F453628

General Info

Members Datasets Scaffolds Average Seq Length
488 282 976 258

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10159166|Ga0307405_101591662
Length 282
Sequence MVQRGARFAQQPSSNRKGPTMTETSTPATRASELLRLHQDSELLTVVNVWDVISARVVAGIEGTKALATASHSIAASHGYEDGENIPVDEMIDAVGRIAAATSLPVSADLEGGYGNAPETIRKAIGVGIVGANLEDQLKPIAESVAQVEAAMKVAEAEGVPDFVLNARTDAFVKAGDRDPGAVLADAVERGRAYLDAGAPVVFVPGALDEQQITTLVDAFGPQRLTVIGIPGSPPLARLAELGVARVSFGPLSQRVALTALAKLVEDVHRGGGVAADTRPLN

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
150 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
151 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
152 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
239 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
240 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
245 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
246 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
247 2643221549 Agromyces sp. Root1464 Isolate Unclassified
248 2643221561 Nocardioides sp. Root151 Isolate Unclassified
249 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
250 2643221572 Leifsonia sp. Root60 Isolate Unclassified
251 2643221615 Nocardioides sp. Root224 Isolate Unclassified
252 2643221616 Leifsonia sp. Root227 Isolate Unclassified
253 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
254 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
255 2643221649 Leifsonia sp. Root4 Isolate Unclassified
256 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
257 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
258 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
259 2643221696 Nocardioides sp. Root140 Isolate Unclassified
260 2643221711 Terrabacter sp. Root85 Isolate Unclassified
261 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
262 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
263 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
264 2808606372 Agromyces sp. 23-23 Isolate Unclassified
265 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
266 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
267 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
268 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
269 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
270 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
271 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
272 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
273 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
274 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
275 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
276 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
277 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
278 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
279 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
280 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
281 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
282 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.01
Metatranscriptomes 0.2
Isolates 7.79

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 9.22
Nodule 0
Rhizoplane 12.91
Rhizosphere 70.08
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10159166 3300031731 Bacteria 1597
2 JGI24737J22298_10093448 3300001990 Bacteria 892
3 JGI25164J39214_1002982 3300002772 Bacteria 2300
4 JGI25152J39213_1000175 3300002773 Bacteria 43464
5 JGI25165J46597_1000005 3300003214 Bacteria 623702
6 rootL2_10166260 3300003322 Bacteria 3178
7 Ga0006562J51391_1033800 3300003578 Bacteria 1290
8 Ga0055539_1000060 3300003752 Bacteria 146006
9 Ga0055525_1001849 3300003759 Bacteria 2847
10 Ga0065714_10072940 3300005288 Bacteria 3272
11 Ga0065712_10033444 3300005290 Bacteria 1339
12 Ga0070676_10113058 3300005328 Bacteria 1693
13 Ga0070683_100003656 3300005329 Bacteria 12533
14 Ga0070683_100189811 3300005329 Bacteria 1951
15 Ga0070683_100218588 3300005329 Bacteria 1811
16 Ga0070690_100081203 3300005330 Bacteria 2121
17 Ga0068869_100013560 3300005334 Bacteria 5425
18 Ga0068869_100311614 3300005334 Bacteria 1274
19 Ga0070666_10151321 3300005335 Bacteria 1619
20 Ga0070682_100010825 3300005337 Bacteria 5190
21 Ga0068868_100054690 3300005338 Bacteria 3147
22 Ga0068868_100134988 3300005338 Bacteria 2022
23 Ga0068868_100218466 3300005338 Bacteria 1595
24 Ga0068868_100374241 3300005338 Bacteria 1224
25 Ga0070660_100074398 3300005339 Bacteria 2658
26 Ga0070689_100333624 3300005340 Bacteria 1269
27 Ga0070691_10102514 3300005341 Bacteria 1423
28 Ga0070692_10027379 3300005345 Bacteria 2825
29 Ga0070692_10183613 3300005345 Bacteria 1214
30 Ga0070668_100122967 3300005347 Bacteria 2076
31 Ga0070669_100103477 3300005353 Bacteria 2151
32 Ga0070675_100184626 3300005354 Bacteria 1804
33 Ga0070673_100102394 3300005364 Bacteria 2361
34 Ga0070659_100013701 3300005366 Bacteria 6043
35 Ga0070667_100387891 3300005367 Bacteria 1270
36 Ga0070700_100060913 3300005441 Bacteria 2380
37 Ga0070663_100024123 3300005455 Bacteria 4088
38 Ga0070678_100023208 3300005456 Bacteria 4130
39 Ga0070678_100365820 3300005456 Bacteria 1244
40 Ga0070678_100391994 3300005456 Bacteria 1204
41 Ga0068867_100396994 3300005459 Bacteria 1162
42 Ga0068867_100409998 3300005459 Bacteria 1145
43 Ga0070684_100021087 3300005535 Bacteria 5414
44 Ga0070684_100147650 3300005535 Bacteria 2129
45 Ga0070684_100700636 3300005535 Bacteria 944
46 Ga0070665_100137393 3300005548 Bacteria 2447
47 Ga0070665_100288245 3300005548 Bacteria 1644
48 Ga0070665_100722345 3300005548 Bacteria 1009
49 Ga0070665_100779976 3300005548 Bacteria 969
50 Ga0068855_100228002 3300005563 Bacteria 2087
51 Ga0070664_100077900 3300005564 Bacteria 2851
52 Ga0070664_100273195 3300005564 Bacteria 1523
53 Ga0068857_100006401 3300005577 Bacteria 10094
54 Ga0068857_100225959 3300005577 Bacteria 1711
55 Ga0068857_100311606 3300005577 Bacteria 1452
56 Ga0068854_100305434 3300005578 Bacteria 1289
57 Ga0068856_100168590 3300005614 Bacteria 2201
58 Ga0068856_100552238 3300005614 Bacteria 1173
59 Ga0070702_100014910 3300005615 Bacteria 3955
60 Ga0068852_100084968 3300005616 Bacteria 2818
61 Ga0068852_100129783 3300005616 Bacteria 2320
62 Ga0068852_100428772 3300005616 Bacteria 1305
63 Ga0068859_100186086 3300005617 Bacteria 2161
64 Ga0068864_100085645 3300005618 Bacteria 2771
65 Ga0068861_100824070 3300005719 Bacteria 873
66 Ga0068851_10085588 3300005834 Bacteria 1653
67 Ga0068870_10155338 3300005840 Bacteria 1352
68 Ga0068860_100000555 3300005843 Bacteria 45431
69 Ga0081539_10066629 3300005985 Bacteria 1951
70 Ga0075365_10010898 3300006038 Bacteria 5323
71 Ga0075365_10058595 3300006038 Bacteria 2564
72 Ga0075365_10063231 3300006038 Bacteria 2477
73 Ga0075365_10120486 3300006038 Bacteria 1809
74 Ga0075368_10001134 3300006042 Bacteria 8402
75 Ga0075368_10026205 3300006042 Bacteria 2242
76 Ga0075363_100001118 3300006048 Bacteria 9746
77 Ga0075363_100017454 3300006048 Bacteria 3560
78 Ga0075363_100037494 3300006048 Bacteria 2546
79 Ga0075364_10042775 3300006051 Bacteria 2944
80 Ga0075364_10270544 3300006051 Bacteria 1156
81 Ga0075362_10007085 3300006177 Bacteria 4219
82 Ga0075367_10097445 3300006178 Bacteria 1794
83 Ga0097621_100120357 3300006237 Bacteria 2226
84 Ga0075370_10009784 3300006353 Bacteria 4994
85 Ga0075370_10129691 3300006353 Bacteria 1471
86 Ga0068871_100407949 3300006358 Bacteria 1211
87 Ga0075428_100875241 3300006844 Bacteria 953
88 Ga0075434_100215940 3300006871 Bacteria 1938
89 Ga0075429_100487635 3300006880 Bacteria 1080
90 Ga0068865_100231593 3300006881 Bacteria 1450
91 Ga0068865_100332472 3300006881 Bacteria 1225
92 Ga0097620_100186094 3300006931 Bacteria 2161
93 Ga0105244_10022044 3300009036 Bacteria 3512
94 Ga0105244_10089981 3300009036 Bacteria 1510
95 Ga0111539_10448461 3300009094 Bacteria 1502
96 Ga0105245_10001722 3300009098 Bacteria 19953
97 Ga0105245_10032712 3300009098 Bacteria 4605
98 Ga0105245_10327094 3300009098 Bacteria 1512
99 Ga0105245_10602377 3300009098 Bacteria 1125
100 Ga0105247_10083044 3300009101 Bacteria 2022
101 Ga0105243_10106975 3300009148 Bacteria 2332
102 Ga0105243_10137785 3300009148 Bacteria 2078
103 Ga0105241_10704872 3300009174 Bacteria 922
104 Ga0105242_10769034 3300009176 Bacteria 950
105 Ga0105248_10031051 3300009177 Bacteria 5970
106 Ga0105248_10217329 3300009177 Bacteria 2153
107 Ga0105248_10470619 3300009177 Bacteria 1416
108 Ga0105237_10461718 3300009545 Bacteria 1276
109 Ga0105238_10433712 3300009551 Bacteria 1310
110 Ga0105238_10889505 3300009551 Bacteria 909
111 Ga0105249_10385190 3300009553 Bacteria 1429
112 Ga0105239_10001349 3300010375 Bacteria 33078
113 Ga0105239_10020213 3300010375 Bacteria 7345
114 Ga0105246_10001504 3300011119 Bacteria 13823
115 Ga0157373_10093298 3300013100 Bacteria 2120
116 Ga0157370_10003550 3300013104 Bacteria 18257
117 Ga0157370_10097483 3300013104 Bacteria 2758
118 Ga0157370_10266466 3300013104 Bacteria 1583
119 Ga0157369_10016603 3300013105 Bacteria 8277
120 Ga0157369_10112448 3300013105 Bacteria 2893
121 Ga0157369_10150112 3300013105 Bacteria 2463
122 Ga0157369_10320183 3300013105 Bacteria 1612
123 Ga0157378_10011034 3300013297 Bacteria 7907
124 Ga0163162_10052068 3300013306 Bacteria 4110
125 Ga0163162_10065463 3300013306 Bacteria 3682
126 Ga0163162_10536789 3300013306 Bacteria 1298
127 Ga0163162_10957066 3300013306 Bacteria 967
128 Ga0157372_10620742 3300013307 Bacteria 1260
129 Ga0157375_10087860 3300013308 Bacteria 3162
130 Ga0157375_10191569 3300013308 Bacteria 2199
131 Ga0157375_10194450 3300013308 Bacteria 2184
132 Ga0157375_10401455 3300013308 Bacteria 1537
133 Ga0157375_10417629 3300013308 Bacteria 1508
134 Ga0157375_10829708 3300013308 Bacteria 1072
135 Ga0157375_10999438 3300013308 Bacteria 976
136 Ga0163163_10047424 3300014325 Bacteria 4223
137 Ga0163163_10667311 3300014325 Bacteria 1103
138 Ga0157380_10136730 3300014326 Bacteria 2099
139 Ga0157380_10236705 3300014326 Bacteria 1643
140 Ga0182008_10024863 3300014497 Bacteria 3045
141 Ga0182008_10116479 3300014497 Bacteria 1326
142 Ga0157379_10022693 3300014968 Bacteria 5561
143 Ga0157379_10716559 3300014968 Bacteria 940
144 Ga0163161_10100093 3300017792 Bacteria 2156
145 Ga0163161_10179168 3300017792 Bacteria 1624
146 Ga0163161_10238689 3300017792 Bacteria 1413
147 Ga0213875_10128635 3300021388 Bacteria 1184
148 Ga0209563_101792 3300025230 Bacteria 5339
149 Ga0207427_100325 3300025231 Bacteria 32046
150 Ga0209437_100629 3300025233 Bacteria 21173
151 Ga0209129_1000220 3300025258 Bacteria 65268
152 Ga0209233_1000001 3300025261 Bacteria 2992747
153 Ga0209025_1000586 3300025294 Bacteria 65856
154 Ga0207697_10012935 3300025315 Bacteria 3488
155 Ga0207682_10027471 3300025893 Bacteria 2266
156 Ga0207688_10018426 3300025901 Bacteria 3799
157 Ga0207688_10021216 3300025901 Bacteria 3549
158 Ga0207688_10100197 3300025901 Bacteria 1672
159 Ga0207680_10464483 3300025903 Bacteria 899
160 Ga0207645_10055010 3300025907 Bacteria 2541
161 Ga0207657_10256587 3300025919 Bacteria 1392
162 Ga0207681_10084710 3300025923 Bacteria 2248
163 Ga0207687_10030561 3300025927 Bacteria 3633
164 Ga0207644_10047576 3300025931 Bacteria 3062
165 Ga0207690_10024959 3300025932 Bacteria 3748
166 Ga0207690_10047825 3300025932 Bacteria 2841
167 Ga0207706_10023472 3300025933 Bacteria 5539
168 Ga0207706_10257819 3300025933 Bacteria 1523
169 Ga0207709_10184333 3300025935 Bacteria 1477
170 Ga0207670_10148094 3300025936 Bacteria 1738
171 Ga0207670_10372375 3300025936 Bacteria 1136
172 Ga0207670_10506590 3300025936 Bacteria 981
173 Ga0207704_10271857 3300025938 Bacteria 1284
174 Ga0207691_10112107 3300025940 Bacteria 2425
175 Ga0207711_10104885 3300025941 Bacteria 2506
176 Ga0207689_10013034 3300025942 Bacteria 7100
177 Ga0207689_10028852 3300025942 Bacteria 4640
178 Ga0207661_10017063 3300025944 Bacteria 5364
179 Ga0207661_10035445 3300025944 Bacteria 3888
180 Ga0207661_10192442 3300025944 Bacteria 1789
181 Ga0207661_10230578 3300025944 Bacteria 1640
182 Ga0207661_10246106 3300025944 Bacteria 1588
183 Ga0207679_10057505 3300025945 Bacteria 2877
184 Ga0207679_10321696 3300025945 Bacteria 1340
185 Ga0207667_10446159 3300025949 Bacteria 1315
186 Ga0207651_10226765 3300025960 Bacteria 1514
187 Ga0207712_10305805 3300025961 Bacteria 1307
188 Ga0207668_10041191 3300025972 Bacteria 3121
189 Ga0207668_10201966 3300025972 Bacteria 1584
190 Ga0207668_10207488 3300025972 Bacteria 1565
191 Ga0207668_10332626 3300025972 Bacteria 1264
192 Ga0207640_10198279 3300025981 Bacteria 1519
193 Ga0207658_10314739 3300025986 Bacteria 1353
194 Ga0207677_10060958 3300026023 Bacteria 2610
195 Ga0207677_10074807 3300026023 Bacteria 2405
196 Ga0207677_10132737 3300026023 Bacteria 1894
197 Ga0207677_10187815 3300026023 Bacteria 1632
198 Ga0207677_10227195 3300026023 Bacteria 1501
199 Ga0207703_10036238 3300026035 Bacteria 3925
200 Ga0207678_10015385 3300026067 Bacteria 6728
201 Ga0207678_10092706 3300026067 Bacteria 2581
202 Ga0207708_10050596 3300026075 Bacteria 3163
203 Ga0207708_10107593 3300026075 Bacteria 2162
204 Ga0207708_10531118 3300026075 Bacteria 990
205 Ga0207702_10145956 3300026078 Bacteria 2147
206 Ga0207702_10237331 3300026078 Bacteria 1707
207 Ga0207702_10310715 3300026078 Bacteria 1499
208 Ga0207641_10083132 3300026088 Bacteria 2784
209 Ga0207676_10260231 3300026095 Bacteria 1566
210 Ga0207674_10105951 3300026116 Bacteria 2789
211 Ga0207674_10280372 3300026116 Bacteria 1615
212 Ga0207675_100002895 3300026118 Bacteria 16878
213 Ga0207683_10036101 3300026121 Bacteria 4301
214 Ga0207683_10297826 3300026121 Bacteria 1476
215 Ga0207683_10332456 3300026121 Bacteria 1393
216 Ga0207683_10347119 3300026121 Bacteria 1362
217 Ga0207683_10392261 3300026121 Bacteria 1276
218 Ga0207683_10393315 3300026121 Bacteria 1275
219 Ga0207698_10101217 3300026142 Bacteria 2389
220 Ga0268266_10003867 3300028379 Bacteria 14601
221 Ga0268264_10000264 3300028381 Bacteria 93499
222 Ga0268264_10182611 3300028381 Bacteria 1906
223 Ga0307513_10001824 3300031456 Bacteria 30233
224 Ga0307509_10232333 3300031507 Bacteria 1646
225 Ga0307413_10000499 3300031824 Bacteria 12927
226 Ga0307413_10376656 3300031824 Bacteria 1104
227 Ga0307518_10005947 3300031838 Bacteria 8754
228 Ga0307410_10039140 3300031852 Bacteria 3111
229 Ga0307410_10072928 3300031852 Bacteria 2386
230 Ga0307410_10437715 3300031852 Bacteria 1064
231 Ga0307406_10011434 3300031901 Bacteria 5039
232 Ga0307407_10082980 3300031903 Bacteria 1944
233 Ga0307407_10156036 3300031903 Bacteria 1489
234 Ga0307407_10303890 3300031903 Bacteria 1113
235 Ga0307412_10082112 3300031911 Bacteria 2231
236 Ga0307412_10161722 3300031911 Unclassified 1664
237 Ga0307409_100084606 3300031995 Bacteria 2576
238 Ga0307409_100100677 3300031995 Bacteria 2396
239 Ga0307409_100123153 3300031995 Bacteria 2200
240 Ga0307409_100325259 3300031995 Bacteria 1441
241 Ga0307409_100434079 3300031995 Bacteria 1263
242 Ga0307416_100069668 3300032002 Bacteria 2912
243 Ga0307416_100081700 3300032002 Bacteria 2734
244 Ga0307416_100410415 3300032002 Bacteria 1395
245 Ga0307415_100038261 3300032126 Bacteria 3160
246 Ga0307507_10006968 3300033179 Bacteria 16815
247 Ga0373931_0169401 3300035691 Bacteria 1286
248 Ga0395900_0045880 3300037418 Bacteria 4501
249 Ga0436364_0402084 3300037853 Bacteria 1400
250 Ga0395901_0162855 3300038443 Bacteria 2342
251 Ga0451791_1071581 3300041451 Bacteria 2613
252 Ga0451793_1146628 3300041452 Bacteria 986
253 Ga0451797_1101593 3300041453 Bacteria 1738
254 Ga0451843_0835498 3300041509 Bacteria 1332
255 Ga0451853_0062399 3300041512 Bacteria 1329
256 Ga0466972_0027988 3300044658 Bacteria 2785
257 Ga0466965_0154777 3300044683 Bacteria 1200
258 Ga0466961_0279937 3300044693 Bacteria 1021
259 Ga0466963_0038643 3300044694 Bacteria 3122
260 Ga0466963_0055479 3300044694 Bacteria 2635
261 Ga0466963_0134753 3300044694 Bacteria 1708
262 Ga0466964_0011404 3300044706 Bacteria 3357
263 Ga0466964_0113823 3300044706 Bacteria 1210
264 Ga0466971_0024231 3300044719 Bacteria 2708
265 Ga0466970_0079304 3300044765 Bacteria 1772
266 Ga0466970_0289659 3300044765 Bacteria 922
267 Ga0466957_0004240 3300044842 Bacteria 7950
268 Ga0466957_0089943 3300044842 Bacteria 1922
269 Ga0466957_0351648 3300044842 Bacteria 1000
270 Ga0466960_0008166 3300044901 Bacteria 4279
271 Ga0466960_0090074 3300044901 Bacteria 1562
272 Ga0466960_0098590 3300044901 Bacteria 1501
273 Ga0466959_0089337 3300045049 Bacteria 2214
274 Ga0466959_0152848 3300045049 Bacteria 1626
275 Ga0451576_0127313 3300045051 Bacteria 2654
276 Ga0466958_0022735 3300045836 Bacteria 3676
277 Ga0466958_0093229 3300045836 Bacteria 1865
278 Ga0466967_0067852 3300045976 Bacteria 3182
279 Ga0466967_0310600 3300045976 Bacteria 1518
280 Ga0466967_0353499 3300045976 Bacteria 1423
281 Ga0466967_0377691 3300045976 Bacteria 1375
282 Ga0466967_0475671 3300045976 Bacteria 1223
283 Ga0466967_0521494 3300045976 Bacteria 1168
284 Ga0495653_0041663 3300046463 Bacteria 3583
285 Ga0495664_0041498 3300046477 Bacteria 2723
286 Ga0495594_0109795 3300046499 Bacteria 1555
287 Ga0495631_0049194 3300046518 Bacteria 1846
288 Ga0495665_0050352 3300046531 Bacteria 2208
289 Ga0495586_0019411 3300046535 Bacteria 3618
290 Ga0495587_0077101 3300046536 Bacteria 1935
291 Ga0495645_0072092 3300046543 Bacteria 2489
292 Ga0495622_0091938 3300046557 Bacteria 1394
293 Ga0495667_0048555 3300046559 Bacteria 2802
294 Ga0495656_0051523 3300046615 Bacteria 1762
295 Ga0495668_0209305 3300046616 Bacteria 1068
296 Ga0495659_0033892 3300046664 Bacteria 1794
297 Ga0495588_0166573 3300046674 Bacteria 1165
298 Ga0495657_0181997 3300046675 Bacteria 1289
299 Ga0495581_0022084 3300047315 Bacteria 3687
300 Ga0495581_0071423 3300047315 Bacteria 2008
301 Ga0495636_0023413 3300047318 Bacteria 2500
302 Ga0495680_0209827 3300047322 Bacteria 1395
303 Ga0495680_0254427 3300047322 Bacteria 1244
304 Ga0495675_0014247 3300047444 Bacteria 5026
305 Ga0495593_0052792 3300047673 Bacteria 2147
306 Ga0496100_0025020 3300048903 Bacteria 3647
307 Ga0496100_0059176 3300048903 Bacteria 2516
308 Ga0496101_0120516 3300048904 Bacteria 1983
309 Ga0496101_0216154 3300048904 Bacteria 1486
310 Ga0496101_0217876 3300048904 Bacteria 1480
311 Ga0496102_0005529 3300048905 Bacteria 10731
312 Ga0496102_0032050 3300048905 Bacteria 4720
313 Ga0496102_0062155 3300048905 Bacteria 3419
314 Ga0496102_0080302 3300048905 Bacteria 3004
315 Ga0496102_0319178 3300048905 Bacteria 1463
316 Ga0496103_0008488 3300048906 Bacteria 6104
317 Ga0496103_0040015 3300048906 Bacteria 2881
318 Ga0496103_0076553 3300048906 Bacteria 2100
319 Ga0496103_0192144 3300048906 Bacteria 1312
320 Ga0496104_0012872 3300048907 Bacteria 7535
321 Ga0496104_0177163 3300048907 Bacteria 2042
322 Ga0496105_0018297 3300048908 Bacteria 5628
323 Ga0496105_0066872 3300048908 Bacteria 2967
324 Ga0496105_0137570 3300048908 Bacteria 2011
325 Ga0496105_0572454 3300048908 Bacteria 879
326 Ga0496106_0015184 3300048909 Bacteria 5700
327 Ga0496106_0138862 3300048909 Bacteria 1910
328 Ga0496107_0009501 3300048910 Bacteria 6747
329 Ga0496108_0008746 3300048911 Bacteria 8210
330 Ga0496108_0027326 3300048911 Bacteria 4710
331 Ga0496108_0044652 3300048911 Bacteria 3699
332 Ga0496108_0242448 3300048911 Bacteria 1568
333 Ga0496108_0315950 3300048911 Bacteria 1361
334 Ga0496108_0415977 3300048911 Bacteria 1174
335 Ga0496109_0000476 3300048912 Bacteria 34082
336 Ga0496109_0007054 3300048912 Bacteria 9480
337 Ga0496109_0017272 3300048912 Bacteria 6321
338 Ga0496109_0020917 3300048912 Bacteria 5784
339 Ga0496109_0063747 3300048912 Bacteria 3371
340 Ga0496109_0247510 3300048912 Bacteria 1678
341 Ga0496109_0297915 3300048912 Bacteria 1520
342 Ga0496109_0534696 3300048912 Bacteria 1106
343 Ga0496110_0013914 3300048913 Bacteria 6665
344 Ga0496110_0085367 3300048913 Bacteria 2817
345 Ga0496110_0128496 3300048913 Bacteria 2287
346 Ga0496110_0129526 3300048913 Bacteria 2278
347 Ga0496110_0167481 3300048913 Bacteria 1993
348 Ga0496111_0023984 3300048914 Bacteria 4289
349 Ga0496111_0043468 3300048914 Bacteria 3229
350 Ga0496111_0154725 3300048914 Bacteria 1701
351 Ga0496111_0307830 3300048914 Bacteria 1174
352 Ga0496112_0042685 3300048915 Bacteria 4438
353 Ga0496112_0089957 3300048915 Bacteria 3038
354 Ga0496112_0147106 3300048915 Bacteria 2324
355 Ga0496113_0045306 3300048916 Bacteria 3262
356 Ga0496113_0106329 3300048916 Bacteria 2179
357 Ga0496113_0107122 3300048916 Bacteria 2171
358 Ga0496114_0010626 3300048917 Bacteria 7324
359 Ga0496114_0012696 3300048917 Bacteria 6746
360 Ga0496114_0020019 3300048917 Bacteria 5428
361 Ga0496114_0047175 3300048917 Bacteria 3582
362 Ga0496114_0161030 3300048917 Bacteria 1951
363 Ga0496114_0177205 3300048917 Bacteria 1860
364 Ga0496115_0117668 3300048918 Bacteria 2186
365 Ga0496115_0555605 3300048918 Bacteria 917
366 Ga0496122_0238869 3300048925 Bacteria 1026
367 Ga0496124_0125737 3300048927 Bacteria 2043
368 Ga0501034_0170549 3300049571 Bacteria 2143
369 Ga0501034_0369386 3300049571 Bacteria 1361
370 Ga0501036_0307614 3300049572 Bacteria 1325
371 Ga0501037_0170027 3300049573 Bacteria 1550
372 Ga0501038_0056220 3300049574 Bacteria 3379
373 Ga0501038_0520320 3300049574 Bacteria 908
374 Ga0501041_0010297 3300049577 Bacteria 5509
375 Ga0501041_0339496 3300049577 Bacteria 949
376 Ga0501042_0006634 3300049578 Bacteria 7536
377 Ga0501046_0106116 3300049580 Bacteria 2150
378 Ga0501047_0009922 3300049581 Bacteria 9004
379 Ga0501067_0000379 3300049583 Bacteria 24195
380 Ga0501067_0022086 3300049583 Bacteria 3521
381 Ga0501067_0036256 3300049583 Bacteria 2738
382 Ga0501067_0038976 3300049583 Bacteria 2638
383 Ga0501068_0004580 3300049584 Bacteria 7519
384 Ga0501068_0019442 3300049584 Bacteria 3945
385 Ga0501068_0053456 3300049584 Bacteria 2445
386 Ga0501068_0056826 3300049584 Bacteria 2372
387 Ga0501068_0077890 3300049584 Bacteria 2031
388 Ga0501069_0024143 3300049585 Bacteria 3317
389 Ga0501069_0025745 3300049585 Bacteria 3217
390 Ga0501069_0058110 3300049585 Bacteria 2157
391 Ga0501069_0066304 3300049585 Bacteria 2019
392 Ga0501069_0072535 3300049585 Bacteria 1930
393 Ga0501070_0000098 3300049586 Bacteria 75579
394 Ga0501070_0001381 3300049586 Bacteria 21726
395 Ga0501070_0246925 3300049586 Bacteria 1460
396 Ga0501071_0005175 3300049587 Bacteria 8357
397 Ga0501071_0067134 3300049587 Bacteria 2608
398 Ga0501072_0010925 3300049588 Bacteria 6925
399 Ga0501072_0024858 3300049588 Bacteria 4663
400 Ga0501072_0163595 3300049588 Bacteria 1775
401 Ga0501072_0287256 3300049588 Bacteria 1308
402 Ga0501073_0006235 3300049589 Bacteria 8895
403 Ga0501073_0015821 3300049589 Bacteria 5465
404 Ga0501074_0001228 3300049590 Bacteria 16909
405 Ga0501074_0004008 3300049590 Bacteria 10496
406 Ga0501074_0061209 3300049590 Bacteria 2712
407 Ga0501074_0418132 3300049590 Bacteria 951
408 Ga0501076_0258793 3300049592 Bacteria 1425
409 Ga0501077_0003488 3300049593 Bacteria 9440
410 Ga0501077_0010388 3300049593 Bacteria 5792
411 Ga0501079_0004194 3300049741 Bacteria 10687
412 Ga0501079_0143655 3300049741 Bacteria 1859
413 Ga0501079_0353441 3300049741 Bacteria 1151
414 Ga0501080_0001799 3300049742 Bacteria 18366
415 Ga0501080_0003449 3300049742 Bacteria 13955
416 Ga0501081_0337123 3300049743 Bacteria 1110
417 Ga0501083_0043273 3300049744 Bacteria 3051
418 Ga0501035_0388254 3300049822 Bacteria 1163
419 Ga0501044_0213935 3300049823 Bacteria 1881
420 Ga0501045_0018670 3300049824 Bacteria 4937
421 nmdc:mga03n38_22827_c1 3300050490 Bacteria 2538
422 nmdc:mga03n38_9693_c1 3300050490 Bacteria 3512
423 nmdc:mga00v17_128105_c1 3300050491 Bacteria 1621
424 nmdc:mga0yw44_149593_c1 3300050492 Bacteria 1522
425 nmdc:mga0yw44_1734_c1 3300050492 Bacteria 8864
426 nmdc:mga0yw44_23688_c1 3300050492 Bacteria 3463
427 nmdc:mga0yw44_37289_c1 3300050492 Bacteria 2870
428 nmdc:mga06z11_17514_c1 3300050494 Bacteria 3253
429 nmdc:mga06z11_87918_c1 3300050494 Bacteria 1682
430 nmdc:mga07m45_10113_c1 3300050496 Bacteria 4916
431 nmdc:mga07m45_107987_c1 3300050496 Bacteria 1601
432 nmdc:mga07m45_17834_c1 3300050496 Bacteria 3820
433 nmdc:mga07m45_270843_c1 3300050496 Bacteria 988
434 nmdc:mga09592_142128_c1 3300050508 Bacteria 2069
435 Ga0495619_0093805 3300053085 Bacteria 2035
436 Ga0495619_0160674 3300053085 Bacteria 1552
437 Ga0500644_0001735 3300053088 Bacteria 5656
438 Ga0500644_0106016 3300053088 Bacteria 1075
439 Ga0500641_0009630 3300053096 Bacteria 3475
440 Ga0500593_000238 3300053117 Bacteria 22609
441 Ga0500573_0000024 3300053140 Bacteria 151713
442 Ga0500573_0083909 3300053140 Bacteria 1808
443 Ga0501084_0002079 3300054114 Bacteria 15980
444 Ga0501084_0532174 3300054114 Bacteria 993
445 Ga0501082_0017541 3300060353 Bacteria 6166
446 Ga0501082_0174110 3300060353 Bacteria 1871
447 Ga0466962_0113529 3300061719 Bacteria 1305
448 Ga0530510_0048709 3300061734 Bacteria 3063
449 Ga0530510_0070800 3300061734 Bacteria 2531
450 Ga0530510_0156974 3300061734 Bacteria 1682
451 2586063067 2585427649 Bacteria 9053857
452 2587862113 2585428094 Bacteria 3604039
453 2643766961 2643221549 Bacteria 4042819
454 2643826553 2643221561 Bacteria 4984412
455 2643850056 2643221567 Bacteria 4163945
456 2643877276 2643221572 Bacteria 3614809
457 2644089245 2643221615 Bacteria 5487866
458 2644097190 2643221616 Bacteria 4066575
459 2644136058 2643221624 Bacteria 4384879
460 2644181662 2643221632 Bacteria 3406696
461 2644280076 2643221649 Bacteria 3867359
462 2644319090 2643221657 Bacteria 5490246
463 2644384331 2643221669 Bacteria 3611286
464 2644456355 2643221681 Bacteria 3707866
465 2644535590 2643221696 Bacteria 5431823
466 2644611801 2643221711 Bacteria 4865335
467 2795782932 2795385470 Bacteria 8317180
468 2808876164 2808606366 Bacteria 4415912
469 2808897668 2808606371 Bacteria 4251511
470 2808899706 2808606372 Bacteria 4649509
471 2809587807 2808606522 Bacteria 9488490
472 2819689600 2818991462 Bacteria 4320267
473 2819726846 2818991469 Bacteria 4644110
474 2857483445 2857481737 Bacteria 4761446
475 2862993891 2862993130 Bacteria 3860849
476 2891326954 2891326441 Bacteria 6439512
477 2895661914 2895660088 Bacteria 3782833
478 2897563596 2897561785 Bacteria 3256946
479 2919444480 2919443155 Bacteria 4072969
480 2946063908 2946059875 Bacteria 4386623
481 2984531830 2984527788 Bacteria 5288478
482 2984533081 2984532647 Bacteria 5288506
483 2984595259 2984592036 Bacteria 3670284
484 8004023918 8004021418 Bacteria 4313954
485 8004025632 8004025490 Bacteria 4327753
486 8004213765 8004212874 Bacteria 2861420
487 8047716410 8047710418 Bacteria 11023148
488 8054109070 8054107350 Bacteria 5022511
489 Ga0307405_10159166
490 JGI24737J22298_10093448
491 JGI25164J39214_1002982
492 JGI25152J39213_1000175
493 JGI25165J46597_1000005
494 rootL2_10166260
495 Ga0006562J51391_1033800
496 Ga0055539_1000060
497 Ga0055525_1001849
498 Ga0065714_10072940
499 Ga0065712_10033444
500 Ga0070676_10113058
501 Ga0070683_100003656
502 Ga0070683_100189811
503 Ga0070683_100218588
504 Ga0070690_100081203
505 Ga0068869_100013560
506 Ga0068869_100311614
507 Ga0070666_10151321
508 Ga0070682_100010825
509 Ga0068868_100054690
510 Ga0068868_100134988
511 Ga0068868_100218466
512 Ga0068868_100374241
513 Ga0070660_100074398
514 Ga0070689_100333624
515 Ga0070691_10102514
516 Ga0070692_10027379
517 Ga0070692_10183613
518 Ga0070668_100122967
519 Ga0070669_100103477
520 Ga0070675_100184626
521 Ga0070673_100102394
522 Ga0070659_100013701
523 Ga0070667_100387891
524 Ga0070700_100060913
525 Ga0070663_100024123
526 Ga0070678_100023208
527 Ga0070678_100365820
528 Ga0070678_100391994
529 Ga0068867_100396994
530 Ga0068867_100409998
531 Ga0070684_100021087
532 Ga0070684_100147650
533 Ga0070684_100700636
534 Ga0070665_100137393
535 Ga0070665_100288245
536 Ga0070665_100722345
537 Ga0070665_100779976
538 Ga0068855_100228002
539 Ga0070664_100077900
540 Ga0070664_100273195
541 Ga0068857_100006401
542 Ga0068857_100225959
543 Ga0068857_100311606
544 Ga0068854_100305434
545 Ga0068856_100168590
546 Ga0068856_100552238
547 Ga0070702_100014910
548 Ga0068852_100084968
549 Ga0068852_100129783
550 Ga0068852_100428772
551 Ga0068859_100186086
552 Ga0068864_100085645
553 Ga0068861_100824070
554 Ga0068851_10085588
555 Ga0068870_10155338
556 Ga0068860_100000555
557 Ga0081539_10066629
558 Ga0075365_10010898
559 Ga0075365_10058595
560 Ga0075365_10063231
561 Ga0075365_10120486
562 Ga0075368_10001134
563 Ga0075368_10026205
564 Ga0075363_100001118
565 Ga0075363_100017454
566 Ga0075363_100037494
567 Ga0075364_10042775
568 Ga0075364_10270544
569 Ga0075362_10007085
570 Ga0075367_10097445
571 Ga0097621_100120357
572 Ga0075370_10009784
573 Ga0075370_10129691
574 Ga0068871_100407949
575 Ga0075428_100875241
576 Ga0075434_100215940
577 Ga0075429_100487635
578 Ga0068865_100231593
579 Ga0068865_100332472
580 Ga0097620_100186094
581 Ga0105244_10022044
582 Ga0105244_10089981
583 Ga0111539_10448461
584 Ga0105245_10001722
585 Ga0105245_10032712
586 Ga0105245_10327094
587 Ga0105245_10602377
588 Ga0105247_10083044
589 Ga0105243_10106975
590 Ga0105243_10137785
591 Ga0105241_10704872
592 Ga0105242_10769034
593 Ga0105248_10031051
594 Ga0105248_10217329
595 Ga0105248_10470619
596 Ga0105237_10461718
597 Ga0105238_10433712
598 Ga0105238_10889505
599 Ga0105249_10385190
600 Ga0105239_10001349
601 Ga0105239_10020213
602 Ga0105246_10001504
603 Ga0157373_10093298
604 Ga0157370_10003550
605 Ga0157370_10097483
606 Ga0157370_10266466
607 Ga0157369_10016603
608 Ga0157369_10112448
609 Ga0157369_10150112
610 Ga0157369_10320183
611 Ga0157378_10011034
612 Ga0163162_10052068
613 Ga0163162_10065463
614 Ga0163162_10536789
615 Ga0163162_10957066
616 Ga0157372_10620742
617 Ga0157375_10087860
618 Ga0157375_10191569
619 Ga0157375_10194450
620 Ga0157375_10401455
621 Ga0157375_10417629
622 Ga0157375_10829708
623 Ga0157375_10999438
624 Ga0163163_10047424
625 Ga0163163_10667311
626 Ga0157380_10136730
627 Ga0157380_10236705
628 Ga0182008_10024863
629 Ga0182008_10116479
630 Ga0157379_10022693
631 Ga0157379_10716559
632 Ga0163161_10100093
633 Ga0163161_10179168
634 Ga0163161_10238689
635 Ga0213875_10128635
636 Ga0209563_101792
637 Ga0207427_100325
638 Ga0209437_100629
639 Ga0209129_1000220
640 Ga0209233_1000001
641 Ga0209025_1000586
642 Ga0207697_10012935
643 Ga0207682_10027471
644 Ga0207688_10018426
645 Ga0207688_10021216
646 Ga0207688_10100197
647 Ga0207680_10464483
648 Ga0207645_10055010
649 Ga0207657_10256587
650 Ga0207681_10084710
651 Ga0207687_10030561
652 Ga0207644_10047576
653 Ga0207690_10024959
654 Ga0207690_10047825
655 Ga0207706_10023472
656 Ga0207706_10257819
657 Ga0207709_10184333
658 Ga0207670_10148094
659 Ga0207670_10372375
660 Ga0207670_10506590
661 Ga0207704_10271857
662 Ga0207691_10112107
663 Ga0207711_10104885
664 Ga0207689_10013034
665 Ga0207689_10028852
666 Ga0207661_10017063
667 Ga0207661_10035445
668 Ga0207661_10192442
669 Ga0207661_10230578
670 Ga0207661_10246106
671 Ga0207679_10057505
672 Ga0207679_10321696
673 Ga0207667_10446159
674 Ga0207651_10226765
675 Ga0207712_10305805
676 Ga0207668_10041191
677 Ga0207668_10201966
678 Ga0207668_10207488
679 Ga0207668_10332626
680 Ga0207640_10198279
681 Ga0207658_10314739
682 Ga0207677_10060958
683 Ga0207677_10074807
684 Ga0207677_10132737
685 Ga0207677_10187815
686 Ga0207677_10227195
687 Ga0207703_10036238
688 Ga0207678_10015385
689 Ga0207678_10092706
690 Ga0207708_10050596
691 Ga0207708_10107593
692 Ga0207708_10531118
693 Ga0207702_10145956
694 Ga0207702_10237331
695 Ga0207702_10310715
696 Ga0207641_10083132
697 Ga0207676_10260231
698 Ga0207674_10105951
699 Ga0207674_10280372
700 Ga0207675_100002895
701 Ga0207683_10036101
702 Ga0207683_10297826
703 Ga0207683_10332456
704 Ga0207683_10347119
705 Ga0207683_10392261
706 Ga0207683_10393315
707 Ga0207698_10101217
708 Ga0268266_10003867
709 Ga0268264_10000264
710 Ga0268264_10182611
711 Ga0307513_10001824
712 Ga0307509_10232333
713 Ga0307413_10000499
714 Ga0307413_10376656
715 Ga0307518_10005947
716 Ga0307410_10039140
717 Ga0307410_10072928
718 Ga0307410_10437715
719 Ga0307406_10011434
720 Ga0307407_10082980
721 Ga0307407_10156036
722 Ga0307407_10303890
723 Ga0307412_10082112
724 Ga0307412_10161722
725 Ga0307409_100084606
726 Ga0307409_100100677
727 Ga0307409_100123153
728 Ga0307409_100325259
729 Ga0307409_100434079
730 Ga0307416_100069668
731 Ga0307416_100081700
732 Ga0307416_100410415
733 Ga0307415_100038261
734 Ga0307507_10006968
735 Ga0373931_0169401
736 Ga0395900_0045880
737 Ga0436364_0402084
738 Ga0395901_0162855
739 Ga0451791_1071581
740 Ga0451793_1146628
741 Ga0451797_1101593
742 Ga0451843_0835498
743 Ga0451853_0062399
744 Ga0466972_0027988
745 Ga0466965_0154777
746 Ga0466961_0279937
747 Ga0466963_0038643
748 Ga0466963_0055479
749 Ga0466963_0134753
750 Ga0466964_0011404
751 Ga0466964_0113823
752 Ga0466971_0024231
753 Ga0466970_0079304
754 Ga0466970_0289659
755 Ga0466957_0004240
756 Ga0466957_0089943
757 Ga0466957_0351648
758 Ga0466960_0008166
759 Ga0466960_0090074
760 Ga0466960_0098590
761 Ga0466959_0089337
762 Ga0466959_0152848
763 Ga0451576_0127313
764 Ga0466958_0022735
765 Ga0466958_0093229
766 Ga0466967_0067852
767 Ga0466967_0310600
768 Ga0466967_0353499
769 Ga0466967_0377691
770 Ga0466967_0475671
771 Ga0466967_0521494
772 Ga0495653_0041663
773 Ga0495664_0041498
774 Ga0495594_0109795
775 Ga0495631_0049194
776 Ga0495665_0050352
777 Ga0495586_0019411
778 Ga0495587_0077101
779 Ga0495645_0072092
780 Ga0495622_0091938
781 Ga0495667_0048555
782 Ga0495656_0051523
783 Ga0495668_0209305
784 Ga0495659_0033892
785 Ga0495588_0166573
786 Ga0495657_0181997
787 Ga0495581_0022084
788 Ga0495581_0071423
789 Ga0495636_0023413
790 Ga0495680_0209827
791 Ga0495680_0254427
792 Ga0495675_0014247
793 Ga0495593_0052792
794 Ga0496100_0025020
795 Ga0496100_0059176
796 Ga0496101_0120516
797 Ga0496101_0216154
798 Ga0496101_0217876
799 Ga0496102_0005529
800 Ga0496102_0032050
801 Ga0496102_0062155
802 Ga0496102_0080302
803 Ga0496102_0319178
804 Ga0496103_0008488
805 Ga0496103_0040015
806 Ga0496103_0076553
807 Ga0496103_0192144
808 Ga0496104_0012872
809 Ga0496104_0177163
810 Ga0496105_0018297
811 Ga0496105_0066872
812 Ga0496105_0137570
813 Ga0496105_0572454
814 Ga0496106_0015184
815 Ga0496106_0138862
816 Ga0496107_0009501
817 Ga0496108_0008746
818 Ga0496108_0027326
819 Ga0496108_0044652
820 Ga0496108_0242448
821 Ga0496108_0315950
822 Ga0496108_0415977
823 Ga0496109_0000476
824 Ga0496109_0007054
825 Ga0496109_0017272
826 Ga0496109_0020917
827 Ga0496109_0063747
828 Ga0496109_0247510
829 Ga0496109_0297915
830 Ga0496109_0534696
831 Ga0496110_0013914
832 Ga0496110_0085367
833 Ga0496110_0128496
834 Ga0496110_0129526
835 Ga0496110_0167481
836 Ga0496111_0023984
837 Ga0496111_0043468
838 Ga0496111_0154725
839 Ga0496111_0307830
840 Ga0496112_0042685
841 Ga0496112_0089957
842 Ga0496112_0147106
843 Ga0496113_0045306
844 Ga0496113_0106329
845 Ga0496113_0107122
846 Ga0496114_0010626
847 Ga0496114_0012696
848 Ga0496114_0020019
849 Ga0496114_0047175
850 Ga0496114_0161030
851 Ga0496114_0177205
852 Ga0496115_0117668
853 Ga0496115_0555605
854 Ga0496122_0238869
855 Ga0496124_0125737
856 Ga0501034_0170549
857 Ga0501034_0369386
858 Ga0501036_0307614
859 Ga0501037_0170027
860 Ga0501038_0056220
861 Ga0501038_0520320
862 Ga0501041_0010297
863 Ga0501041_0339496
864 Ga0501042_0006634
865 Ga0501046_0106116
866 Ga0501047_0009922
867 Ga0501067_0000379
868 Ga0501067_0022086
869 Ga0501067_0036256
870 Ga0501067_0038976
871 Ga0501068_0004580
872 Ga0501068_0019442
873 Ga0501068_0053456
874 Ga0501068_0056826
875 Ga0501068_0077890
876 Ga0501069_0024143
877 Ga0501069_0025745
878 Ga0501069_0058110
879 Ga0501069_0066304
880 Ga0501069_0072535
881 Ga0501070_0000098
882 Ga0501070_0001381
883 Ga0501070_0246925
884 Ga0501071_0005175
885 Ga0501071_0067134
886 Ga0501072_0010925
887 Ga0501072_0024858
888 Ga0501072_0163595
889 Ga0501072_0287256
890 Ga0501073_0006235
891 Ga0501073_0015821
892 Ga0501074_0001228
893 Ga0501074_0004008
894 Ga0501074_0061209
895 Ga0501074_0418132
896 Ga0501076_0258793
897 Ga0501077_0003488
898 Ga0501077_0010388
899 Ga0501079_0004194
900 Ga0501079_0143655
901 Ga0501079_0353441
902 Ga0501080_0001799
903 Ga0501080_0003449
904 Ga0501081_0337123
905 Ga0501083_0043273
906 Ga0501035_0388254
907 Ga0501044_0213935
908 Ga0501045_0018670
909 nmdc:mga03n38_22827_c1
910 nmdc:mga03n38_9693_c1
911 nmdc:mga00v17_128105_c1
912 nmdc:mga0yw44_149593_c1
913 nmdc:mga0yw44_1734_c1
914 nmdc:mga0yw44_23688_c1
915 nmdc:mga0yw44_37289_c1
916 nmdc:mga06z11_17514_c1
917 nmdc:mga06z11_87918_c1
918 nmdc:mga07m45_10113_c1
919 nmdc:mga07m45_107987_c1
920 nmdc:mga07m45_17834_c1
921 nmdc:mga07m45_270843_c1
922 nmdc:mga09592_142128_c1
923 Ga0495619_0093805
924 Ga0495619_0160674
925 Ga0500644_0001735
926 Ga0500644_0106016
927 Ga0500641_0009630
928 Ga0500593_000238
929 Ga0500573_0000024
930 Ga0500573_0083909
931 Ga0501084_0002079
932 Ga0501084_0532174
933 Ga0501082_0017541
934 Ga0501082_0174110
935 Ga0466962_0113529
936 Ga0530510_0048709
937 Ga0530510_0070800
938 Ga0530510_0156974
939 2586063067
940 2587862113
941 2643766961
942 2643826553
943 2643850056
944 2643877276
945 2644089245
946 2644097190
947 2644136058
948 2644181662
949 2644280076
950 2644319090
951 2644384331
952 2644456355
953 2644535590
954 2644611801
955 2795782932
956 2808876164
957 2808897668
958 2808899706
959 2809587807
960 2819689600
961 2819726846
962 2857483445
963 2862993891
964 2891326954
965 2895661914
966 2897563596
967 2919444480
968 2946063908
969 2984531830
970 2984533081
971 2984595259
972 8004023918
973 8004025632
974 8004213765
975 8047716410
976 8054109070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

34

269

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mg4-assembly4.cif.gz_D crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9354 7 239
4mg4-assembly2.cif.gz_F crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9309 5 239
2ze3-assembly1.cif.gz_A-2 crystal structure of dfa0005 complexed with alpha-ketoglutarate: a novel member of the icl/pepm superfamily from alkali-tolerant deinococcus ficus 0.9138 1 247
4mg4-assembly1.cif.gz_H crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9028 7 239
4mg4-assembly1.cif.gz_A crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.8968 4 248
ID Description Score Start End Superfamily
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9071 1 226 3.20.20.60
af_P9WLN9_1_257_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8973 10 255 3.20.20.60
2qiwB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8967 3 226 3.20.20.60
4mg4B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8959 4 248 3.20.20.60
af_Q8GYI4_58_362_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8926 7 256 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A4Q2J8J3-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 1.001 4 144 GO:0016829
AF-A0A8B0KQ40-F1-model_v4 deleted 0.9917 3 258
AF-A0A6I2F2R0-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9905 2 258 GO:0016829
AF-A0A849IS66-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9889 2 251 GO:0016829
AF-H8GW64-F1-model_v4 Putative transferase 0.9874 30 258 GO:0016740

Map