F453566

General Info

Members Datasets Scaffolds Average Seq Length
488 254 976 156

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100710424|Ga0070707_1007104242
Length 172
Sequence LLSPERVDTFLQNMRNDPRKISQTPGYPEVSAPGRRSFLDYLLGSTALATLGAIIYPIFRFMSPPPVIESGESSVVAAKLSEIPVNSGKIFKFGNKPGILVRTATGEFKAFSAVCTHLECIVQYRTETKQIWCACHNGQYNLSGKNVGGPPPRPLEEFKVNTRGDDVVVSKT

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
193 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
194 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
195 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
204 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
205 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
206 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
207 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
208 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
209 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
210 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
211 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
212 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
213 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
214 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
215 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
216 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
217 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
218 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
219 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
220 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
221 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
222 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
223 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
224 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
225 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
226 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
227 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
228 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
229 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
230 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
234 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
235 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
236 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
237 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
238 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049849 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought Metagenome Rhizosphere
241 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
242 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.61
Rhizosphere 99.18
Stem 0
Stem Tuber 0
Unclassified 30.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100710424 3300005468 Unclassified 968
2 SwRhRL2b_contig_2170169 2162886007 Unclassified 907
3 MBSR1b_contig_9057675 2162886012 Bacteria 881
4 JGI24034J14986_102154 3300001432 Unclassified 1044
5 JGI24748J21848_1000024 3300002074 Bacteria 105887
6 JGI24034J26672_10000027 3300002239 Bacteria 105887
7 Ga0065704_10107535 3300005289 Unclassified 2053
8 Ga0065712_10068103 3300005290 Bacteria 14654
9 Ga0065715_10105146 3300005293 Bacteria 2912
10 Ga0065715_10372847 3300005293 Bacteria 918
11 Ga0065707_10090224 3300005295 Bacteria 4185
12 Ga0065707_10182246 3300005295 Archaea 1405
13 Ga0065707_10219491 3300005295 Bacteria 1231
14 Ga0065707_10468724 3300005295 Bacteria 776
15 Ga0070690_100000369 3300005330 Bacteria 22998
16 Ga0070690_100379653 3300005330 Bacteria 1033
17 Ga0070690_100454759 3300005330 Bacteria 950
18 Ga0070670_100286707 3300005331 Bacteria 1438
19 Ga0068869_100064589 3300005334 Bacteria 2693
20 Ga0068869_100093869 3300005334 Bacteria 2261
21 Ga0068869_100288581 3300005334 Bacteria 1321
22 Ga0070666_10127214 3300005335 Bacteria 1769
23 Ga0070666_10462070 3300005335 Bacteria 917
24 Ga0070680_100092362 3300005336 Bacteria 2506
25 Ga0070680_100108150 3300005336 Bacteria 2313
26 Ga0068868_100071490 3300005338 Bacteria 2767
27 Ga0068868_100145383 3300005338 Bacteria 1949
28 Ga0070660_100100218 3300005339 Bacteria 2294
29 Ga0070689_100137176 3300005340 Unclassified 1965
30 Ga0070689_100463398 3300005340 Bacteria 1080
31 Ga0070687_100038008 3300005343 Bacteria 2410
32 Ga0070687_100069632 3300005343 Bacteria 1885
33 Ga0070692_10001489 3300005345 Bacteria 8549
34 Ga0070692_10061392 3300005345 Bacteria 1981
35 Ga0070692_10110209 3300005345 Bacteria 1521
36 Ga0070692_10192469 3300005345 Bacteria 1189
37 Ga0070692_11002894 3300005345 Unclassified 584
38 Ga0070669_100016926 3300005353 Bacteria 5205
39 Ga0070669_100367218 3300005353 Bacteria 1171
40 Ga0070675_100000026 3300005354 Bacteria 113553
41 Ga0070671_100133955 3300005355 Bacteria 2088
42 Ga0070671_101044443 3300005355 Bacteria 717
43 Ga0070673_100071082 3300005364 Bacteria 2795
44 Ga0070673_100085951 3300005364 Unclassified 2562
45 Ga0070673_100672161 3300005364 Unclassified 949
46 Ga0070673_101512585 3300005364 Unclassified 633
47 Ga0070688_100355111 3300005365 Bacteria 1074
48 Ga0070659_100001303 3300005366 Bacteria 18095
49 Ga0070659_101086054 3300005366 Bacteria 705
50 Ga0070703_10000231 3300005406 Bacteria 27002
51 Ga0070709_10253864 3300005434 Bacteria 1268
52 Ga0070709_10507889 3300005434 Bacteria 917
53 Ga0070709_10546320 3300005434 Unclassified 886
54 Ga0070710_10007297 3300005437 Bacteria 5349
55 Ga0070710_11109500 3300005437 Bacteria 581
56 Ga0070701_10000269 3300005438 Bacteria 16962
57 Ga0070711_100530538 3300005439 Bacteria 974
58 Ga0070700_100000020 3300005441 Bacteria 135275
59 Ga0070700_100006163 3300005441 Bacteria 6391
60 Ga0070700_100009074 3300005441 Bacteria 5451
61 Ga0070700_100062341 3300005441 Bacteria 2355
62 Ga0070694_100012760 3300005444 Bacteria 5234
63 Ga0070694_100070883 3300005444 Unclassified 2401
64 Ga0070694_100077018 3300005444 Bacteria 2310
65 Ga0070694_100089775 3300005444 Bacteria 2154
66 Ga0070694_100132628 3300005444 Bacteria 1801
67 Ga0070694_100571800 3300005444 Bacteria 907
68 Ga0070708_100002369 3300005445 Bacteria 14590
69 Ga0070708_100016815 3300005445 Bacteria 6081
70 Ga0070662_100140607 3300005457 Unclassified 1870
71 Ga0070662_100333061 3300005457 Bacteria 1240
72 Ga0070681_10001426 3300005458 Bacteria 21041
73 Ga0068867_100033499 3300005459 Unclassified 3721
74 Ga0068867_100579152 3300005459 Unclassified 976
75 Ga0068867_100703973 3300005459 Bacteria 892
76 Ga0070707_100202498 3300005468 Bacteria 1935
77 Ga0070707_100645653 3300005468 Bacteria 1021
78 Ga0070698_100001774 3300005471 Bacteria 24062
79 Ga0070698_100163437 3300005471 Unclassified 2169
80 Ga0070698_100211276 3300005471 Bacteria 1875
81 Ga0070698_100480667 3300005471 Bacteria 1179
82 Ga0070698_100592625 3300005471 Bacteria 1049
83 Ga0070679_100011940 3300005530 Bacteria 8293
84 Ga0070684_101297268 3300005535 Unclassified 685
85 Ga0070697_100113250 3300005536 Bacteria 2263
86 Ga0068853_100027469 3300005539 Unclassified 4780
87 Ga0068853_100102127 3300005539 Bacteria 2537
88 Ga0068853_100864023 3300005539 Unclassified 868
89 Ga0070686_100003473 3300005544 Bacteria 8639
90 Ga0070686_100152210 3300005544 Bacteria 1621
91 Ga0070686_100163785 3300005544 Bacteria 1568
92 Ga0070686_100658888 3300005544 Unclassified 831
93 Ga0070686_100668963 3300005544 Unclassified 825
94 Ga0070686_101265008 3300005544 Bacteria 615
95 Ga0070686_101318704 3300005544 Unclassified 603
96 Ga0070695_100067553 3300005545 Bacteria 2332
97 Ga0070695_100081499 3300005545 Unclassified 2141
98 Ga0070695_100133874 3300005545 Bacteria 1711
99 Ga0070695_100319585 3300005545 Bacteria 1153
100 Ga0070695_100324865 3300005545 Unclassified 1145
101 Ga0070695_100644548 3300005545 Unclassified 836
102 Ga0070695_101122265 3300005545 Unclassified 644
103 Ga0070696_100113035 3300005546 Bacteria 1957
104 Ga0070696_100447928 3300005546 Unclassified 1018
105 Ga0070693_100780216 3300005547 Unclassified 707
106 Ga0070704_100033478 3300005549 Unclassified 3475
107 Ga0070704_100230759 3300005549 Unclassified 1510
108 Ga0070704_100381512 3300005549 Bacteria 1198
109 Ga0070704_100656755 3300005549 Unclassified 926
110 Ga0070704_101117686 3300005549 Bacteria 716
111 Ga0070704_101482090 3300005549 Bacteria 624
112 Ga0070704_101591976 3300005549 Bacteria 602
113 Ga0068855_101554573 3300005563 Bacteria 678
114 Ga0070664_100001817 3300005564 Bacteria 17106
115 Ga0068857_100000678 3300005577 Bacteria 25267
116 Ga0068857_100173784 3300005577 Bacteria 1959
117 Ga0068857_100356654 3300005577 Bacteria 1355
118 Ga0068854_100057068 3300005578 Unclassified 2816
119 Ga0068854_100124419 3300005578 Unclassified 1962
120 Ga0070702_100182613 3300005615 Bacteria 1374
121 Ga0068852_100503951 3300005616 Bacteria 1206
122 Ga0068859_100002243 3300005617 Bacteria 19603
123 Ga0068859_100156492 3300005617 Bacteria 2356
124 Ga0068859_100303565 3300005617 Unclassified 1690
125 Ga0068859_100944947 3300005617 Unclassified 946
126 Ga0068859_100955752 3300005617 Unclassified 940
127 Ga0068864_100023337 3300005618 Bacteria 5194
128 Ga0068864_100049820 3300005618 Bacteria 3604
129 Ga0068864_100140736 3300005618 Unclassified 2176
130 Ga0068866_10003044 3300005718 Bacteria 6918
131 Ga0068861_100182193 3300005719 Bacteria 1749
132 Ga0068861_100197753 3300005719 Bacteria 1685
133 Ga0068861_100328886 3300005719 Bacteria 1333
134 Ga0068861_100539318 3300005719 Unclassified 1061
135 Ga0068861_101112474 3300005719 Unclassified 760
136 Ga0068870_10002242 3300005840 Bacteria 8032
137 Ga0068870_10089733 3300005840 Bacteria 1716
138 Ga0068863_100344302 3300005841 Bacteria 1451
139 Ga0068863_101325148 3300005841 Bacteria 727
140 Ga0068858_100000077 3300005842 Bacteria 103156
141 Ga0068858_100037486 3300005842 Unclassified 4497
142 Ga0068858_100118380 3300005842 Bacteria 2476
143 Ga0068858_100599159 3300005842 Bacteria 1069
144 Ga0068860_100086115 3300005843 Bacteria 2990
145 Ga0068860_101235412 3300005843 Unclassified 768
146 Ga0068862_100007079 3300005844 Bacteria 9314
147 Ga0068862_101125217 3300005844 Bacteria 781
148 Ga0068862_102128623 3300005844 Unclassified 572
149 Ga0070717_11446077 3300006028 Bacteria 624
150 Ga0070716_100038252 3300006173 Unclassified 2656
151 Ga0070716_100054886 3300006173 Bacteria 2278
152 Ga0068871_100296062 3300006358 Bacteria 1419
153 Ga0068871_101089203 3300006358 Unclassified 747
154 Ga0075428_100053661 3300006844 Bacteria 4417
155 Ga0075428_100055929 3300006844 Unclassified 4322
156 Ga0075428_100514529 3300006844 Bacteria 1280
157 Ga0075430_100019970 3300006846 Bacteria 5701
158 Ga0075430_101162465 3300006846 Unclassified 635
159 Ga0075431_100124673 3300006847 Unclassified 2658
160 Ga0075431_100377091 3300006847 Unclassified 1423
161 Ga0075434_100280751 3300006871 Unclassified 1685
162 Ga0075434_100708235 3300006871 Unclassified 1024
163 Ga0075434_100904158 3300006871 Bacteria 898
164 Ga0075429_100026609 3300006880 Bacteria 5024
165 Ga0075429_100289984 3300006880 Bacteria 1433
166 Ga0075429_100734011 3300006880 Unclassified 865
167 Ga0068865_100389130 3300006881 Bacteria 1139
168 Ga0075436_100000007 3300006914 Bacteria 288785
169 Ga0097620_100002243 3300006931 Bacteria 19603
170 Ga0097620_100156491 3300006931 Bacteria 2356
171 Ga0097620_100303533 3300006931 Unclassified 1690
172 Ga0097620_100945019 3300006931 Unclassified 946
173 Ga0097620_100955730 3300006931 Unclassified 940
174 Ga0075435_100000082 3300007076 Bacteria 50118
175 Ga0075435_100000993 3300007076 Bacteria 17979
176 Ga0075435_100002951 3300007076 Bacteria 11439
177 Ga0105244_10023304 3300009036 Unclassified 3394
178 Ga0105240_11268056 3300009093 Unclassified 778
179 Ga0111539_10006410 3300009094 Bacteria 15174
180 Ga0105245_10151406 3300009098 Bacteria 2194
181 Ga0105245_10669016 3300009098 Unclassified 1069
182 Ga0105245_11345018 3300009098 Unclassified 764
183 Ga0105247_10000015 3300009101 Bacteria 277224
184 Ga0114129_10015444 3300009147 Bacteria 10862
185 Ga0114129_10122540 3300009147 Unclassified 3577
186 Ga0105243_10001965 3300009148 Bacteria 17515
187 Ga0105243_10286025 3300009148 Bacteria 1487
188 Ga0105243_11398837 3300009148 Unclassified 720
189 Ga0105241_10044426 3300009174 Unclassified 3367
190 Ga0105241_10161999 3300009174 Unclassified 1840
191 Ga0105241_10180046 3300009174 Unclassified 1753
192 Ga0105241_10432804 3300009174 Bacteria 1160
193 Ga0105241_10545844 3300009174 Unclassified 1040
194 Ga0105242_10001809 3300009176 Bacteria 16853
195 Ga0105242_10003529 3300009176 Bacteria 12159
196 Ga0105242_10149340 3300009176 Unclassified 2036
197 Ga0105242_11071243 3300009176 Unclassified 818
198 Ga0105242_13014193 3300009176 Unclassified 521
199 Ga0105248_10128287 3300009177 Bacteria 2861
200 Ga0105248_10218920 3300009177 Bacteria 2144
201 Ga0105248_10805326 3300009177 Unclassified 1060
202 Ga0105248_11090252 3300009177 Bacteria 902
203 Ga0105248_11520966 3300009177 Bacteria 758
204 Ga0105237_10345645 3300009545 Unclassified 1492
205 Ga0105249_10019271 3300009553 Bacteria 6084
206 Ga0105249_10128496 3300009553 Bacteria 2416
207 Ga0105249_10209336 3300009553 Bacteria 1913
208 Ga0105249_10249995 3300009553 Bacteria 1757
209 Ga0105239_10300121 3300010375 Bacteria 1809
210 Ga0105246_11766707 3300011119 Unclassified 590
211 Ga0157374_10182498 3300013296 Bacteria 2050
212 Ga0157378_10004080 3300013297 Bacteria 12904
213 Ga0157378_10035573 3300013297 Unclassified 4406
214 Ga0157378_10064385 3300013297 Bacteria 3280
215 Ga0157378_10067504 3300013297 Bacteria 3205
216 Ga0157378_10067913 3300013297 Bacteria 3196
217 Ga0157378_10165970 3300013297 Unclassified 2068
218 Ga0157378_10204160 3300013297 Bacteria 1871
219 Ga0157378_10283076 3300013297 Unclassified 1599
220 Ga0163162_10012439 3300013306 Bacteria 8314
221 Ga0163162_10219773 3300013306 Bacteria 2030
222 Ga0157372_10245955 3300013307 Bacteria 2076
223 Ga0157372_12053813 3300013307 Unclassified 657
224 Ga0157375_10000623 3300013308 Bacteria 31448
225 Ga0157375_10521725 3300013308 Bacteria 1351
226 Ga0157375_12639468 3300013308 Unclassified 600
227 Ga0163163_10000302 3300014325 Bacteria 48452
228 Ga0163163_10005223 3300014325 Bacteria 11200
229 Ga0157380_10260046 3300014326 Bacteria 1576
230 Ga0157380_11775944 3300014326 Unclassified 675
231 Ga0157377_10000060 3300014745 Bacteria 82791
232 Ga0163161_10018634 3300017792 Unclassified 4865
233 Ga0163161_10018954 3300017792 Bacteria 4823
234 Ga0163161_10829799 3300017792 Unclassified 779
235 Ga0163161_10935832 3300017792 Unclassified 736
236 Ga0207672_1000048 3300025223 Bacteria 15719
237 Ga0207655_1020597 3300025728 Unclassified 3382
238 Ga0207653_10000315 3300025885 Bacteria 27054
239 Ga0207692_10041534 3300025898 Bacteria 2278
240 Ga0207642_10029396 3300025899 Unclassified 2275
241 Ga0207710_10000004 3300025900 Bacteria 846540
242 Ga0207699_10502903 3300025906 Unclassified 875
243 Ga0207699_10573795 3300025906 Bacteria 820
244 Ga0207645_10369681 3300025907 Bacteria 961
245 Ga0207643_10009571 3300025908 Bacteria 5206
246 Ga0207643_10644553 3300025908 Bacteria 683
247 Ga0207684_10485537 3300025910 Bacteria 1059
248 Ga0207654_10280335 3300025911 Bacteria 1127
249 Ga0207654_10336783 3300025911 Bacteria 1035
250 Ga0207707_10005108 3300025912 Bacteria 11509
251 Ga0207663_10394657 3300025916 Bacteria 1057
252 Ga0207663_10608057 3300025916 Unclassified 859
253 Ga0207660_10018552 3300025917 Unclassified 4639
254 Ga0207660_10100483 3300025917 Bacteria 2160
255 Ga0207660_10390228 3300025917 Bacteria 1120
256 Ga0207660_10766685 3300025917 Bacteria 787
257 Ga0207662_10089081 3300025918 Unclassified 1895
258 Ga0207662_10247669 3300025918 Bacteria 1168
259 Ga0207662_10391638 3300025918 Bacteria 940
260 Ga0207662_10465684 3300025918 Unclassified 866
261 Ga0207657_10108018 3300025919 Bacteria 2301
262 Ga0207652_10014321 3300025921 Bacteria 6421
263 Ga0207646_10021228 3300025922 Bacteria 6003
264 Ga0207646_10807614 3300025922 Unclassified 835
265 Ga0207681_10005268 3300025923 Bacteria 7943
266 Ga0207650_10063606 3300025925 Unclassified 2759
267 Ga0207659_10000002 3300025926 Bacteria 619441
268 Ga0207687_10200314 3300025927 Unclassified 1560
269 Ga0207687_11039872 3300025927 Bacteria 703
270 Ga0207644_10000188 3300025931 Bacteria 44565
271 Ga0207644_10756893 3300025931 Bacteria 812
272 Ga0207690_10005586 3300025932 Bacteria 7429
273 Ga0207706_10148463 3300025933 Bacteria 2062
274 Ga0207686_10000104 3300025934 Bacteria 69026
275 Ga0207686_10003210 3300025934 Bacteria 8794
276 Ga0207686_10088753 3300025934 Unclassified 2036
277 Ga0207686_10604355 3300025934 Bacteria 863
278 Ga0207686_10679532 3300025934 Bacteria 817
279 Ga0207709_10001317 3300025935 Bacteria 17605
280 Ga0207709_10356437 3300025935 Bacteria 1106
281 Ga0207670_10423379 3300025936 Bacteria 1069
282 Ga0207669_10755911 3300025937 Unclassified 803
283 Ga0207704_10031497 3300025938 Unclassified 2989
284 Ga0207665_10008555 3300025939 Bacteria 6735
285 Ga0207665_10013629 3300025939 Bacteria 5348
286 Ga0207691_10192648 3300025940 Bacteria 1777
287 Ga0207691_10805455 3300025940 Bacteria 789
288 Ga0207711_10302912 3300025941 Bacteria 1474
289 Ga0207689_10026565 3300025942 Unclassified 4850
290 Ga0207689_10100395 3300025942 Bacteria 2377
291 Ga0207689_10264780 3300025942 Bacteria 1422
292 Ga0207679_10002107 3300025945 Bacteria 12350
293 Ga0207651_10178263 3300025960 Bacteria 1683
294 Ga0207651_10340206 3300025960 Unclassified 1260
295 Ga0207712_10004294 3300025961 Bacteria 8998
296 Ga0207712_10209590 3300025961 Bacteria 1551
297 Ga0207640_10226582 3300025981 Bacteria 1435
298 Ga0207677_10039980 3300026023 Bacteria 3088
299 Ga0207677_10115927 3300026023 Bacteria 2005
300 Ga0207677_11093767 3300026023 Bacteria 726
301 Ga0207703_10000043 3300026035 Bacteria 161047
302 Ga0207703_10163198 3300026035 Bacteria 1953
303 Ga0207703_10520197 3300026035 Bacteria 1119
304 Ga0207703_10978179 3300026035 Unclassified 812
305 Ga0207703_11037770 3300026035 Unclassified 787
306 Ga0207639_10022277 3300026041 Unclassified 4562
307 Ga0207639_10083092 3300026041 Bacteria 2541
308 Ga0207708_10000021 3300026075 Bacteria 186005
309 Ga0207708_10001177 3300026075 Bacteria 19693
310 Ga0207708_10009681 3300026075 Bacteria 7149
311 Ga0207708_10093262 3300026075 Unclassified 2324
312 Ga0207708_10145953 3300026075 Bacteria 1859
313 Ga0207708_10342267 3300026075 Unclassified 1225
314 Ga0207641_11113011 3300026088 Unclassified 788
315 Ga0207641_11266924 3300026088 Bacteria 737
316 Ga0207641_12235833 3300026088 Bacteria 547
317 Ga0207648_10038022 3300026089 Unclassified 4236
318 Ga0207648_10171403 3300026089 Bacteria 1918
319 Ga0207648_10187858 3300026089 Unclassified 1830
320 Ga0207676_10038951 3300026095 Bacteria 3632
321 Ga0207676_10170776 3300026095 Bacteria 1894
322 Ga0207676_10186388 3300026095 Bacteria 1822
323 Ga0207676_10315903 3300026095 Bacteria 1432
324 Ga0207676_10391197 3300026095 Bacteria 1297
325 Ga0207674_10000469 3300026116 Bacteria 52895
326 Ga0207674_10062162 3300026116 Unclassified 3772
327 Ga0207674_10187936 3300026116 Unclassified 2016
328 Ga0207675_100010406 3300026118 Bacteria 8715
329 Ga0207675_100069111 3300026118 Bacteria 3301
330 Ga0207675_100147540 3300026118 Bacteria 2237
331 Ga0207675_100246960 3300026118 Bacteria 1726
332 Ga0207683_10432976 3300026121 Bacteria 1212
333 Ga0207428_10006668 3300027907 Bacteria 10603
334 Ga0207428_10111592 3300027907 Unclassified 2104
335 Ga0268265_10324534 3300028380 Unclassified 1396
336 Ga0268265_10470360 3300028380 Unclassified 1178
337 Ga0268265_10491256 3300028380 Bacteria 1155
338 Ga0268264_10067083 3300028381 Bacteria 3028
339 Ga0268264_10489876 3300028381 Unclassified 1197
340 Ga0268264_12410100 3300028381 Bacteria 532
341 Ga0265316_10304631 3300031344 Bacteria 1160
342 Ga0307408_100012814 3300031548 Bacteria 5560
343 Ga0307408_101339820 3300031548 Bacteria 672
344 Ga0265314_10417164 3300031711 Unclassified 722
345 Ga0307405_10300413 3300031731 Bacteria 1218
346 Ga0307413_10087538 3300031824 Bacteria 2018
347 Ga0307410_10120312 3300031852 Bacteria 1914
348 Ga0307410_10331519 3300031852 Bacteria 1210
349 Ga0307406_10007781 3300031901 Bacteria 5957
350 Ga0307407_10008317 3300031903 Bacteria 4755
351 Ga0307412_10152885 3300031911 Bacteria 1705
352 Ga0307409_100196377 3300031995 Bacteria 1801
353 Ga0307416_100005363 3300032002 Bacteria 7870
354 Ga0307416_100088008 3300032002 Bacteria 2654
355 Ga0307416_101232807 3300032002 Unclassified 854
356 Ga0307411_11655111 3300032005 Unclassified 591
357 Ga0307415_100003348 3300032126 Bacteria 8139
358 Ga0373929_0019482 3300035085 Bacteria 1359
359 Ga0373951_0099916 3300035091 Unclassified 770
360 Ga0373932_0049483 3300035112 Archaea 1242
361 Ga0373932_0213377 3300035112 Bacteria 691
362 Ga0373941_0078597 3300035115 Unclassified 1110
363 Ga0373960_0220988 3300035121 Unclassified 678
364 Ga0373943_0011993 3300035170 Bacteria 3901
365 Ga0316574_0019296 3300035398 Unclassified 4020
366 Ga0373931_0050812 3300035691 Bacteria 2207
367 Ga0373927_0016790 3300035695 Bacteria 4828
368 Ga0316582_0352787 3300036647 Bacteria 1012
369 Ga0395905_0008292 3300037471 Bacteria 10254
370 Ga0395901_0822541 3300038443 Bacteria 916
371 Ga0436363_1398227 3300039450 Bacteria 1696
372 Ga0439435_0153135 3300042436 Unclassified 741
373 Ga0451577_0004745 3300042876 Bacteria 14227
374 Ga0451577_0233072 3300042876 Bacteria 1665
375 Ga0453683_0004110 3300044673 Bacteria 10456
376 Ga0453683_0082543 3300044673 Bacteria 2014
377 Ga0453683_0659880 3300044673 Bacteria 684
378 Ga0453684_1214959 3300044712 Unclassified 791
379 Ga0451576_0090794 3300045051 Bacteria 3177
380 Ga0451576_0273292 3300045051 Bacteria 1767
381 Ga0451576_0597633 3300045051 Bacteria 1160
382 Ga0495603_0464719 3300046455 Unclassified 725
383 Ga0495618_0443249 3300046514 Unclassified 789
384 Ga0495630_0204433 3300046517 Bacteria 1507
385 Ga0495652_0885637 3300046529 Unclassified 590
386 Ga0495621_0095225 3300046539 Bacteria 1127
387 Ga0495634_0194659 3300046642 Bacteria 1262
388 Ga0495635_0032238 3300046663 Unclassified 3636
389 Ga0495658_0652518 3300046683 Unclassified 674
390 Ga0495684_0462942 3300047471 Unclassified 879
391 Ga0496100_0146655 3300048903 Bacteria 1679
392 Ga0496101_0824879 3300048904 Bacteria 731
393 Ga0496106_0014664 3300048909 Bacteria 5793
394 Ga0501291_045884 3300049514 Unclassified 782
395 Ga0501295_136474 3300049518 Bacteria 598
396 Ga0501296_011629 3300049519 Bacteria 1055
397 Ga0501298_005309 3300049521 Bacteria 2061
398 Ga0501036_0481511 3300049572 Bacteria 1033
399 Ga0501036_0518218 3300049572 Unclassified 992
400 Ga0501040_0007829 3300049576 Bacteria 6922
401 Ga0501042_0120461 3300049578 Unclassified 1889
402 Ga0501046_0084444 3300049580 Bacteria 2449
403 Ga0501046_0242580 3300049580 Bacteria 1329
404 Ga0501048_0081877 3300049582 Bacteria 2277
405 Ga0501075_0542257 3300049591 Unclassified 888
406 Ga0501076_0043981 3300049592 Bacteria 3521
407 Ga0501198_000654 3300049649 Bacteria 4305
408 Ga0501198_001222 3300049649 Bacteria 3312
409 Ga0501202_014833 3300049652 Bacteria 1494
410 Ga0501206_002131 3300049653 Unclassified 2499
411 Ga0501207_000480 3300049654 Bacteria 4499
412 Ga0501209_053638 3300049656 Bacteria 1107
413 Ga0501210_003069 3300049657 Unclassified 1077
414 Ga0501216_003730 3300049660 Bacteria 2237
415 Ga0501217_000179 3300049661 Bacteria 9307
416 Ga0501217_026583 3300049661 Bacteria 1399
417 Ga0501223_000789 3300049663 Bacteria 7503
418 Ga0501223_013413 3300049663 Unclassified 1632
419 Ga0501224_004081 3300049664 Bacteria 2059
420 Ga0501228_005276 3300049666 Bacteria 1141
421 Ga0501228_023349 3300049666 Unclassified 714
422 Ga0501230_057630 3300049667 Bacteria 782
423 Ga0501230_155771 3300049667 Unclassified 520
424 Ga0501233_000771 3300049668 Bacteria 5340
425 Ga0501233_045415 3300049668 Bacteria 1047
426 Ga0501235_001647 3300049669 Bacteria 4787
427 Ga0501235_008363 3300049669 Bacteria 2258
428 Ga0501235_009981 3300049669 Unclassified 2076
429 Ga0501240_100253 3300049673 Unclassified 556
430 Ga0501242_063687 3300049674 Bacteria 565
431 Ga0501243_009630 3300049675 Bacteria 1502
432 Ga0501243_031665 3300049675 Unclassified 905
433 Ga0501249_055916 3300049679 Bacteria 910
434 Ga0501251_015182 3300049681 Unclassified 965
435 Ga0501252_009575 3300049682 Bacteria 1132
436 Ga0501253_024665 3300049683 Bacteria 1093
437 Ga0501257_003236 3300049686 Bacteria 3478
438 Ga0501257_055932 3300049686 Bacteria 991
439 Ga0501259_022550 3300049688 Bacteria 1132
440 Ga0501260_006894 3300049689 Bacteria 1101
441 Ga0501221_005071 3300049704 Bacteria 2194
442 Ga0501225_0001143 3300049705 Bacteria 8294
443 Ga0501225_0013841 3300049705 Bacteria 2255
444 Ga0501234_000147 3300049707 Bacteria 9476
445 Ga0501234_021607 3300049707 Bacteria 1025
446 Ga0501234_051695 3300049707 Bacteria 685
447 Ga0501245_004762 3300049708 Bacteria 1868
448 Ga0501080_0464860 3300049742 Unclassified 1133
449 Ga0501081_0053480 3300049743 Bacteria 2788
450 Ga0501081_0718473 3300049743 Unclassified 750
451 Ga0501262_017108 3300049759 Bacteria 965
452 Ga0501263_022757 3300049760 Bacteria 851
453 Ga0501270_031541 3300049767 Bacteria 877
454 Ga0501271_043295 3300049768 Unclassified 592
455 Ga0501273_003126 3300049770 Bacteria 1735
456 Ga0501278_008551 3300049774 Bacteria 792
457 Ga0501035_0201841 3300049822 Unclassified 1705
458 Ga0501200_00441 3300049849 Bacteria 1351
459 Ga0501212_019331 3300049851 Bacteria 1043
460 Ga0501212_025802 3300049851 Bacteria 929
461 Ga0501226_000894 3300049853 Bacteria 3985
462 nmdc:mga05p37_163740_c1 3300050507 Bacteria 2715
463 nmdc:mga05p37_557268_c1 3300050507 Bacteria 1303
464 nmdc:mga09592_83848_c1 3300050508 Unclassified 2717
465 nmdc:mga09592_990495_c1 3300050508 Unclassified 703
466 nmdc:mga0qj67_1037122_c1 3300050509 Unclassified 642
467 nmdc:mga0qj67_36473_c1 3300050509 Bacteria 3846
468 nmdc:mga0qj67_81545_c1 3300050509 Bacteria 2594
469 nmdc:mga06r32_1118412_c1 3300050510 Unclassified 736
470 nmdc:mga06r32_24711_c1 3300050510 Bacteria 5581
471 nmdc:mga06r32_453928_c1 3300050510 Bacteria 1261
472 nmdc:mga08y16_117751_c1 3300050511 Bacteria 2765
473 nmdc:mga08y16_42172_c1 3300050511 Bacteria 4780
474 nmdc:mga08y16_70335_c1 3300050511 Bacteria 3648
475 nmdc:mga0n895_292155_c1 3300050512 Bacteria 1652
476 nmdc:mga0n895_322156_c1 3300050512 Bacteria 1566
477 nmdc:mga0n895_717671_c1 3300050512 Unclassified 995
478 nmdc:mga0rr50_4317_c1 3300050513 Bacteria 8331
479 nmdc:mga0rr50_48_c1 3300050513 Bacteria 67747
480 nmdc:mga0rr50_76_c2 3300050513 Bacteria 38295
481 nmdc:mga08x19_243_c1 3300050514 Bacteria 41703
482 nmdc:mga08x19_3018_c1 3300050514 Bacteria 10115
483 Ga0495655_0037081 3300053083 Unclassified 1222
484 Ga0501084_0039791 3300054114 Unclassified 3932
485 Ga0501084_0264774 3300054114 Unclassified 1451
486 Ga0501082_0008846 3300060353 Bacteria 8686
487 Ga0501082_0716154 3300060353 Unclassified 876
488 Ga0530510_0081021 3300061734 Bacteria 2363
489 Ga0070707_100710424
490 SwRhRL2b_contig_2170169
491 MBSR1b_contig_9057675
492 JGI24034J14986_102154
493 JGI24748J21848_1000024
494 JGI24034J26672_10000027
495 Ga0065704_10107535
496 Ga0065712_10068103
497 Ga0065715_10105146
498 Ga0065715_10372847
499 Ga0065707_10090224
500 Ga0065707_10182246
501 Ga0065707_10219491
502 Ga0065707_10468724
503 Ga0070690_100000369
504 Ga0070690_100379653
505 Ga0070690_100454759
506 Ga0070670_100286707
507 Ga0068869_100064589
508 Ga0068869_100093869
509 Ga0068869_100288581
510 Ga0070666_10127214
511 Ga0070666_10462070
512 Ga0070680_100092362
513 Ga0070680_100108150
514 Ga0068868_100071490
515 Ga0068868_100145383
516 Ga0070660_100100218
517 Ga0070689_100137176
518 Ga0070689_100463398
519 Ga0070687_100038008
520 Ga0070687_100069632
521 Ga0070692_10001489
522 Ga0070692_10061392
523 Ga0070692_10110209
524 Ga0070692_10192469
525 Ga0070692_11002894
526 Ga0070669_100016926
527 Ga0070669_100367218
528 Ga0070675_100000026
529 Ga0070671_100133955
530 Ga0070671_101044443
531 Ga0070673_100071082
532 Ga0070673_100085951
533 Ga0070673_100672161
534 Ga0070673_101512585
535 Ga0070688_100355111
536 Ga0070659_100001303
537 Ga0070659_101086054
538 Ga0070703_10000231
539 Ga0070709_10253864
540 Ga0070709_10507889
541 Ga0070709_10546320
542 Ga0070710_10007297
543 Ga0070710_11109500
544 Ga0070701_10000269
545 Ga0070711_100530538
546 Ga0070700_100000020
547 Ga0070700_100006163
548 Ga0070700_100009074
549 Ga0070700_100062341
550 Ga0070694_100012760
551 Ga0070694_100070883
552 Ga0070694_100077018
553 Ga0070694_100089775
554 Ga0070694_100132628
555 Ga0070694_100571800
556 Ga0070708_100002369
557 Ga0070708_100016815
558 Ga0070662_100140607
559 Ga0070662_100333061
560 Ga0070681_10001426
561 Ga0068867_100033499
562 Ga0068867_100579152
563 Ga0068867_100703973
564 Ga0070707_100202498
565 Ga0070707_100645653
566 Ga0070698_100001774
567 Ga0070698_100163437
568 Ga0070698_100211276
569 Ga0070698_100480667
570 Ga0070698_100592625
571 Ga0070679_100011940
572 Ga0070684_101297268
573 Ga0070697_100113250
574 Ga0068853_100027469
575 Ga0068853_100102127
576 Ga0068853_100864023
577 Ga0070686_100003473
578 Ga0070686_100152210
579 Ga0070686_100163785
580 Ga0070686_100658888
581 Ga0070686_100668963
582 Ga0070686_101265008
583 Ga0070686_101318704
584 Ga0070695_100067553
585 Ga0070695_100081499
586 Ga0070695_100133874
587 Ga0070695_100319585
588 Ga0070695_100324865
589 Ga0070695_100644548
590 Ga0070695_101122265
591 Ga0070696_100113035
592 Ga0070696_100447928
593 Ga0070693_100780216
594 Ga0070704_100033478
595 Ga0070704_100230759
596 Ga0070704_100381512
597 Ga0070704_100656755
598 Ga0070704_101117686
599 Ga0070704_101482090
600 Ga0070704_101591976
601 Ga0068855_101554573
602 Ga0070664_100001817
603 Ga0068857_100000678
604 Ga0068857_100173784
605 Ga0068857_100356654
606 Ga0068854_100057068
607 Ga0068854_100124419
608 Ga0070702_100182613
609 Ga0068852_100503951
610 Ga0068859_100002243
611 Ga0068859_100156492
612 Ga0068859_100303565
613 Ga0068859_100944947
614 Ga0068859_100955752
615 Ga0068864_100023337
616 Ga0068864_100049820
617 Ga0068864_100140736
618 Ga0068866_10003044
619 Ga0068861_100182193
620 Ga0068861_100197753
621 Ga0068861_100328886
622 Ga0068861_100539318
623 Ga0068861_101112474
624 Ga0068870_10002242
625 Ga0068870_10089733
626 Ga0068863_100344302
627 Ga0068863_101325148
628 Ga0068858_100000077
629 Ga0068858_100037486
630 Ga0068858_100118380
631 Ga0068858_100599159
632 Ga0068860_100086115
633 Ga0068860_101235412
634 Ga0068862_100007079
635 Ga0068862_101125217
636 Ga0068862_102128623
637 Ga0070717_11446077
638 Ga0070716_100038252
639 Ga0070716_100054886
640 Ga0068871_100296062
641 Ga0068871_101089203
642 Ga0075428_100053661
643 Ga0075428_100055929
644 Ga0075428_100514529
645 Ga0075430_100019970
646 Ga0075430_101162465
647 Ga0075431_100124673
648 Ga0075431_100377091
649 Ga0075434_100280751
650 Ga0075434_100708235
651 Ga0075434_100904158
652 Ga0075429_100026609
653 Ga0075429_100289984
654 Ga0075429_100734011
655 Ga0068865_100389130
656 Ga0075436_100000007
657 Ga0097620_100002243
658 Ga0097620_100156491
659 Ga0097620_100303533
660 Ga0097620_100945019
661 Ga0097620_100955730
662 Ga0075435_100000082
663 Ga0075435_100000993
664 Ga0075435_100002951
665 Ga0105244_10023304
666 Ga0105240_11268056
667 Ga0111539_10006410
668 Ga0105245_10151406
669 Ga0105245_10669016
670 Ga0105245_11345018
671 Ga0105247_10000015
672 Ga0114129_10015444
673 Ga0114129_10122540
674 Ga0105243_10001965
675 Ga0105243_10286025
676 Ga0105243_11398837
677 Ga0105241_10044426
678 Ga0105241_10161999
679 Ga0105241_10180046
680 Ga0105241_10432804
681 Ga0105241_10545844
682 Ga0105242_10001809
683 Ga0105242_10003529
684 Ga0105242_10149340
685 Ga0105242_11071243
686 Ga0105242_13014193
687 Ga0105248_10128287
688 Ga0105248_10218920
689 Ga0105248_10805326
690 Ga0105248_11090252
691 Ga0105248_11520966
692 Ga0105237_10345645
693 Ga0105249_10019271
694 Ga0105249_10128496
695 Ga0105249_10209336
696 Ga0105249_10249995
697 Ga0105239_10300121
698 Ga0105246_11766707
699 Ga0157374_10182498
700 Ga0157378_10004080
701 Ga0157378_10035573
702 Ga0157378_10064385
703 Ga0157378_10067504
704 Ga0157378_10067913
705 Ga0157378_10165970
706 Ga0157378_10204160
707 Ga0157378_10283076
708 Ga0163162_10012439
709 Ga0163162_10219773
710 Ga0157372_10245955
711 Ga0157372_12053813
712 Ga0157375_10000623
713 Ga0157375_10521725
714 Ga0157375_12639468
715 Ga0163163_10000302
716 Ga0163163_10005223
717 Ga0157380_10260046
718 Ga0157380_11775944
719 Ga0157377_10000060
720 Ga0163161_10018634
721 Ga0163161_10018954
722 Ga0163161_10829799
723 Ga0163161_10935832
724 Ga0207672_1000048
725 Ga0207655_1020597
726 Ga0207653_10000315
727 Ga0207692_10041534
728 Ga0207642_10029396
729 Ga0207710_10000004
730 Ga0207699_10502903
731 Ga0207699_10573795
732 Ga0207645_10369681
733 Ga0207643_10009571
734 Ga0207643_10644553
735 Ga0207684_10485537
736 Ga0207654_10280335
737 Ga0207654_10336783
738 Ga0207707_10005108
739 Ga0207663_10394657
740 Ga0207663_10608057
741 Ga0207660_10018552
742 Ga0207660_10100483
743 Ga0207660_10390228
744 Ga0207660_10766685
745 Ga0207662_10089081
746 Ga0207662_10247669
747 Ga0207662_10391638
748 Ga0207662_10465684
749 Ga0207657_10108018
750 Ga0207652_10014321
751 Ga0207646_10021228
752 Ga0207646_10807614
753 Ga0207681_10005268
754 Ga0207650_10063606
755 Ga0207659_10000002
756 Ga0207687_10200314
757 Ga0207687_11039872
758 Ga0207644_10000188
759 Ga0207644_10756893
760 Ga0207690_10005586
761 Ga0207706_10148463
762 Ga0207686_10000104
763 Ga0207686_10003210
764 Ga0207686_10088753
765 Ga0207686_10604355
766 Ga0207686_10679532
767 Ga0207709_10001317
768 Ga0207709_10356437
769 Ga0207670_10423379
770 Ga0207669_10755911
771 Ga0207704_10031497
772 Ga0207665_10008555
773 Ga0207665_10013629
774 Ga0207691_10192648
775 Ga0207691_10805455
776 Ga0207711_10302912
777 Ga0207689_10026565
778 Ga0207689_10100395
779 Ga0207689_10264780
780 Ga0207679_10002107
781 Ga0207651_10178263
782 Ga0207651_10340206
783 Ga0207712_10004294
784 Ga0207712_10209590
785 Ga0207640_10226582
786 Ga0207677_10039980
787 Ga0207677_10115927
788 Ga0207677_11093767
789 Ga0207703_10000043
790 Ga0207703_10163198
791 Ga0207703_10520197
792 Ga0207703_10978179
793 Ga0207703_11037770
794 Ga0207639_10022277
795 Ga0207639_10083092
796 Ga0207708_10000021
797 Ga0207708_10001177
798 Ga0207708_10009681
799 Ga0207708_10093262
800 Ga0207708_10145953
801 Ga0207708_10342267
802 Ga0207641_11113011
803 Ga0207641_11266924
804 Ga0207641_12235833
805 Ga0207648_10038022
806 Ga0207648_10171403
807 Ga0207648_10187858
808 Ga0207676_10038951
809 Ga0207676_10170776
810 Ga0207676_10186388
811 Ga0207676_10315903
812 Ga0207676_10391197
813 Ga0207674_10000469
814 Ga0207674_10062162
815 Ga0207674_10187936
816 Ga0207675_100010406
817 Ga0207675_100069111
818 Ga0207675_100147540
819 Ga0207675_100246960
820 Ga0207683_10432976
821 Ga0207428_10006668
822 Ga0207428_10111592
823 Ga0268265_10324534
824 Ga0268265_10470360
825 Ga0268265_10491256
826 Ga0268264_10067083
827 Ga0268264_10489876
828 Ga0268264_12410100
829 Ga0265316_10304631
830 Ga0307408_100012814
831 Ga0307408_101339820
832 Ga0265314_10417164
833 Ga0307405_10300413
834 Ga0307413_10087538
835 Ga0307410_10120312
836 Ga0307410_10331519
837 Ga0307406_10007781
838 Ga0307407_10008317
839 Ga0307412_10152885
840 Ga0307409_100196377
841 Ga0307416_100005363
842 Ga0307416_100088008
843 Ga0307416_101232807
844 Ga0307411_11655111
845 Ga0307415_100003348
846 Ga0373929_0019482
847 Ga0373951_0099916
848 Ga0373932_0049483
849 Ga0373932_0213377
850 Ga0373941_0078597
851 Ga0373960_0220988
852 Ga0373943_0011993
853 Ga0316574_0019296
854 Ga0373931_0050812
855 Ga0373927_0016790
856 Ga0316582_0352787
857 Ga0395905_0008292
858 Ga0395901_0822541
859 Ga0436363_1398227
860 Ga0439435_0153135
861 Ga0451577_0004745
862 Ga0451577_0233072
863 Ga0453683_0004110
864 Ga0453683_0082543
865 Ga0453683_0659880
866 Ga0453684_1214959
867 Ga0451576_0090794
868 Ga0451576_0273292
869 Ga0451576_0597633
870 Ga0495603_0464719
871 Ga0495618_0443249
872 Ga0495630_0204433
873 Ga0495652_0885637
874 Ga0495621_0095225
875 Ga0495634_0194659
876 Ga0495635_0032238
877 Ga0495658_0652518
878 Ga0495684_0462942
879 Ga0496100_0146655
880 Ga0496101_0824879
881 Ga0496106_0014664
882 Ga0501291_045884
883 Ga0501295_136474
884 Ga0501296_011629
885 Ga0501298_005309
886 Ga0501036_0481511
887 Ga0501036_0518218
888 Ga0501040_0007829
889 Ga0501042_0120461
890 Ga0501046_0084444
891 Ga0501046_0242580
892 Ga0501048_0081877
893 Ga0501075_0542257
894 Ga0501076_0043981
895 Ga0501198_000654
896 Ga0501198_001222
897 Ga0501202_014833
898 Ga0501206_002131
899 Ga0501207_000480
900 Ga0501209_053638
901 Ga0501210_003069
902 Ga0501216_003730
903 Ga0501217_000179
904 Ga0501217_026583
905 Ga0501223_000789
906 Ga0501223_013413
907 Ga0501224_004081
908 Ga0501228_005276
909 Ga0501228_023349
910 Ga0501230_057630
911 Ga0501230_155771
912 Ga0501233_000771
913 Ga0501233_045415
914 Ga0501235_001647
915 Ga0501235_008363
916 Ga0501235_009981
917 Ga0501240_100253
918 Ga0501242_063687
919 Ga0501243_009630
920 Ga0501243_031665
921 Ga0501249_055916
922 Ga0501251_015182
923 Ga0501252_009575
924 Ga0501253_024665
925 Ga0501257_003236
926 Ga0501257_055932
927 Ga0501259_022550
928 Ga0501260_006894
929 Ga0501221_005071
930 Ga0501225_0001143
931 Ga0501225_0013841
932 Ga0501234_000147
933 Ga0501234_021607
934 Ga0501234_051695
935 Ga0501245_004762
936 Ga0501080_0464860
937 Ga0501081_0053480
938 Ga0501081_0718473
939 Ga0501262_017108
940 Ga0501263_022757
941 Ga0501270_031541
942 Ga0501271_043295
943 Ga0501273_003126
944 Ga0501278_008551
945 Ga0501035_0201841
946 Ga0501200_00441
947 Ga0501212_019331
948 Ga0501212_025802
949 Ga0501226_000894
950 nmdc:mga05p37_163740_c1
951 nmdc:mga05p37_557268_c1
952 nmdc:mga09592_83848_c1
953 nmdc:mga09592_990495_c1
954 nmdc:mga0qj67_1037122_c1
955 nmdc:mga0qj67_36473_c1
956 nmdc:mga0qj67_81545_c1
957 nmdc:mga06r32_1118412_c1
958 nmdc:mga06r32_24711_c1
959 nmdc:mga06r32_453928_c1
960 nmdc:mga08y16_117751_c1
961 nmdc:mga08y16_42172_c1
962 nmdc:mga08y16_70335_c1
963 nmdc:mga0n895_292155_c1
964 nmdc:mga0n895_322156_c1
965 nmdc:mga0n895_717671_c1
966 nmdc:mga0rr50_4317_c1
967 nmdc:mga0rr50_48_c1
968 nmdc:mga0rr50_76_c2
969 nmdc:mga08x19_243_c1
970 nmdc:mga08x19_3018_c1
971 Ga0495655_0037081
972 Ga0501084_0039791
973 Ga0501084_0264774
974 Ga0501082_0008846
975 Ga0501082_0716154
976 Ga0530510_0081021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

73

159

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hn2-assembly1.cif.gz_B selenomethionine-labelled soluble domain of rieske iron-sulfur protein from chlorobaculum tepidum 0.9615 59 154
5cxm-assembly2.cif.gz_D crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803 0.8975 60 155
5cxm-assembly2.cif.gz_D crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803 0.864 60 155
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.8626 59 157
2yvj-assembly1.cif.gz_B crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex 0.858 59 154
ID Description Score Start End Superfamily
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8975 60 155 2.102.10.10
af_E7F3F1_17_122_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8847 57 157 2.102.10.10
1z01A02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.8786 59 157 2.20.25.680
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.864 60 155 2.102.10.10
af_Q19655_23_127_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8607 60 157 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A357Z6T0-F1-model_v4 (2Fe-2S)-binding protein 0.9587 83 155 GO:0046872
GO:0051537
AF-A0A7X6AIZ7-F1-model_v4 deleted 0.9565 59 157
AF-A0A3N5UB09-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit 0.9538 72 155 GO:0016020
GO:0046872
GO:0051537
AF-A0A7C5I8G0-F1-model_v4 Plastoquinol--plastocyanin reductase 0.951 74 157 GO:0016020
GO:0046872
GO:0051537
AF-A0A098LLA5-F1-model_v4 Rieske (2Fe-2S) domain-containing protein 0.9479 83 157 GO:0046872
GO:0051537

Map