122873 3300038443 Bacteria 2728
303 Ga0395901_0234904 3300038443 Bacteria 1913
304 Ga0436365_0556883 3300039437 Bacteria 3786
305 Ga0436365_0929489 3300039437 Bacteria 4321
306 Ga0436365_1214917 3300039437 Bacteria 8040
307 Ga0436365_1817318 3300039437 Bacteria 20232
308 Ga0436365_1873205 3300039437 Bacteria 55177
309 Ga0436360_1310202 3300039438 Bacteria 6411
310 Ga0436360_1340332 3300039438 Bacteria 808
311 Ga0436363_1060313 3300039450 Bacteria 1544
312 Ga0439460_0085220 3300042461 Bacteria 997
313 Ga0466966_0172521 3300044684 Bacteria 1314
314 Ga0466963_0001613 3300044694 Bacteria 12260
315 Ga0466963_0017314 3300044694 Bacteria 4491
316 Ga0466963_0082991 3300044694 Bacteria 2173
317 Ga0466964_0101517 3300044706 Bacteria 1269
318 Ga0466971_0034621 3300044719 Bacteria 2263
319 Ga0466957_0062499 3300044842 Bacteria 2287
320 Ga0466957_0131425 3300044842 Bacteria 1604
321 Ga0466959_0300826 3300045049 Bacteria 1098
322 Ga0451576_0039398 3300045051 Bacteria 5001
323 Ga0451576_0137059 3300045051 Bacteria 2552
324 Ga0466958_0004816 3300045836 Bacteria 7182
325 Ga0466958_0065336 3300045836 Bacteria 2220
326 Ga0466958_0175415 3300045836 Bacteria 1359
327 Ga0466958_0226454 3300045836 Bacteria 1193
328 Ga0466967_0016793 3300045976 Bacteria 5785
329 Ga0466967_0038432 3300045976 Bacteria 4105
330 Ga0466967_0183259 3300045976 Bacteria 1976
331 Ga0466967_0238061 3300045976 Bacteria 1735
332 Ga0466967_0292519 3300045976 Bacteria 1565
333 Ga0466967_0369866 3300045976 Bacteria 1390
334 Ga0495629_0009218 3300046459 Bacteria 7223
335 Ga0495639_0007077 3300046475 Bacteria 4817
336 Ga0495664_0041120 3300046477 Bacteria 2734
337 Ga0495664_0085160 3300046477 Bacteria 1897
338 Ga0495664_0142612 3300046477 Bacteria 1452
339 Ga0495594_0032641 3300046499 Bacteria 2827
340 Ga0495608_0295606 3300046511 Bacteria 1003
341 Ga0495618_0039684 3300046514 Bacteria 2960
342 Ga0495628_0053337 3300046516 Bacteria 3191
343 Ga0495644_0081055 3300046523 Bacteria 1223
344 Ga0495652_0088149 3300046529 Bacteria 2544
345 Ga0495665_0018945 3300046531 Bacteria 3699
346 Ga0495640_0054160 3300046533 Bacteria 2749
347 Ga0495640_0224417 3300046533 Bacteria 1184
348 Ga0495598_0030044 3300046537 Bacteria 1519
349 Ga0495645_0003348 3300046543 Bacteria 10861
350 Ga0495645_0192598 3300046543 Bacteria 1388
351 Ga0495667_0171508 3300046559 Bacteria 1394
352 Ga0495656_0033186 3300046615 Bacteria 2105
353 Ga0495668_0304747 3300046616 Bacteria 873
354 Ga0495634_0040085 3300046642 Bacteria 3187
355 Ga0495611_0085593 3300046648 Bacteria 1454
356 Ga0495635_0037966 3300046663 Bacteria 3334
357 Ga0495658_0029013 3300046683 Bacteria 2990
358 Ga0495604_0036388 3300047317 Bacteria 3881
359 Ga0495674_0076598 3300047319 Bacteria 2876
360 Ga0495674_0162646 3300047319 Bacteria 1867
361 Ga0495677_0052258 3300047445 Bacteria 1506
362 Ga0495684_0002766 3300047471 Bacteria 13841
363 Ga0495593_0009234 3300047673 Bacteria 5718
364 Ga0496100_0099093 3300048903 Bacteria 2004
365 Ga0496101_0101871 3300048904 Bacteria 2150
366 Ga0496102_0018908 3300048905 Bacteria 6062
367 Ga0496102_0217282 3300048905 Bacteria 1802
368 Ga0496104_0304101 3300048907 Bacteria 1507
369 Ga0496105_0154908 3300048908 Bacteria 1882
370 Ga0496106_0002440 3300048909 Bacteria 13854
371 Ga0496106_0018102 3300048909 Bacteria 5209
372 Ga0496106_0176412 3300048909 Bacteria 1695
373 Ga0496107_0004195 3300048910 Bacteria 9734
374 Ga0496107_0376809 3300048910 Bacteria 1055
375 Ga0496108_0006903 3300048911 Bacteria 9189
376 Ga0496108_0075249 3300048911 Bacteria 2852
377 Ga0496108_0178920 3300048911 Bacteria 1836
378 Ga0496109_0000201 3300048912 Bacteria 59452
379 Ga0496109_0183021 3300048912 Bacteria 1968
380 Ga0496109_0507674 3300048912 Bacteria 1138
381 Ga0496110_0005518 3300048913 Bacteria 9928
382 Ga0496110_0047387 3300048913 Bacteria 3763
383 Ga0496110_0284706 3300048913 Bacteria 1505
384 Ga0496111_0132300 3300048914 Bacteria 1846
385 Ga0496112_0000004 3300048915 Bacteria 553294
386 Ga0496112_0010646 3300048915 Bacteria 8354
387 Ga0496112_0025368 3300048915 Bacteria 5692
388 Ga0496113_0145286 3300048916 Bacteria 1868
389 Ga0496113_0197472 3300048916 Bacteria 1598
390 Ga0496114_0099862 3300048917 Bacteria 2476
391 Ga0501031_0000268 3300049568 Bacteria 29430
392 Ga0501032_0000765 3300049569 Bacteria 26091
393 Ga0501033_0000108 3300049570 Bacteria 79903
394 Ga0501034_0000100 3300049571 Bacteria 159536
395 Ga0501034_0004441 3300049571 Bacteria 15598
396 Ga0501034_0011260 3300049571 Bacteria 9284
397 Ga0501034_0013268 3300049571 Bacteria 8488
398 Ga0501036_0000228 3300049572 Bacteria 37800
399 Ga0501036_0087447 3300049572 Bacteria 2634
400 Ga0501036_0148929 3300049572 Bacteria 1974
401 Ga0501037_0002072 3300049573 Bacteria 14545
402 Ga0501038_0000350 3300049574 Bacteria 39547
403 Ga0501038_0098098 3300049574 Bacteria 2444
404 Ga0501038_0284424 3300049574 Bacteria 1301
405 Ga0501039_0001602 3300049575 Bacteria 16666
406 Ga0501039_0204905 3300049575 Bacteria 1551
407 Ga0501040_0075378 3300049576 Bacteria 2331
408 Ga0501040_0109610 3300049576 Bacteria 1930
409 Ga0501041_0067103 3300049577 Bacteria 2199
410 Ga0501041_0105757 3300049577 Bacteria 1744
411 Ga0501042_0032769 3300049578 Bacteria 3681
412 Ga0501042_0091268 3300049578 Bacteria 2186
413 Ga0501043_0000085 3300049579 Bacteria 83544
414 Ga0501043_0232769 3300049579 Bacteria 1423
415 Ga0501043_0261521 3300049579 Bacteria 1331
416 Ga0501046_0000426 3300049580 Bacteria 42186
417 Ga0501046_0042221 3300049580 Bacteria 3636
418 Ga0501046_0061025 3300049580 Bacteria 2950
419 Ga0501047_0000221 3300049581 Bacteria 68563
420 Ga0501047_0365003 3300049581 Bacteria 1279
421 Ga0501047_0499406 3300049581 Bacteria 1043
422 Ga0501048_0000621 3300049582 Bacteria 25292
423 Ga0501048_0097109 3300049582 Bacteria 2078
424 Ga0501048_0186936 3300049582 Bacteria 1468
425 Ga0501067_0000384 3300049583 Bacteria 24036
426 Ga0501067_0123440 3300049583 Bacteria 1441
427 Ga0501068_0002221 3300049584 Bacteria 10327
428 Ga0501068_0085310 3300049584 Bacteria 1943
429 Ga0501068_0315908 3300049584 Bacteria 1001
430 Ga0501068_0489098 3300049584 Bacteria 798
431 Ga0501069_0004243 3300049585 Bacteria 7409
432 Ga0501070_0001287 3300049586 Bacteria 22514
433 Ga0501070_0002523 3300049586 Bacteria 16046
434 Ga0501070_0030958 3300049586 Bacteria 4482
435 Ga0501070_0581356 3300049586 Bacteria 894
436 Ga0501071_0095202 3300049587 Bacteria 2191
437 Ga0501071_0120780 3300049587 Bacteria 1942
438 Ga0501071_0128511 3300049587 Bacteria 1882
439 Ga0501071_0140750 3300049587 Bacteria 1796
440 Ga0501072_0001233 3300049588 Bacteria 19088
441 Ga0501072_0088926 3300049588 Bacteria 2451
442 Ga0501072_0682694 3300049588 Bacteria 808
443 Ga0501073_0001343 3300049589 Bacteria 18116
444 Ga0501073_0103677 3300049589 Bacteria 1975
445 Ga0501074_0000094 3300049590 Bacteria 42565
446 Ga0501074_0049863 3300049590 Bacteria 3022
447 Ga0501074_0267554 3300049590 Bacteria 1215
448 Ga0501075_0014291 3300049591 Bacteria 5688
449 Ga0501075_0070506 3300049591 Bacteria 2641
450 Ga0501076_0073731 3300049592 Bacteria 2733
451 Ga0501076_0136344 3300049592 Bacteria 1992
452 Ga0501076_0503321 3300049592 Bacteria 998
453 Ga0501077_0030235 3300049593 Bacteria 3447
454 Ga0501079_0002821 3300049741 Bacteria 12669
455 Ga0501079_0024551 3300049741 Bacteria 4626
456 Ga0501079_0223437 3300049741 Bacteria 1471
457 Ga0501080_0007102 3300049742 Bacteria 10113
458 Ga0501080_0060563 3300049742 Bacteria 3524
459 Ga0501080_0869035 3300049742 Bacteria 787
460 Ga0501081_0032616 3300049743 Bacteria 3534
461 Ga0501083_0002500 3300049744 Bacteria 12612
462 Ga0501083_0003299 3300049744 Bacteria 11276
463 Ga0501083_0079410 3300049744 Bacteria 2176
464 Ga0501083_0253525 3300049744 Bacteria 1145
465 Ga0501083_0257604 3300049744 Bacteria 1135
466 Ga0501044_0000970 3300049823 Bacteria 34530
467 Ga0501044_0094061 3300049823 Bacteria 3022
468 Ga0501045_0016665 3300049824 Bacteria 5220
469 Ga0501045_0018056 3300049824 Bacteria 5011
470 nmdc:mga05p37_1565_c1 3300050507 Bacteria 26589
471 nmdc:mga09592_112_c1 3300050508 Bacteria 50879
472 nmdc:mga08y16_21313_c1 3300050511 Bacteria 6843
473 nmdc:mga08y16_291537_c1 3300050511 Bacteria 1682
474 nmdc:mga0rr50_109022_c1 3300050513 Bacteria 2188
475 nmdc:mga08x19_368558_c1 3300050514 Bacteria 1005
476 nmdc:mga0a205_551308_c1 3300050515 Bacteria 1008
477 Ga0495601_0073642 3300053077 Bacteria 2184
478 Ga0495601_0125824 3300053077 Bacteria 1667
479 Ga0495612_0037637 3300053078 Bacteria 1965
480 Ga0501084_0002518 3300054114 Bacteria 14755
481 Ga0501084_0108441 3300054114 Bacteria 2333
482 Ga0501084_0138811 3300054114 Bacteria 2046
483 Ga0501082_0000452 3300060353 Bacteria 36318
484 Ga0501082_0443540 3300060353 Bacteria 1134
485 Ga0466962_0019078 3300061719 Bacteria 3294
486 Ga0530510_0148964 3300061734 Bacteria 1727
487 Ga0530510_0298500 3300061734 Bacteria 1205
488 2643754463 2643221547 Bacteria 4740017
489 Ga0466967_0409383
490 Ga0065712_10035637
491 Ga0065715_10037957
492 Ga0070676_10036234
493 Ga0070683_100004460
494 Ga0070683_100079984
495 Ga0070683_100262235
496 Ga0070690_100018336
497 Ga0070690_100046270
498 Ga0070690_100076510
499 Ga0070690_100176561
500 Ga0070670_100131721
501 Ga0070677_10001786
502 Ga0070666_10548225
503 Ga0070682_100005127
504 Ga0070689_100318794
505 Ga0070687_100214645
506 Ga0070674_100012863
507 Ga0070674_100087433
508 Ga0070674_100119794
509 Ga0070674_100301732
510 Ga0070673_100224402
511 Ga0070673_100257355
512 Ga0070688_100047946
513 Ga0070659_100100233
514 Ga0070667_100121498
515 Ga0070709_10002380
516 Ga0070709_10007915
517 Ga0070709_10024139
518 Ga0070714_100004035
519 Ga0070714_100046612
520 Ga0070714_100218494
521 Ga0070714_100399957
522 Ga0070714_100421144
523 Ga0070713_100023978
524 Ga0070713_100035848
525 Ga0070713_100045762
526 Ga0070713_100104221
527 Ga0070713_100133645
528 Ga0070710_10001831
529 Ga0070710_10192360
530 Ga0070711_100003229
531 Ga0070711_100045939
532 Ga0070700_100131414
533 Ga0070678_100042970
534 Ga0070662_100825228
535 Ga0070681_10005331
536 Ga0070685_10112781
537 Ga0070679_100007272
538 Ga0070679_100093673
539 Ga0070684_100010952
540 Ga0070684_100021912
541 Ga0068853_100737339
542 Ga0070672_100594038
543 Ga0070686_100674155
544 Ga0070665_100221010
545 Ga0070704_100390322
546 Ga0068855_100158498
547 Ga0068855_100761430
548 Ga0070664_100041659
549 Ga0068857_100526417
550 Ga0068854_100188801
551 Ga0068854_100318300
552 Ga0068856_100066208
553 Ga0068856_100696044
554 Ga0068852_100045874
555 Ga0068852_100428342
556 Ga0068864_100087463
557 Ga0068864_100544678
558 Ga0068866_10241800
559 Ga0068861_100868819
560 Ga0068863_100666411
561 Ga0068858_100250045
562 Ga0068860_100204211
563 Ga0068862_100377831
564 Ga0081455_10005026
565 Ga0081455_10032500
566 Ga0081538_10028784
567 Ga0070717_10002140
568 Ga0070717_10030126
569 Ga0070716_100011810
570 Ga0070712_100187387
571 Ga0097621_100712903
572 Ga0068871_100024757
573 Ga0075428_100001065
574 Ga0075428_100163436
575 Ga0075433_10244998
576 Ga0075434_100126021
577 Ga0075434_100482188
578 Ga0075429_100000221
579 Ga0068865_100218437
580 Ga0075436_100332329
581 Ga0105240_10110236
582 Ga0105240_10226075
583 Ga0105240_10248681
584 Ga0111539_10021705
585 Ga0111539_10200618
586 Ga0111539_10696852
587 Ga0105245_11109729
588 Ga0114129_10000015
589 Ga0105241_10071994
590 Ga0105241_10342479
591 Ga0105242_10236006
592 Ga0105242_11093321
593 Ga0105248_10007295
594 Ga0105248_10091256
595 Ga0105248_10779633
596 Ga0105237_10258308
597 Ga0105238_10219574
598 Ga0105238_10228934
599 Ga0105239_10564289
600 Ga0105239_10643026
601 Ga0105246_10134493
602 Ga0105246_10508694
603 Ga0157369_10017597
604 Ga0157369_10027195
605 Ga0157369_10579699
606 Ga0157378_10141449
607 Ga0163162_10049242
608 Ga0157372_10005880
609 Ga0157372_10514269
610 Ga0157372_10527297
611 Ga0157372_10752852
612 Ga0163163_10014585
613 Ga0163163_10323002
614 Ga0157380_10033167
615 Ga0182008_10052711
616 Ga0157377_10343640
617 Ga0157379_10056463
618 Ga0157379_10119739
619 Ga0157376_10075689
620 Ga0163161_10009358
621 Ga0206353_10883993
622 Ga0206353_11580630
623 Ga0213874_10018679
624 Ga0213876_10013698
625 Ga0213876_10016604
626 Ga0213876_10095037
627 Ga0213876_10109574
628 Ga0213875_10001241
629 Ga0213875_10005591
630 Ga0224572_1003681
631 Ga0224572_1007965
632 Ga0207697_10178539
633 Ga0207682_10003542
634 Ga0207692_10001838
635 Ga0207688_10098081
636 Ga0207680_10176267
637 Ga0207699_10005803
638 Ga0207699_10013937
639 Ga0207699_10044961
640 Ga0207699_10545955
641 Ga0207645_10014012
642 Ga0207643_10028025
643 Ga0207654_10387045
644 Ga0207707_10000642
645 Ga0207707_10013022
646 Ga0207707_10075094
647 Ga0207695_10053857
648 Ga0207695_10151368
649 Ga0207695_10176814
650 Ga0207695_10219740
651 Ga0207671_10544110
652 Ga0207693_10000581
653 Ga0207693_10133453
654 Ga0207693_10778721
655 Ga0207663_10000084
656 Ga0207663_10037195
657 Ga0207660_10355950
658 Ga0207662_10232840
659 Ga0207657_10237777
660 Ga0207649_10088518
661 Ga0207649_10354518
662 Ga0207652_10140320
663 Ga0207694_10407951
664 Ga0207694_10552537
665 Ga0207659_10280378
666 Ga0207687_10490986
667 Ga0207664_10010621
668 Ga0207664_10103704
669 Ga0207664_10375812
670 Ga0207644_10346143
671 Ga0207706_10059760
672 Ga0207706_10641187
673 Ga0207670_10249644
674 Ga0207669_10014985
675 Ga0207665_10001451
676 Ga0207665_10150292
677 Ga0207691_10003165
678 Ga0207711_10029672
679 Ga0207689_10011420
680 Ga0207661_10006741
681 Ga0207661_10034996
682 Ga0207661_10044242
683 Ga0207661_10377616
684 Ga0207679_10132723
685 Ga0207679_10500123
686 Ga0207667_10035113
687 Ga0207651_10311404
688 Ga0207640_10049257
689 Ga0207640_10081610
690 Ga0207640_10661366
691 Ga0207658_10091586
692 Ga0207677_10102313
693 Ga0207703_10209854
694 Ga0207639_10090539
695 Ga0207678_10093141
696 Ga0207678_10219160
697 Ga0207678_10859231
698 Ga0207708_10296779
699 Ga0207708_10825054
700 Ga0207702_10305479
701 Ga0207702_10697890
702 Ga0207641_10297350
703 Ga0207648_10014698
704 Ga0207648_10045528
705 Ga0207676_10119530
706 Ga0207674_10081044
707 Ga0207674_10102352
708 Ga0207674_10441292
709 Ga0207675_100766287
710 Ga0207683_10006991
711 Ga0207683_10030616
712 Ga0207683_10100665
713 Ga0207698_10016337
714 Ga0207698_10346905
715 Ga0207428_10002176
716 Ga0268266_10110119
717 Ga0268265_10252127
718 Ga0265318_10031037
719 Ga0265338_10197520
720 Ga0265320_10008692
721 Ga0265325_10002671
722 Ga0265325_10170202
723 Ga0265339_10003924
724 Ga0265327_10127298
725 Ga0307513_10491631
726 Ga0265313_10012286
727 Ga0307508_10034118
728 Ga0265314_10007016
729 Ga0307413_10250408
730 Ga0307406_10037728
731 Ga0307416_100060998
732 Ga0373930_0022009
733 Ga0373938_0053104
734 Ga0373928_0045334
735 Ga0373940_0022137
736 Ga0373944_0093791
737 Ga0373949_0002057
738 Ga0373951_0009202
739 Ga0373923_0002745
740 Ga0373932_0006206
741 Ga0373939_0005876
742 Ga0373941_0051122
743 Ga0373941_0116757
744 Ga0373953_0134526
745 Ga0373954_0137858
746 Ga0373960_0028335
747 Ga0373946_0003973
748 Ga0373955_0008088
749 Ga0373942_0011294
750 Ga0373961_0062197
751 Ga0373924_0004585
752 Ga0373931_0001654
753 Ga0373931_0186127
754 Ga0373927_0232411
755 Ga0373933_0217026
756 Ga0373947_0005034
757 Ga0373937_0070933
758 Ga0373925_0003867
759 Ga0373925_0096855
760 Ga0395899_0002058
761 Ga0395899_0034475
762 Ga0395899_0041076
763 Ga0395899_0072912
764 Ga0395899_0296237
765 Ga0395899_0415447
766 Ga0395900_0010224
767 Ga0395900_0012284
768 Ga0395900_0016562
769 Ga0395900_0032920
770 Ga0395900_0091984
771 Ga0395900_0182970
772 Ga0395900_0277511
773 Ga0395900_0409636
774 Ga0395898_0010168
775 Ga0395898_0044597
776 Ga0395898_0045833
777 Ga0395898_0092839
778 Ga0395898_0134593
779 Ga0395905_0000237
780 Ga0395905_0001574
781 Ga0395905_0131854
782 Ga0395905_0469144
783 Ga0395905_0635693
784 Ga0436364_1206713
785 Ga0436364_1278600
786 Ga0395901_0001024
787 Ga0395901_0017632
788 Ga0395901_0026167
789 Ga0395901_0070639
790 Ga0395901_0122873
791 Ga0395901_0234904
792 Ga0436365_0556883
793 Ga0436365_0929489
794 Ga0436365_1214917
795 Ga0436365_1817318
796 Ga0436365_1873205
797 Ga0436360_1310202
798 Ga0436360_1340332
799 Ga0436363_1060313
800 Ga0439460_0085220
801 Ga0466966_0172521
802 Ga0466963_0001613
803 Ga0466963_0017314
804 Ga0466963_0082991
805 Ga0466964_0101517
806 Ga0466971_0034621
807 Ga0466957_0062499
808 Ga0466957_0131425
809 Ga0466959_0300826
810 Ga0451576_0039398
811 Ga0451576_0137059
812 Ga0466958_0004816
813 Ga0466958_0065336
814 Ga0466958_0175415
815 Ga0466958_0226454
816 Ga0466967_0016793
817 Ga0466967_0038432
818 Ga0466967_0183259
819 Ga0466967_0238061
820 Ga0466967_0292519
821 Ga0466967_0369866
822 Ga0495629_0009218
823 Ga0495639_0007077
824 Ga0495664_0041120
825 Ga0495664_0085160
826 Ga0495664_0142612
827 Ga0495594_0032641
828 Ga0495608_0295606
829 Ga0495618_0039684
830 Ga0495628_0053337
831 Ga0495644_0081055
832 Ga0495652_0088149
833 Ga0495665_0018945
834 Ga0495640_0054160
835 Ga0495640_0224417
836 Ga0495598_0030044
837 Ga0495645_0003348
838 Ga0495645_0192598
839 Ga0495667_0171508
840 Ga0495656_0033186
841 Ga0495668_0304747
842 Ga0495634_0040085
843 Ga0495611_0085593
844 Ga0495635_0037966
845 Ga0495658_0029013
846 Ga0495604_0036388
847 Ga0495674_0076598
848 Ga0495674_0162646
849 Ga0495677_0052258
850 Ga0495684_0002766
851 Ga0495593_0009234
852 Ga0496100_0099093
853 Ga0496101_0101871
854 Ga0496102_0018908
855 Ga0496102_0217282
856 Ga0496104_0304101
857 Ga0496105_0154908
858 Ga0496106_0002440
859 Ga0496106_0018102
860 Ga0496106_0176412
861 Ga0496107_0004195
862 Ga0496107_0376809
863 Ga0496108_0006903
864 Ga0496108_0075249
865 Ga0496108_0178920
866 Ga0496109_0000201
867 Ga0496109_0183021
868 Ga0496109_0507674
869 Ga0496110_0005518
870 Ga0496110_0047387
871 Ga0496110_0284706
872 Ga0496111_0132300
873 Ga0496112_0000004
874 Ga0496112_0010646
875 Ga0496112_0025368
876 Ga0496113_0145286
877 Ga0496113_0197472
878 Ga0496114_0099862
879 Ga0501031_0000268
880 Ga0501032_0000765
881 Ga0501033_0000108
882 Ga0501034_0000100
883 Ga0501034_0004441
884 Ga0501034_0011260
885 Ga0501034_0013268
886 Ga0501036_0000228
887 Ga0501036_0087447
888 Ga0501036_0148929
889 Ga0501037_0002072
890 Ga0501038_0000350
891 Ga0501038_0098098
892 Ga0501038_0284424
893 Ga0501039_0001602
894 Ga0501039_0204905
895 Ga0501040_0075378
896 Ga0501040_0109610
897 Ga0501041_0067103
898 Ga0501041_0105757
899 Ga0501042_0032769
900 Ga0501042_0091268
901 Ga0501043_0000085
902 Ga0501043_0232769
903 Ga0501043_0261521
904 Ga0501046_0000426
905 Ga0501046_0042221
906 Ga0501046_0061025
907 Ga0501047_0000221
908 Ga0501047_0365003
909 Ga0501047_0499406
910 Ga0501048_0000621
911 Ga0501048_0097109
912 Ga0501048_0186936
913 Ga0501067_0000384
914 Ga0501067_0123440
915 Ga0501068_0002221
916 Ga0501068_0085310
917 Ga0501068_0315908
918 Ga0501068_0489098
919 Ga0501069_0004243
920 Ga0501070_0001287
921 Ga0501070_0002523
922 Ga0501070_0030958
923 Ga0501070_0581356
924 Ga0501071_0095202
925 Ga0501071_0120780
926 Ga0501071_0128511
927 Ga0501071_0140750
928 Ga0501072_0001233
929 Ga0501072_0088926
930 Ga0501072_0682694
931 Ga0501073_0001343
932 Ga0501073_0103677
933 Ga0501074_0000094
934 Ga0501074_0049863
935 Ga0501074_0267554
936 Ga0501075_0014291
937 Ga0501075_0070506
938 Ga0501076_0073731
939 Ga0501076_0136344
940 Ga0501076_0503321
941 Ga0501077_0030235
942 Ga0501079_0002821
943 Ga0501079_0024551
944 Ga0501079_0223437
945 Ga0501080_0007102
946 Ga0501080_0060563
947 Ga0501080_0869035
948 Ga0501081_0032616
949 Ga0501083_0002500
950 Ga0501083_0003299
951 Ga0501083_0079410
952 Ga0501083_0253525
953 Ga0501083_0257604
954 Ga0501044_0000970
955 Ga0501044_0094061
956 Ga0501045_0016665
957 Ga0501045_0018056
958 nmdc:mga05p37_1565_c1
959 nmdc:mga09592_112_c1
960 nmdc:mga08y16_21313_c1
961 nmdc:mga08y16_291537_c1
962 nmdc:mga0rr50_109022_c1
963 nmdc:mga08x19_368558_c1
964 nmdc:mga0a205_551308_c1
965 Ga0495601_0073642
966 Ga0495601_0125824
967 Ga0495612_0037637
968 Ga0501084_0002518
969 Ga0501084_0108441
970 Ga0501084_0138811
971 Ga0501082_0000452
972 Ga0501082_0443540
973 Ga0466962_0019078
974 Ga0530510_0148964
975 Ga0530510_0298500
976 2643754463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

32

178

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9691 1 234
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9651 1 234
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9571 2 221
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9281 2 221
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9262 2 231
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9774 2 234 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.965 2 234 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9551 2 216 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9545 1 234 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9457 1 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538Q6K0-F1-model_v4 ABC transporter ATP-binding protein 0.9954 1 209 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A411YF14-F1-model_v4 ATP-binding cassette domain-containing protein 0.9935 2 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A2V6PR21-F1-model_v4 ABC transporter ATP-binding protein 0.9933 1 214 GO:0003908
GO:0005524
GO:0006281
GO:0015658
GO:0015807
GO:0016887
AF-A0A4Q7GCT7-F1-model_v4 Branched-chain amino acid ABC transporter ATP-binding protein 0.9932 2 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A538QNG9-F1-model_v4 ABC transporter ATP-binding protein 0.9924 2 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map