F453639

General Info

Members Datasets Scaffolds Average Seq Length
488 257 976 314

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0231126|Ga0436360_0231126_5371_6402
Length 343
Sequence VLVVARAKLGFHVTKSIAQGLDQTAMRVLITGVAGFLGSHLADFLLAEGNAVIGVDNLSTGSLENLKHLKGEPRFEFREHDICRAFDVGGVDYVFNFASPASPIDYARLGVETLEVGSVGTTNALDIAKRYNAKFLHASTSECYGDPDVHPQTEDYWGHVNPIGPRSVYDEAKRFSEALTMAYHRYYGVDTRLVRIFNTYGPRLQKNDGRVISNFMVQALKGEDLTVYGEGNQTRSFCYVSDEIEGIVGLSKVDEHLPVNVGNPHEWTILDCAKTVLKVTNSPSRIVYRPLPQDDPTQRQPDISKAKRLFGWEPKIDLETGLRLSLDYFRSLVEMEKQLADGD

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
173 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
225 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
242 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.25
Rhizosphere 96.93
Stem 0
Stem Tuber 0
Unclassified 7.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0231126 3300039438 Bacteria 16861
2 JGI25406J46586_10041958 3300003203 Bacteria 1606
3 Ga0065714_10096453 3300005288 Bacteria 1760
4 Ga0065712_10004279 3300005290 Bacteria 9998
5 Ga0065715_10001790 3300005293 Bacteria 7219
6 Ga0070658_10157239 3300005327 Bacteria 1906
7 Ga0070676_10006510 3300005328 Bacteria 6240
8 Ga0070683_100001978 3300005329 Bacteria 16048
9 Ga0070683_100153883 3300005329 Bacteria 2180
10 Ga0070683_100356352 3300005329 Unclassified 1393
11 Ga0070683_100450354 3300005329 Bacteria 1228
12 Ga0070670_100001613 3300005331 Bacteria 18235
13 Ga0070670_100013040 3300005331 Bacteria 7119
14 Ga0070670_100331858 3300005331 Bacteria 1334
15 Ga0070677_10017551 3300005333 Bacteria 2564
16 Ga0068869_100004293 3300005334 Bacteria 8848
17 Ga0068869_100120342 3300005334 Unclassified 2007
18 Ga0070666_10030190 3300005335 Bacteria 3569
19 Ga0070666_10032102 3300005335 Bacteria 3468
20 Ga0070680_100038753 3300005336 Bacteria 3855
21 Ga0068868_100000274 3300005338 Bacteria 34709
22 Ga0068868_100075822 3300005338 Bacteria 2688
23 Ga0070660_100018704 3300005339 Bacteria 5067
24 Ga0070660_100159631 3300005339 Bacteria 1816
25 Ga0070689_100000020 3300005340 Bacteria 138642
26 Ga0070661_100016917 3300005344 Bacteria 5163
27 Ga0070661_100018003 3300005344 Bacteria 5018
28 Ga0070661_100069369 3300005344 Bacteria 2592
29 Ga0070668_100044519 3300005347 Bacteria 3405
30 Ga0070675_100028718 3300005354 Bacteria 4478
31 Ga0070675_100229616 3300005354 Bacteria 1619
32 Ga0070671_100001209 3300005355 Bacteria 19343
33 Ga0070671_100066787 3300005355 Bacteria 2997
34 Ga0070674_100003364 3300005356 Bacteria 8960
35 Ga0070673_100009466 3300005364 Bacteria 6539
36 Ga0070659_100017675 3300005366 Bacteria 5371
37 Ga0070667_100008428 3300005367 Bacteria 8550
38 Ga0070667_100113732 3300005367 Bacteria 2349
39 Ga0070709_10094888 3300005434 Bacteria 1975
40 Ga0070714_100010861 3300005435 Bacteria 7213
41 Ga0070714_100105612 3300005435 Unclassified 2487
42 Ga0070713_100004295 3300005436 Bacteria 9547
43 Ga0070713_100012975 3300005436 Bacteria 6136
44 Ga0070713_100330902 3300005436 Bacteria 1409
45 Ga0070710_10021234 3300005437 Bacteria 3380
46 Ga0070711_100004977 3300005439 Bacteria 7893
47 Ga0070711_100011134 3300005439 Bacteria 5580
48 Ga0070705_100122687 3300005440 Bacteria 1680
49 Ga0070694_100014800 3300005444 Bacteria 4887
50 Ga0070708_100442040 3300005445 Bacteria 1227
51 Ga0070663_100007198 3300005455 Bacteria 6760
52 Ga0070678_100007168 3300005456 Bacteria 6595
53 Ga0070678_100044516 3300005456 Bacteria 3170
54 Ga0070662_100014241 3300005457 Bacteria 5308
55 Ga0070662_100072123 3300005457 Bacteria 2549
56 Ga0070681_10039187 3300005458 Bacteria 4750
57 Ga0070681_10047214 3300005458 Bacteria 4304
58 Ga0070681_10103060 3300005458 Unclassified 2798
59 Ga0070706_100416709 3300005467 Bacteria 1250
60 Ga0070679_100017904 3300005530 Bacteria 6862
61 Ga0070679_100100965 3300005530 Bacteria 2871
62 Ga0070684_100004516 3300005535 Bacteria 10596
63 Ga0070684_100038511 3300005535 Bacteria 4107
64 Ga0070684_100060018 3300005535 Bacteria 3325
65 Ga0070684_100131695 3300005535 Bacteria 2256
66 Ga0070697_100414032 3300005536 Bacteria 1171
67 Ga0068853_100012590 3300005539 Bacteria 6883
68 Ga0068853_100192348 3300005539 Bacteria 1854
69 Ga0068853_100222278 3300005539 Bacteria 1725
70 Ga0070672_100024822 3300005543 Bacteria 4436
71 Ga0070672_100136864 3300005543 Bacteria 2018
72 Ga0070695_100007718 3300005545 Bacteria 6370
73 Ga0070696_100008359 3300005546 Bacteria 6925
74 Ga0070693_100003510 3300005547 Bacteria 7312
75 Ga0070665_100020247 3300005548 Bacteria 6680
76 Ga0068855_100003330 3300005563 Bacteria 19652
77 Ga0068855_100004904 3300005563 Bacteria 16328
78 Ga0068855_100005333 3300005563 Bacteria 15696
79 Ga0068855_100203469 3300005563 Bacteria 2228
80 Ga0068855_100237297 3300005563 Unclassified 2039
81 Ga0070664_100001158 3300005564 Bacteria 20913
82 Ga0070664_100034466 3300005564 Bacteria 4247
83 Ga0068857_100001191 3300005577 Bacteria 20322
84 Ga0068857_100008616 3300005577 Bacteria 8827
85 Ga0068857_100024053 3300005577 Bacteria 5363
86 Ga0068857_100108778 3300005577 Bacteria 2491
87 Ga0068857_100400160 3300005577 Bacteria 1278
88 Ga0068854_100001734 3300005578 Bacteria 13303
89 Ga0068854_100178560 3300005578 Bacteria 1657
90 Ga0068854_100269999 3300005578 Unclassified 1365
91 Ga0068856_100000684 3300005614 Bacteria 36817
92 Ga0068856_100007587 3300005614 Bacteria 10586
93 Ga0068856_100022379 3300005614 Bacteria 6144
94 Ga0068856_100036715 3300005614 Bacteria 4805
95 Ga0068856_100056929 3300005614 Bacteria 3859
96 Ga0068852_100000026 3300005616 Bacteria 114548
97 Ga0068852_100000162 3300005616 Bacteria 44844
98 Ga0068852_100076890 3300005616 Bacteria 2948
99 Ga0068852_100206981 3300005616 Unclassified 1859
100 Ga0068852_100270035 3300005616 Bacteria 1636
101 Ga0068859_100004532 3300005617 Bacteria 14168
102 Ga0068859_100561844 3300005617 Bacteria 1235
103 Ga0068864_100000489 3300005618 Bacteria 34241
104 Ga0068851_10000898 3300005834 Bacteria 12816
105 Ga0068851_10009769 3300005834 Bacteria 4468
106 Ga0068863_100003404 3300005841 Bacteria 15685
107 Ga0068863_100416306 3300005841 Bacteria 1316
108 Ga0068858_100000718 3300005842 Bacteria 34499
109 Ga0068858_100038597 3300005842 Bacteria 4430
110 Ga0068858_100283447 3300005842 Bacteria 1578
111 Ga0068860_100004073 3300005843 Bacteria 14999
112 Ga0068862_100061070 3300005844 Bacteria 3239
113 Ga0081455_10000554 3300005937 Bacteria 48600
114 Ga0081538_10004527 3300005981 Bacteria 12800
115 Ga0081539_10002700 3300005985 Bacteria 24080
116 Ga0070717_10010717 3300006028 Bacteria 6936
117 Ga0070717_10013225 3300006028 Bacteria 6315
118 Ga0070716_100256653 3300006173 Bacteria 1194
119 Ga0070712_100254412 3300006175 Bacteria 1405
120 Ga0097621_100000090 3300006237 Bacteria 49478
121 Ga0068871_100013809 3300006358 Bacteria 6004
122 Ga0068871_100065039 3300006358 Bacteria 2986
123 Ga0075428_100032305 3300006844 Bacteria 5780
124 Ga0075428_100037760 3300006844 Bacteria 5315
125 Ga0075430_100047517 3300006846 Bacteria 3625
126 Ga0075430_100076530 3300006846 Bacteria 2805
127 Ga0075431_100054267 3300006847 Bacteria 4132
128 Ga0075431_100178138 3300006847 Bacteria 2182
129 Ga0075433_10207597 3300006852 Bacteria 1741
130 Ga0075434_100017705 3300006871 Bacteria 6869
131 Ga0075434_100186194 3300006871 Bacteria 2096
132 Ga0075429_100043058 3300006880 Bacteria 3928
133 Ga0075429_100073195 3300006880 Bacteria 2984
134 Ga0075429_100074788 3300006880 Bacteria 2951
135 Ga0075429_100507525 3300006880 Bacteria 1057
136 Ga0068865_100013180 3300006881 Bacteria 5218
137 Ga0075436_100010953 3300006914 Bacteria 6225
138 Ga0097620_100004532 3300006931 Bacteria 14168
139 Ga0097620_100561823 3300006931 Bacteria 1235
140 Ga0075435_100015431 3300007076 Bacteria 5742
141 Ga0075435_100020525 3300007076 Bacteria 5064
142 Ga0099794_10038736 3300007265 Bacteria 2259
143 Ga0105240_10000038 3300009093 Bacteria 270341
144 Ga0105240_10000267 3300009093 Bacteria 103103
145 Ga0105240_10000274 3300009093 Bacteria 102157
146 Ga0105240_10015772 3300009093 Bacteria 10253
147 Ga0105240_10015983 3300009093 Bacteria 10174
148 Ga0105240_10019622 3300009093 Bacteria 9030
149 Ga0105240_10023154 3300009093 Bacteria 8223
150 Ga0105240_10048485 3300009093 Bacteria 5368
151 Ga0105240_10112205 3300009093 Bacteria 3296
152 Ga0105240_10390178 3300009093 Bacteria 1570
153 Ga0111539_10451227 3300009094 Bacteria 1497
154 Ga0105245_10000750 3300009098 Bacteria 29290
155 Ga0105245_10053139 3300009098 Bacteria 3635
156 Ga0105245_10159391 3300009098 Bacteria 2140
157 Ga0105245_10196874 3300009098 Bacteria 1933
158 Ga0105247_10003425 3300009101 Bacteria 10354
159 Ga0105247_10015809 3300009101 Bacteria 4517
160 Ga0105247_10080090 3300009101 Bacteria 2056
161 Ga0114129_10000989 3300009147 Bacteria 37153
162 Ga0114129_10198185 3300009147 Bacteria 2722
163 Ga0114129_10236312 3300009147 Bacteria 2458
164 Ga0114129_10431681 3300009147 Bacteria 1731
165 Ga0114129_10631922 3300009147 Bacteria 1384
166 Ga0105243_10034259 3300009148 Bacteria 3929
167 Ga0105243_10048765 3300009148 Bacteria 3340
168 Ga0105241_10000059 3300009174 Bacteria 83637
169 Ga0105241_10002855 3300009174 Bacteria 12900
170 Ga0105241_10004202 3300009174 Bacteria 10639
171 Ga0105241_10071796 3300009174 Bacteria 2688
172 Ga0105241_10074402 3300009174 Bacteria 2645
173 Ga0105241_10173364 3300009174 Bacteria 1783
174 Ga0105242_10115629 3300009176 Bacteria 2293
175 Ga0105242_10119445 3300009176 Bacteria 2259
176 Ga0105242_10511100 3300009176 Bacteria 1144
177 Ga0105248_10000467 3300009177 Bacteria 46062
178 Ga0105248_10005092 3300009177 Bacteria 14501
179 Ga0105237_10014213 3300009545 Bacteria 8334
180 Ga0105237_10023623 3300009545 Bacteria 6296
181 Ga0105237_10039455 3300009545 Bacteria 4767
182 Ga0105237_10215489 3300009545 Bacteria 1920
183 Ga0105237_10278385 3300009545 Bacteria 1675
184 Ga0105237_10460239 3300009545 Bacteria 1278
185 Ga0105238_10000466 3300009551 Bacteria 42492
186 Ga0105238_10006878 3300009551 Bacteria 11358
187 Ga0105238_10031588 3300009551 Bacteria 5391
188 Ga0105238_10083810 3300009551 Bacteria 3177
189 Ga0105238_10087639 3300009551 Bacteria 3099
190 Ga0105238_10264542 3300009551 Bacteria 1700
191 Ga0105249_10126979 3300009553 Bacteria 2430
192 Ga0105249_10157146 3300009553 Unclassified 2194
193 Ga0105249_10562335 3300009553 Bacteria 1192
194 Ga0105239_10004984 3300010375 Bacteria 15679
195 Ga0105239_10006259 3300010375 Bacteria 13840
196 Ga0105239_10029394 3300010375 Bacteria 6042
197 Ga0105239_10034986 3300010375 Bacteria 5517
198 Ga0105239_10211990 3300010375 Bacteria 2171
199 Ga0105239_10425048 3300010375 Bacteria 1505
200 Ga0105246_10002003 3300011119 Bacteria 12298
201 Ga0105246_10004354 3300011119 Bacteria 8614
202 Ga0105246_10241789 3300011119 Unclassified 1427
203 Ga0157373_10041406 3300013100 Bacteria 3295
204 Ga0157373_10062155 3300013100 Bacteria 2645
205 Ga0157370_10000011 3300013104 Bacteria 212362
206 Ga0157370_10314131 3300013104 Bacteria 1446
207 Ga0157369_10000060 3300013105 Bacteria 152332
208 Ga0157369_10000488 3300013105 Bacteria 52650
209 Ga0157369_10001987 3300013105 Bacteria 24613
210 Ga0157369_10016155 3300013105 Bacteria 8403
211 Ga0157369_10039960 3300013105 Bacteria 5124
212 Ga0157369_10041763 3300013105 Bacteria 5005
213 Ga0157369_10074867 3300013105 Bacteria 3631
214 Ga0157369_10080887 3300013105 Bacteria 3478
215 Ga0157369_10094033 3300013105 Bacteria 3200
216 Ga0157369_10137240 3300013105 Unclassified 2589
217 Ga0157369_10161622 3300013105 Bacteria 2364
218 Ga0157374_10002962 3300013296 Bacteria 14218
219 Ga0157374_10029541 3300013296 Bacteria 4966
220 Ga0157374_10117885 3300013296 Unclassified 2559
221 Ga0157374_10119695 3300013296 Bacteria 2540
222 Ga0157374_10223698 3300013296 Bacteria 1847
223 Ga0157378_10007414 3300013297 Bacteria 9584
224 Ga0157378_10029965 3300013297 Bacteria 4805
225 Ga0157378_10133201 3300013297 Bacteria 2302
226 Ga0157378_10374606 3300013297 Unclassified 1396
227 Ga0163162_10031901 3300013306 Bacteria 5228
228 Ga0163162_10055709 3300013306 Bacteria 3982
229 Ga0163162_10221175 3300013306 Bacteria 2023
230 Ga0157372_10000240 3300013307 Bacteria 60611
231 Ga0157372_10002911 3300013307 Bacteria 18522
232 Ga0157372_10006449 3300013307 Bacteria 12494
233 Ga0157372_10015718 3300013307 Bacteria 8116
234 Ga0157372_10025715 3300013307 Bacteria 6404
235 Ga0157372_10037588 3300013307 Bacteria 5342
236 Ga0157372_10223610 3300013307 Unclassified 2182
237 Ga0157375_10004564 3300013308 Bacteria 12031
238 Ga0157375_10178111 3300013308 Bacteria 2277
239 Ga0157375_10556721 3300013308 Bacteria 1308
240 Ga0163163_10001965 3300014325 Bacteria 17374
241 Ga0157379_10001276 3300014968 Bacteria 20470
242 Ga0157379_10048155 3300014968 Bacteria 3805
243 Ga0157376_10015146 3300014969 Bacteria 5814
244 Ga0157376_10231854 3300014969 Unclassified 1715
245 Ga0163161_10038308 3300017792 Bacteria 3439
246 Ga0206352_10983614 3300020078 Unclassified 1794
247 Ga0213872_10008519 3300021361 Bacteria 4959
248 Ga0213872_10021042 3300021361 Bacteria 3003
249 Ga0213872_10021458 3300021361 Bacteria 2974
250 Ga0213875_10025007 3300021388 Unclassified 2846
251 Ga0213871_10026543 3300021441 Bacteria 1482
252 Ga0207656_10019529 3300025321 Bacteria 2682
253 Ga0207682_10021369 3300025893 Bacteria 2546
254 Ga0207710_10000944 3300025900 Bacteria 15386
255 Ga0207688_10063584 3300025901 Bacteria 2082
256 Ga0207680_10036283 3300025903 Bacteria 2838
257 Ga0207680_10215814 3300025903 Bacteria 1313
258 Ga0207680_10268801 3300025903 Unclassified 1182
259 Ga0207647_10052666 3300025904 Bacteria 2511
260 Ga0207647_10111314 3300025904 Unclassified 1619
261 Ga0207699_10135742 3300025906 Bacteria 1611
262 Ga0207645_10000665 3300025907 Bacteria 28520
263 Ga0207645_10007109 3300025907 Bacteria 7947
264 Ga0207705_10362326 3300025909 Bacteria 1118
265 Ga0207684_10443045 3300025910 Bacteria 1115
266 Ga0207654_10000017 3300025911 Bacteria 201589
267 Ga0207654_10000728 3300025911 Bacteria 18352
268 Ga0207654_10002174 3300025911 Bacteria 10042
269 Ga0207707_10010455 3300025912 Bacteria 8052
270 Ga0207707_10030371 3300025912 Bacteria 4728
271 Ga0207695_10000030 3300025913 Bacteria 533735
272 Ga0207695_10000070 3300025913 Bacteria 318111
273 Ga0207695_10000669 3300025913 Bacteria 67530
274 Ga0207695_10002576 3300025913 Bacteria 26614
275 Ga0207695_10004905 3300025913 Bacteria 18026
276 Ga0207695_10005273 3300025913 Bacteria 17229
277 Ga0207695_10005370 3300025913 Bacteria 17036
278 Ga0207695_10013946 3300025913 Bacteria 9553
279 Ga0207695_10016184 3300025913 Bacteria 8743
280 Ga0207695_10054555 3300025913 Bacteria 4172
281 Ga0207695_10385087 3300025913 Unclassified 1288
282 Ga0207671_10000071 3300025914 Bacteria 159699
283 Ga0207671_10003485 3300025914 Bacteria 15653
284 Ga0207671_10038849 3300025914 Bacteria 3527
285 Ga0207671_10183498 3300025914 Bacteria 1629
286 Ga0207671_10381338 3300025914 Bacteria 1120
287 Ga0207693_10326115 3300025915 Bacteria 1202
288 Ga0207663_10144325 3300025916 Bacteria 1662
289 Ga0207660_10199912 3300025917 Bacteria 1560
290 Ga0207657_10215707 3300025919 Unclassified 1539
291 Ga0207649_10026571 3300025920 Unclassified 3388
292 Ga0207649_10055857 3300025920 Bacteria 2463
293 Ga0207652_10076029 3300025921 Bacteria 2927
294 Ga0207646_10073652 3300025922 Bacteria 3051
295 Ga0207694_10000192 3300025924 Bacteria 61988
296 Ga0207694_10000859 3300025924 Bacteria 27018
297 Ga0207694_10002709 3300025924 Bacteria 14345
298 Ga0207694_10202068 3300025924 Bacteria 1617
299 Ga0207650_10000465 3300025925 Bacteria 34125
300 Ga0207650_10059713 3300025925 Unclassified 2843
301 Ga0207659_10090785 3300025926 Bacteria 2281
302 Ga0207687_10003472 3300025927 Bacteria 10613
303 Ga0207700_10049337 3300025928 Unclassified 3131
304 Ga0207700_10181435 3300025928 Bacteria 1763
305 Ga0207644_10030852 3300025931 Bacteria 3731
306 Ga0207690_10009019 3300025932 Bacteria 5919
307 Ga0207706_10005068 3300025933 Bacteria 12302
308 Ga0207706_10020647 3300025933 Bacteria 5919
309 Ga0207686_10230679 3300025934 Bacteria 1342
310 Ga0207670_10000126 3300025936 Bacteria 50717
311 Ga0207669_10160786 3300025937 Bacteria 1586
312 Ga0207704_10241423 3300025938 Unclassified 1350
313 Ga0207665_10159631 3300025939 Bacteria 1621
314 Ga0207691_10002614 3300025940 Bacteria 17587
315 Ga0207691_10013303 3300025940 Bacteria 7884
316 Ga0207711_10006019 3300025941 Bacteria 10250
317 Ga0207689_10004353 3300025942 Bacteria 12896
318 Ga0207689_10025824 3300025942 Bacteria 4921
319 Ga0207661_10048749 3300025944 Bacteria 3368
320 Ga0207661_10179524 3300025944 Unclassified 1848
321 Ga0207661_10467540 3300025944 Bacteria 1150
322 Ga0207679_10001654 3300025945 Bacteria 13906
323 Ga0207679_10100653 3300025945 Bacteria 2259
324 Ga0207667_10000815 3300025949 Bacteria 40351
325 Ga0207667_10004349 3300025949 Bacteria 17348
326 Ga0207667_10012737 3300025949 Bacteria 9660
327 Ga0207667_10142245 3300025949 Bacteria 2470
328 Ga0207651_10064971 3300025960 Bacteria 2556
329 Ga0207651_10187175 3300025960 Bacteria 1648
330 Ga0207712_10040775 3300025961 Bacteria 3189
331 Ga0207668_10005350 3300025972 Bacteria 7551
332 Ga0207640_10263479 3300025981 Unclassified 1344
333 Ga0207658_10001530 3300025986 Bacteria 17971
334 Ga0207677_10000986 3300026023 Bacteria 15683
335 Ga0207703_10002777 3300026035 Bacteria 14984
336 Ga0207703_10251460 3300026035 Bacteria 1593
337 Ga0207639_10118895 3300026041 Bacteria 2168
338 Ga0207678_10144287 3300026067 Bacteria 2032
339 Ga0207702_10005318 3300026078 Bacteria 11293
340 Ga0207702_10005718 3300026078 Bacteria 10840
341 Ga0207702_10009127 3300026078 Bacteria 8348
342 Ga0207702_10026381 3300026078 Bacteria 4823
343 Ga0207702_10063137 3300026078 Bacteria 3167
344 Ga0207702_10305779 3300026078 Bacteria 1510
345 Ga0207641_10001559 3300026088 Bacteria 22459
346 Ga0207676_10004204 3300026095 Bacteria 10170
347 Ga0207674_10000764 3300026116 Bacteria 42010
348 Ga0207674_10003289 3300026116 Bacteria 19873
349 Ga0207674_10101565 3300026116 Bacteria 2856
350 Ga0207674_10245042 3300026116 Bacteria 1739
351 Ga0207683_10000952 3300026121 Bacteria 26522
352 Ga0207683_10005047 3300026121 Bacteria 11332
353 Ga0207698_10000010 3300026142 Bacteria 270583
354 Ga0207698_10000273 3300026142 Bacteria 31333
355 Ga0207698_10088764 3300026142 Unclassified 2522
356 Ga0207698_10310099 3300026142 Bacteria 1473
357 Ga0209999_1013535 3300027543 Bacteria 1480
358 Ga0209983_1013336 3300027665 Bacteria 1689
359 Ga0209588_1000647 3300027671 Bacteria 8771
360 Ga0209971_1022573 3300027682 Bacteria 1499
361 Ga0207428_10156213 3300027907 Bacteria 1735
362 Ga0268266_10012095 3300028379 Bacteria 7469
363 Ga0268265_10150303 3300028380 Unclassified 1963
364 Ga0268264_10000331 3300028381 Bacteria 73935
365 Ga0265319_1010796 3300028563 Bacteria 3787
366 Ga0265318_10020967 3300028577 Bacteria 2629
367 Ga0265338_10329322 3300028800 Bacteria 1103
368 Ga0265320_10037318 3300031240 Bacteria 2448
369 Ga0265331_10025903 3300031250 Bacteria 2956
370 Ga0265316_10079884 3300031344 Bacteria 2509
371 Ga0265316_10216712 3300031344 Bacteria 1414
372 Ga0265313_10041717 3300031595 Bacteria 2258
373 Ga0265314_10012854 3300031711 Bacteria 6802
374 Ga0307405_10072817 3300031731 Bacteria 2216
375 Ga0307413_10007667 3300031824 Bacteria 5035
376 Ga0307410_10010417 3300031852 Bacteria 5263
377 Ga0307410_10113509 3300031852 Bacteria 1964
378 Ga0307410_10123973 3300031852 Bacteria 1888
379 Ga0307406_10124253 3300031901 Bacteria 1800
380 Ga0307407_10013394 3300031903 Bacteria 3980
381 Ga0307412_10129320 3300031911 Unclassified 1832
382 Ga0307412_10199954 3300031911 Bacteria 1517
383 Ga0307409_100006354 3300031995 Bacteria 6934
384 Ga0307409_100010694 3300031995 Bacteria 5728
385 Ga0307409_100293743 3300031995 Bacteria 1508
386 Ga0307416_100009543 3300032002 Bacteria 6359
387 Ga0307416_100272215 3300032002 Bacteria 1663
388 Ga0307414_10006151 3300032004 Bacteria 6670
389 Ga0307411_10002963 3300032005 Bacteria 7710
390 Ga0307411_10215042 3300032005 Bacteria 1487
391 Ga0307415_100005602 3300032126 Bacteria 6684
392 Ga0373939_0010084 3300035114 Bacteria 2354
393 Ga0373945_0030669 3300035116 Bacteria 1896
394 Ga0373956_0026303 3300035119 Bacteria 2520
395 Ga0373943_0018610 3300035170 Bacteria 3193
396 Ga0373935_0018382 3300035692 Bacteria 4251
397 Ga0373935_0033889 3300035692 Unclassified 3181
398 Ga0373937_0149160 3300036401 Unclassified 2190
399 Ga0395900_0022502 3300037418 Bacteria 6447
400 Ga0395898_0029262 3300037466 Bacteria 5518
401 Ga0436364_0312326 3300037853 Bacteria 2255
402 Ga0395901_0042194 3300038443 Bacteria 4729
403 Ga0436365_1159537 3300039437 Unclassified 1566
404 Ga0436360_0513085 3300039438 Bacteria 1332
405 Ga0436360_1306349 3300039438 Bacteria 10899
406 Ga0436361_0223220 3300039447 Bacteria 3170
407 Ga0436361_0587474 3300039447 Bacteria 14552
408 Ga0436361_0626744 3300039447 Bacteria 6699
409 Ga0436361_0763547 3300039447 Bacteria 4288
410 Ga0466966_0020698 3300044684 Bacteria 4323
411 Ga0466966_0027296 3300044684 Bacteria 3724
412 Ga0466963_0209498 3300044694 Bacteria 1364
413 Ga0453684_0000134 3300044712 Bacteria 324468
414 Ga0451576_0167799 3300045051 Unclassified 2291
415 Ga0451576_0328075 3300045051 Bacteria 1602
416 Ga0466967_0004773 3300045976 Bacteria 9231
417 Ga0466967_0104994 3300045976 Bacteria 2588
418 Ga0466967_0186533 3300045976 Unclassified 1958
419 Ga0466967_0385120 3300045976 Bacteria 1362
420 Ga0495629_0046948 3300046459 Bacteria 3028
421 Ga0495580_0135949 3300046472 Bacteria 1704
422 Ga0495580_0166669 3300046472 Bacteria 1524
423 Ga0495652_0160514 3300046529 Bacteria 1746
424 Ga0495665_0159216 3300046531 Bacteria 1177
425 Ga0495645_0059325 3300046543 Bacteria 2775
426 Ga0495613_0366398 3300046689 Bacteria 987
427 Ga0495674_0055359 3300047319 Bacteria 3480
428 Ga0495602_0030871 3300048088 Bacteria 5075
429 Ga0495602_0223439 3300048088 Bacteria 1420
430 Ga0496102_0012937 3300048905 Bacteria 7227
431 Ga0496104_0084025 3300048907 Bacteria 3037
432 Ga0496104_0093441 3300048907 Bacteria 2877
433 Ga0496104_0335306 3300048907 Bacteria 1425
434 Ga0496105_0045023 3300048908 Bacteria 3641
435 Ga0496106_0074087 3300048909 Bacteria 2606
436 Ga0496112_0013513 3300048915 Bacteria 7541
437 Ga0496112_0265727 3300048915 Unclassified 1665
438 Ga0496114_0102144 3300048917 Bacteria 2449
439 Ga0496115_0091605 3300048918 Bacteria 2485
440 Ga0496115_0121567 3300048918 Bacteria 2149
441 Ga0496126_0246870 3300048929 Bacteria 1489
442 Ga0501292_018374 3300049515 Bacteria 1112
443 Ga0501298_002699 3300049521 Bacteria 2709
444 Ga0501036_0186233 3300049572 Bacteria 1747
445 Ga0501036_0296105 3300049572 Bacteria 1353
446 Ga0501039_0008506 3300049575 Bacteria 7825
447 Ga0501040_0002406 3300049576 Bacteria 12044
448 Ga0501041_0000547 3300049577 Bacteria 19456
449 Ga0501042_0001267 3300049578 Bacteria 14710
450 Ga0501046_0023318 3300049580 Bacteria 5093
451 Ga0501048_0032685 3300049582 Bacteria 3760
452 Ga0501068_0033419 3300049584 Bacteria 3063
453 Ga0501071_0015286 3300049587 Bacteria 5268
454 Ga0501072_0003804 3300049588 Bacteria 11392
455 Ga0501074_0034349 3300049590 Bacteria 3676
456 Ga0501075_0001934 3300049591 Bacteria 13661
457 Ga0501075_0002970 3300049591 Bacteria 11345
458 Ga0501077_0005012 3300049593 Bacteria 8031
459 Ga0501233_010064 3300049668 Bacteria 1855
460 Ga0501235_010474 3300049669 Bacteria 2026
461 Ga0501249_020910 3300049679 Bacteria 1426
462 Ga0501245_008061 3300049708 Bacteria 1496
463 Ga0501079_0018172 3300049741 Bacteria 5370
464 Ga0501081_0197746 3300049743 Bacteria 1457
465 Ga0501283_011763 3300049779 Bacteria 1306
466 Ga0501045_0007320 3300049824 Bacteria 7670
467 nmdc:mga05p37_154645_c1 3300050507 Bacteria 2803
468 nmdc:mga05p37_221251_c1 3300050507 Bacteria 2285
469 nmdc:mga05p37_22583_c1 3300050507 Bacteria 7629
470 nmdc:mga05p37_37169_c1 3300050507 Bacteria 5972
471 nmdc:mga05p37_8749_c1 3300050507 Bacteria 11960
472 nmdc:mga09592_473188_c1 3300050508 Bacteria 1080
473 nmdc:mga0qj67_202430_c1 3300050509 Bacteria 1613
474 nmdc:mga0qj67_32728_c1 3300050509 Bacteria 4056
475 nmdc:mga0qj67_38524_c1 3300050509 Bacteria 3750
476 nmdc:mga06r32_29415_c1 3300050510 Bacteria 5148
477 nmdc:mga06r32_524439_c1 3300050510 Bacteria 1160
478 nmdc:mga06r32_564373_c1 3300050510 Bacteria 1111
479 nmdc:mga0n895_234516_c1 3300050512 Bacteria 1862
480 nmdc:mga0n895_260276_c1 3300050512 Bacteria 1761
481 nmdc:mga0rr50_5131_c1 3300050513 Bacteria 7778
482 Ga0495601_0049917 3300053077 Bacteria 2639
483 Ga0501084_0005220 3300054114 Bacteria 10632
484 Ga0590077_011625 3300059426 Bacteria 1818
485 Ga0501082_0000931 3300060353 Bacteria 25889
486 Ga0501082_0276758 3300060353 Bacteria 1461
487 Ga0530510_0008598 3300061734 Bacteria 7131
488 Ga0530510_0056924 3300061734 Bacteria 2825
489 Ga0436360_0231126
490 JGI25406J46586_10041958
491 Ga0065714_10096453
492 Ga0065712_10004279
493 Ga0065715_10001790
494 Ga0070658_10157239
495 Ga0070676_10006510
496 Ga0070683_100001978
497 Ga0070683_100153883
498 Ga0070683_100356352
499 Ga0070683_100450354
500 Ga0070670_100001613
501 Ga0070670_100013040
502 Ga0070670_100331858
503 Ga0070677_10017551
504 Ga0068869_100004293
505 Ga0068869_100120342
506 Ga0070666_10030190
507 Ga0070666_10032102
508 Ga0070680_100038753
509 Ga0068868_100000274
510 Ga0068868_100075822
511 Ga0070660_100018704
512 Ga0070660_100159631
513 Ga0070689_100000020
514 Ga0070661_100016917
515 Ga0070661_100018003
516 Ga0070661_100069369
517 Ga0070668_100044519
518 Ga0070675_100028718
519 Ga0070675_100229616
520 Ga0070671_100001209
521 Ga0070671_100066787
522 Ga0070674_100003364
523 Ga0070673_100009466
524 Ga0070659_100017675
525 Ga0070667_100008428
526 Ga0070667_100113732
527 Ga0070709_10094888
528 Ga0070714_100010861
529 Ga0070714_100105612
530 Ga0070713_100004295
531 Ga0070713_100012975
532 Ga0070713_100330902
533 Ga0070710_10021234
534 Ga0070711_100004977
535 Ga0070711_100011134
536 Ga0070705_100122687
537 Ga0070694_100014800
538 Ga0070708_100442040
539 Ga0070663_100007198
540 Ga0070678_100007168
541 Ga0070678_100044516
542 Ga0070662_100014241
543 Ga0070662_100072123
544 Ga0070681_10039187
545 Ga0070681_10047214
546 Ga0070681_10103060
547 Ga0070706_100416709
548 Ga0070679_100017904
549 Ga0070679_100100965
550 Ga0070684_100004516
551 Ga0070684_100038511
552 Ga0070684_100060018
553 Ga0070684_100131695
554 Ga0070697_100414032
555 Ga0068853_100012590
556 Ga0068853_100192348
557 Ga0068853_100222278
558 Ga0070672_100024822
559 Ga0070672_100136864
560 Ga0070695_100007718
561 Ga0070696_100008359
562 Ga0070693_100003510
563 Ga0070665_100020247
564 Ga0068855_100003330
565 Ga0068855_100004904
566 Ga0068855_100005333
567 Ga0068855_100203469
568 Ga0068855_100237297
569 Ga0070664_100001158
570 Ga0070664_100034466
571 Ga0068857_100001191
572 Ga0068857_100008616
573 Ga0068857_100024053
574 Ga0068857_100108778
575 Ga0068857_100400160
576 Ga0068854_100001734
577 Ga0068854_100178560
578 Ga0068854_100269999
579 Ga0068856_100000684
580 Ga0068856_100007587
581 Ga0068856_100022379
582 Ga0068856_100036715
583 Ga0068856_100056929
584 Ga0068852_100000026
585 Ga0068852_100000162
586 Ga0068852_100076890
587 Ga0068852_100206981
588 Ga0068852_100270035
589 Ga0068859_100004532
590 Ga0068859_100561844
591 Ga0068864_100000489
592 Ga0068851_10000898
593 Ga0068851_10009769
594 Ga0068863_100003404
595 Ga0068863_100416306
596 Ga0068858_100000718
597 Ga0068858_100038597
598 Ga0068858_100283447
599 Ga0068860_100004073
600 Ga0068862_100061070
601 Ga0081455_10000554
602 Ga0081538_10004527
603 Ga0081539_10002700
604 Ga0070717_10010717
605 Ga0070717_10013225
606 Ga0070716_100256653
607 Ga0070712_100254412
608 Ga0097621_100000090
609 Ga0068871_100013809
610 Ga0068871_100065039
611 Ga0075428_100032305
612 Ga0075428_100037760
613 Ga0075430_100047517
614 Ga0075430_100076530
615 Ga0075431_100054267
616 Ga0075431_100178138
617 Ga0075433_10207597
618 Ga0075434_100017705
619 Ga0075434_100186194
620 Ga0075429_100043058
621 Ga0075429_100073195
622 Ga0075429_100074788
623 Ga0075429_100507525
624 Ga0068865_100013180
625 Ga0075436_100010953
626 Ga0097620_100004532
627 Ga0097620_100561823
628 Ga0075435_100015431
629 Ga0075435_100020525
630 Ga0099794_10038736
631 Ga0105240_10000038
632 Ga0105240_10000267
633 Ga0105240_10000274
634 Ga0105240_10015772
635 Ga0105240_10015983
636 Ga0105240_10019622
637 Ga0105240_10023154
638 Ga0105240_10048485
639 Ga0105240_10112205
640 Ga0105240_10390178
641 Ga0111539_10451227
642 Ga0105245_10000750
643 Ga0105245_10053139
644 Ga0105245_10159391
645 Ga0105245_10196874
646 Ga0105247_10003425
647 Ga0105247_10015809
648 Ga0105247_10080090
649 Ga0114129_10000989
650 Ga0114129_10198185
651 Ga0114129_10236312
652 Ga0114129_10431681
653 Ga0114129_10631922
654 Ga0105243_10034259
655 Ga0105243_10048765
656 Ga0105241_10000059
657 Ga0105241_10002855
658 Ga0105241_10004202
659 Ga0105241_10071796
660 Ga0105241_10074402
661 Ga0105241_10173364
662 Ga0105242_10115629
663 Ga0105242_10119445
664 Ga0105242_10511100
665 Ga0105248_10000467
666 Ga0105248_10005092
667 Ga0105237_10014213
668 Ga0105237_10023623
669 Ga0105237_10039455
670 Ga0105237_10215489
671 Ga0105237_10278385
672 Ga0105237_10460239
673 Ga0105238_10000466
674 Ga0105238_10006878
675 Ga0105238_10031588
676 Ga0105238_10083810
677 Ga0105238_10087639
678 Ga0105238_10264542
679 Ga0105249_10126979
680 Ga0105249_10157146
681 Ga0105249_10562335
682 Ga0105239_10004984
683 Ga0105239_10006259
684 Ga0105239_10029394
685 Ga0105239_10034986
686 Ga0105239_10211990
687 Ga0105239_10425048
688 Ga0105246_10002003
689 Ga0105246_10004354
690 Ga0105246_10241789
691 Ga0157373_10041406
692 Ga0157373_10062155
693 Ga0157370_10000011
694 Ga0157370_10314131
695 Ga0157369_10000060
696 Ga0157369_10000488
697 Ga0157369_10001987
698 Ga0157369_10016155
699 Ga0157369_10039960
700 Ga0157369_10041763
701 Ga0157369_10074867
702 Ga0157369_10080887
703 Ga0157369_10094033
704 Ga0157369_10137240
705 Ga0157369_10161622
706 Ga0157374_10002962
707 Ga0157374_10029541
708 Ga0157374_10117885
709 Ga0157374_10119695
710 Ga0157374_10223698
711 Ga0157378_10007414
712 Ga0157378_10029965
713 Ga0157378_10133201
714 Ga0157378_10374606
715 Ga0163162_10031901
716 Ga0163162_10055709
717 Ga0163162_10221175
718 Ga0157372_10000240
719 Ga0157372_10002911
720 Ga0157372_10006449
721 Ga0157372_10015718
722 Ga0157372_10025715
723 Ga0157372_10037588
724 Ga0157372_10223610
725 Ga0157375_10004564
726 Ga0157375_10178111
727 Ga0157375_10556721
728 Ga0163163_10001965
729 Ga0157379_10001276
730 Ga0157379_10048155
731 Ga0157376_10015146
732 Ga0157376_10231854
733 Ga0163161_10038308
734 Ga0206352_10983614
735 Ga0213872_10008519
736 Ga0213872_10021042
737 Ga0213872_10021458
738 Ga0213875_10025007
739 Ga0213871_10026543
740 Ga0207656_10019529
741 Ga0207682_10021369
742 Ga0207710_10000944
743 Ga0207688_10063584
744 Ga0207680_10036283
745 Ga0207680_10215814
746 Ga0207680_10268801
747 Ga0207647_10052666
748 Ga0207647_10111314
749 Ga0207699_10135742
750 Ga0207645_10000665
751 Ga0207645_10007109
752 Ga0207705_10362326
753 Ga0207684_10443045
754 Ga0207654_10000017
755 Ga0207654_10000728
756 Ga0207654_10002174
757 Ga0207707_10010455
758 Ga0207707_10030371
759 Ga0207695_10000030
760 Ga0207695_10000070
761 Ga0207695_10000669
762 Ga0207695_10002576
763 Ga0207695_10004905
764 Ga0207695_10005273
765 Ga0207695_10005370
766 Ga0207695_10013946
767 Ga0207695_10016184
768 Ga0207695_10054555
769 Ga0207695_10385087
770 Ga0207671_10000071
771 Ga0207671_10003485
772 Ga0207671_10038849
773 Ga0207671_10183498
774 Ga0207671_10381338
775 Ga0207693_10326115
776 Ga0207663_10144325
777 Ga0207660_10199912
778 Ga0207657_10215707
779 Ga0207649_10026571
780 Ga0207649_10055857
781 Ga0207652_10076029
782 Ga0207646_10073652
783 Ga0207694_10000192
784 Ga0207694_10000859
785 Ga0207694_10002709
786 Ga0207694_10202068
787 Ga0207650_10000465
788 Ga0207650_10059713
789 Ga0207659_10090785
790 Ga0207687_10003472
791 Ga0207700_10049337
792 Ga0207700_10181435
793 Ga0207644_10030852
794 Ga0207690_10009019
795 Ga0207706_10005068
796 Ga0207706_10020647
797 Ga0207686_10230679
798 Ga0207670_10000126
799 Ga0207669_10160786
800 Ga0207704_10241423
801 Ga0207665_10159631
802 Ga0207691_10002614
803 Ga0207691_10013303
804 Ga0207711_10006019
805 Ga0207689_10004353
806 Ga0207689_10025824
807 Ga0207661_10048749
808 Ga0207661_10179524
809 Ga0207661_10467540
810 Ga0207679_10001654
811 Ga0207679_10100653
812 Ga0207667_10000815
813 Ga0207667_10004349
814 Ga0207667_10012737
815 Ga0207667_10142245
816 Ga0207651_10064971
817 Ga0207651_10187175
818 Ga0207712_10040775
819 Ga0207668_10005350
820 Ga0207640_10263479
821 Ga0207658_10001530
822 Ga0207677_10000986
823 Ga0207703_10002777
824 Ga0207703_10251460
825 Ga0207639_10118895
826 Ga0207678_10144287
827 Ga0207702_10005318
828 Ga0207702_10005718
829 Ga0207702_10009127
830 Ga0207702_10026381
831 Ga0207702_10063137
832 Ga0207702_10305779
833 Ga0207641_10001559
834 Ga0207676_10004204
835 Ga0207674_10000764
836 Ga0207674_10003289
837 Ga0207674_10101565
838 Ga0207674_10245042
839 Ga0207683_10000952
840 Ga0207683_10005047
841 Ga0207698_10000010
842 Ga0207698_10000273
843 Ga0207698_10088764
844 Ga0207698_10310099
845 Ga0209999_1013535
846 Ga0209983_1013336
847 Ga0209588_1000647
848 Ga0209971_1022573
849 Ga0207428_10156213
850 Ga0268266_10012095
851 Ga0268265_10150303
852 Ga0268264_10000331
853 Ga0265319_1010796
854 Ga0265318_10020967
855 Ga0265338_10329322
856 Ga0265320_10037318
857 Ga0265331_10025903
858 Ga0265316_10079884
859 Ga0265316_10216712
860 Ga0265313_10041717
861 Ga0265314_10012854
862 Ga0307405_10072817
863 Ga0307413_10007667
864 Ga0307410_10010417
865 Ga0307410_10113509
866 Ga0307410_10123973
867 Ga0307406_10124253
868 Ga0307407_10013394
869 Ga0307412_10129320
870 Ga0307412_10199954
871 Ga0307409_100006354
872 Ga0307409_100010694
873 Ga0307409_100293743
874 Ga0307416_100009543
875 Ga0307416_100272215
876 Ga0307414_10006151
877 Ga0307411_10002963
878 Ga0307411_10215042
879 Ga0307415_100005602
880 Ga0373939_0010084
881 Ga0373945_0030669
882 Ga0373956_0026303
883 Ga0373943_0018610
884 Ga0373935_0018382
885 Ga0373935_0033889
886 Ga0373937_0149160
887 Ga0395900_0022502
888 Ga0395898_0029262
889 Ga0436364_0312326
890 Ga0395901_0042194
891 Ga0436365_1159537
892 Ga0436360_0513085
893 Ga0436360_1306349
894 Ga0436361_0223220
895 Ga0436361_0587474
896 Ga0436361_0626744
897 Ga0436361_0763547
898 Ga0466966_0020698
899 Ga0466966_0027296
900 Ga0466963_0209498
901 Ga0453684_0000134
902 Ga0451576_0167799
903 Ga0451576_0328075
904 Ga0466967_0004773
905 Ga0466967_0104994
906 Ga0466967_0186533
907 Ga0466967_0385120
908 Ga0495629_0046948
909 Ga0495580_0135949
910 Ga0495580_0166669
911 Ga0495652_0160514
912 Ga0495665_0159216
913 Ga0495645_0059325
914 Ga0495613_0366398
915 Ga0495674_0055359
916 Ga0495602_0030871
917 Ga0495602_0223439
918 Ga0496102_0012937
919 Ga0496104_0084025
920 Ga0496104_0093441
921 Ga0496104_0335306
922 Ga0496105_0045023
923 Ga0496106_0074087
924 Ga0496112_0013513
925 Ga0496112_0265727
926 Ga0496114_0102144
927 Ga0496115_0091605
928 Ga0496115_0121567
929 Ga0496126_0246870
930 Ga0501292_018374
931 Ga0501298_002699
932 Ga0501036_0186233
933 Ga0501036_0296105
934 Ga0501039_0008506
935 Ga0501040_0002406
936 Ga0501041_0000547
937 Ga0501042_0001267
938 Ga0501046_0023318
939 Ga0501048_0032685
940 Ga0501068_0033419
941 Ga0501071_0015286
942 Ga0501072_0003804
943 Ga0501074_0034349
944 Ga0501075_0001934
945 Ga0501075_0002970
946 Ga0501077_0005012
947 Ga0501233_010064
948 Ga0501235_010474
949 Ga0501249_020910
950 Ga0501245_008061
951 Ga0501079_0018172
952 Ga0501081_0197746
953 Ga0501283_011763
954 Ga0501045_0007320
955 nmdc:mga05p37_154645_c1
956 nmdc:mga05p37_221251_c1
957 nmdc:mga05p37_22583_c1
958 nmdc:mga05p37_37169_c1
959 nmdc:mga05p37_8749_c1
960 nmdc:mga09592_473188_c1
961 nmdc:mga0qj67_202430_c1
962 nmdc:mga0qj67_32728_c1
963 nmdc:mga0qj67_38524_c1
964 nmdc:mga06r32_29415_c1
965 nmdc:mga06r32_524439_c1
966 nmdc:mga06r32_564373_c1
967 nmdc:mga0n895_234516_c1
968 nmdc:mga0n895_260276_c1
969 nmdc:mga0rr50_5131_c1
970 Ga0495601_0049917
971 Ga0501084_0005220
972 Ga0590077_011625
973 Ga0501082_0000931
974 Ga0501082_0276758
975 Ga0530510_0008598
976 Ga0530510_0056924

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

28

262

0.88

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

29

324

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m55-assembly1.cif.gz_E crystal structure of human udp-xylose synthase r236h substitution 0.9899 2 236
4lk3-assembly1.cif.gz_E crystal structure of human udp-xylose synthase r236a substitution 0.9844 2 308
4m55-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236h substitution 0.9826 2 308
4lk3-assembly1.cif.gz_C crystal structure of human udp-xylose synthase r236a substitution 0.9796 2 308
2b69-assembly1.cif.gz_A crystal structure of human udp-glucoronic acid decarboxylase 0.9794 2 308
ID Description Score Start End Superfamily
4m55E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9899 2 236 3.40.50.720
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9871 1 308 3.40.50.720
4lk3E00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9844 2 308 3.40.50.720
af_A0A1D6N7M5_279_504_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9837 90 308 3.40.50.720
af_B7ZXP4_113_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.982 2 126 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0R3QDC1-F1-model_v4 UDP-glucuronate decarboxylase 0.9944 157 308 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A4R2IL66-F1-model_v4 GDP-mannose 4,6 dehydratase 0.9936 181 308 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A520Y571-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9932 2 308 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A7C5C0K4-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9927 176 307 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403
AF-A0A5C4MPF4-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9922 167 308 GO:0005737
GO:0033320
GO:0042732
GO:0048040
GO:0070403

Map