F453535

General Info

Members Datasets Scaffolds Average Seq Length
488 262 487 199

Family's Representative Sequence

Representative Sequence 3300002126|JGI24035J26624_1015562|JGI24035J26624_10155622
Length 196
Sequence MSYSKQHLREASEIVAKLDPTLCEKAVELLAAVRARGGRLFILGVGGSAGNASHAVNDFRKLAGIEAYAPTDNVSELTARTNDDGWPSVFAEWLKGSRLNGKDAILVLSVGGGSHNVSPNLVGALQLAKERGSAILGIVGRDGGYTAQVADVAIVIPTVNPANITPHTEAFQAVVWHLWISHPALKVAETKWESMK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
112 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
206 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
261 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.2
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 5.53
Rhizosphere 92.42
Stem 0
Stem Tuber 0
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5376679 2162886012 Bacteria 906
2 CNXas_1000001 3300000545 Bacteria 91563
3 JGI24035J26624_1015562 3300002126 Bacteria 780
4 rootH2_10000721 3300003320 Bacteria 45836
5 Ga0065703_1018758 3300005272 Bacteria 13579
6 Ga0065714_10134876 3300005288 Bacteria 1218
7 Ga0065712_10000573 3300005290 Bacteria 13456
8 Ga0065712_10008601 3300005290 Unclassified 2900
9 Ga0065712_10023745 3300005290 Bacteria 1031
10 Ga0065715_10002065 3300005293 Bacteria 6776
11 Ga0065715_10009496 3300005293 Unclassified 4020
12 Ga0065715_10105554 3300005293 Unclassified 2885
13 Ga0065715_10112402 3300005293 Bacteria 2531
14 Ga0065715_10349752 3300005293 Bacteria 953
15 Ga0070676_10006268 3300005328 Bacteria 6354
16 Ga0070676_10113891 3300005328 Bacteria 1688
17 Ga0070683_100017316 3300005329 Bacteria 6368
18 Ga0070683_100333309 3300005329 Bacteria 1445
19 Ga0070690_100087326 3300005330 Bacteria 2048
20 Ga0070690_100110619 3300005330 Bacteria 1833
21 Ga0070670_100171527 3300005331 Bacteria 1882
22 Ga0068869_100003463 3300005334 Bacteria 9647
23 Ga0068869_100027986 3300005334 Unclassified 3934
24 Ga0070666_10040986 3300005335 Unclassified 3093
25 Ga0070680_100158169 3300005336 Unclassified 1904
26 Ga0070682_100136674 3300005337 Unclassified 1666
27 Ga0068868_100026335 3300005338 Unclassified 4431
28 Ga0068868_100145469 3300005338 Unclassified 1949
29 Ga0070689_100050771 3300005340 Unclassified 3205
30 Ga0070689_100066480 3300005340 Unclassified 2809
31 Ga0070687_100003550 3300005343 Bacteria 6073
32 Ga0070661_100040652 3300005344 Bacteria 3393
33 Ga0070661_100080737 3300005344 Unclassified 2400
34 Ga0070668_100015168 3300005347 Bacteria 5758
35 Ga0070669_100018560 3300005353 Bacteria 4970
36 Ga0070669_100043052 3300005353 Bacteria 3287
37 Ga0070669_100319157 3300005353 Bacteria 1254
38 Ga0070675_100030828 3300005354 Bacteria 4331
39 Ga0070675_100038169 3300005354 Unclassified 3913
40 Ga0070675_100194796 3300005354 Unclassified 1757
41 Ga0070671_100026689 3300005355 Unclassified 4749
42 Ga0070671_100342934 3300005355 Unclassified 1275
43 Ga0070674_100251664 3300005356 Bacteria 1388
44 Ga0070673_100030088 3300005364 Bacteria 4058
45 Ga0070673_100721119 3300005364 Unclassified 917
46 Ga0070688_100004364 3300005365 Bacteria 7356
47 Ga0070688_100058535 3300005365 Unclassified 2426
48 Ga0070688_100067256 3300005365 Bacteria 2282
49 Ga0070688_100089148 3300005365 Unclassified 2012
50 Ga0070688_100230769 3300005365 Unclassified 1309
51 Ga0070659_100018402 3300005366 Bacteria 5272
52 Ga0070659_100453396 3300005366 Unclassified 1088
53 Ga0070667_100071001 3300005367 Unclassified 2965
54 Ga0070667_100240371 3300005367 Bacteria 1617
55 Ga0070709_10127675 3300005434 Bacteria 1732
56 Ga0070714_100811144 3300005435 Unclassified 907
57 Ga0070713_100054568 3300005436 Unclassified 3316
58 Ga0070713_100236371 3300005436 Bacteria 1662
59 Ga0070713_100368601 3300005436 Bacteria 1336
60 Ga0070713_100400500 3300005436 Bacteria 1282
61 Ga0070713_100636382 3300005436 Bacteria 1015
62 Ga0070710_10014716 3300005437 Unclassified 3942
63 Ga0070710_10212857 3300005437 Unclassified 1226
64 Ga0070701_10097779 3300005438 Bacteria 1620
65 Ga0070711_100020899 3300005439 Unclassified 4226
66 Ga0070711_100119790 3300005439 Unclassified 1945
67 Ga0070705_100000850 3300005440 Bacteria 17152
68 Ga0070700_100191717 3300005441 Bacteria 1429
69 Ga0070694_100009414 3300005444 Bacteria 5995
70 Ga0070694_100049910 3300005444 Bacteria 2819
71 Ga0070708_100036050 3300005445 Bacteria 4312
72 Ga0070708_100043453 3300005445 Bacteria 3949
73 Ga0070708_100068697 3300005445 Bacteria 3185
74 Ga0070708_100277914 3300005445 Unclassified 1576
75 Ga0070708_100502593 3300005445 Bacteria 1144
76 Ga0070663_100185665 3300005455 Bacteria 1616
77 Ga0070678_100096613 3300005456 Bacteria 2279
78 Ga0070662_100024490 3300005457 Bacteria 4158
79 Ga0070662_100054016 3300005457 Bacteria 2910
80 Ga0070681_10033106 3300005458 Bacteria 5188
81 Ga0070685_10118580 3300005466 Bacteria 1641
82 Ga0070706_100002884 3300005467 Bacteria 17131
83 Ga0070706_100103216 3300005467 Bacteria 2651
84 Ga0070706_100507520 3300005467 Unclassified 1122
85 Ga0070707_100002697 3300005468 Bacteria 16885
86 Ga0070707_100008675 3300005468 Bacteria 9431
87 Ga0070707_100027339 3300005468 Bacteria 5427
88 Ga0070707_100150623 3300005468 Unclassified 2265
89 Ga0070707_100172233 3300005468 Bacteria 2109
90 Ga0070707_100255725 3300005468 Bacteria 1704
91 Ga0070698_100004923 3300005471 Bacteria 14651
92 Ga0070698_100058213 3300005471 Bacteria 3907
93 Ga0070699_100069023 3300005518 Bacteria 3071
94 Ga0070699_100081466 3300005518 Unclassified 2821
95 Ga0070699_100782434 3300005518 Unclassified 873
96 Ga0070679_100012926 3300005530 Bacteria 7996
97 Ga0070684_100081933 3300005535 Bacteria 2856
98 Ga0070684_100307837 3300005535 Unclassified 1454
99 Ga0070672_100049690 3300005543 Bacteria 3264
100 Ga0070686_100067615 3300005544 Unclassified 2328
101 Ga0070695_100005537 3300005545 Bacteria 7435
102 Ga0070695_100266923 3300005545 Bacteria 1252
103 Ga0070696_100112424 3300005546 Bacteria 1963
104 Ga0070665_100003323 3300005548 Bacteria 17234
105 Ga0070665_100011586 3300005548 Bacteria 8916
106 Ga0070665_100074929 3300005548 Unclassified 3390
107 Ga0070665_100133133 3300005548 Bacteria 2488
108 Ga0070704_100000116 3300005549 Bacteria 28451
109 Ga0070704_100362593 3300005549 Unclassified 1226
110 Ga0068855_100000058 3300005563 Bacteria 134718
111 Ga0068855_100221047 3300005563 Bacteria 2124
112 Ga0070664_100060747 3300005564 Bacteria 3219
113 Ga0070702_100500763 3300005615 Unclassified 892
114 Ga0068859_100073666 3300005617 Bacteria 3453
115 Ga0068864_100280937 3300005618 Bacteria 1554
116 Ga0068861_100205514 3300005719 Bacteria 1656
117 Ga0068861_100827667 3300005719 Bacteria 871
118 Ga0068863_100141632 3300005841 Bacteria 2298
119 Ga0068858_100096076 3300005842 Bacteria 2761
120 Ga0068858_100381390 3300005842 Bacteria 1353
121 Ga0068860_100158353 3300005843 Unclassified 2183
122 Ga0068862_100075981 3300005844 Bacteria 2907
123 Ga0068862_101770415 3300005844 Bacteria 627
124 Ga0081455_10004845 3300005937 Bacteria 14934
125 Ga0081455_10007688 3300005937 Bacteria 11316
126 Ga0081455_10140554 3300005937 Bacteria 1876
127 Ga0081455_10146372 3300005937 Bacteria 1827
128 Ga0081540_1001895 3300005983 Bacteria 17513
129 Ga0081540_1095076 3300005983 Bacteria 1300
130 Ga0081539_10007439 3300005985 Bacteria 9984
131 Ga0081539_10051929 3300005985 Bacteria 2307
132 Ga0070717_10041558 3300006028 Unclassified 3748
133 Ga0070717_10396660 3300006028 Unclassified 1239
134 Ga0075432_10057389 3300006058 Bacteria 1381
135 Ga0070715_10182754 3300006163 Bacteria 1053
136 Ga0070715_10230644 3300006163 Bacteria 957
137 Ga0070716_100002739 3300006173 Bacteria 8176
138 Ga0070716_100064452 3300006173 Bacteria 2131
139 Ga0070716_100479816 3300006173 Unclassified 913
140 Ga0070712_100032248 3300006175 Unclassified 3536
141 Ga0070712_100059274 3300006175 Unclassified 2695
142 Ga0070712_100214830 3300006175 Bacteria 1519
143 Ga0070712_100301003 3300006175 Unclassified 1298
144 Ga0097621_100388187 3300006237 Bacteria 1248
145 Ga0068871_100101456 3300006358 Bacteria 2412
146 Ga0068871_100155110 3300006358 Bacteria 1955
147 Ga0075428_100015909 3300006844 Bacteria 8322
148 Ga0075428_100142897 3300006844 Bacteria 2602
149 Ga0075428_100769692 3300006844 Unclassified 1024
150 Ga0075431_100061420 3300006847 Bacteria 3877
151 Ga0075431_100179683 3300006847 Bacteria 2172
152 Ga0075433_10001383 3300006852 Bacteria 17853
153 Ga0075433_10070179 3300006852 Bacteria 3079
154 Ga0075434_100127613 3300006871 Bacteria 2561
155 Ga0075434_100181774 3300006871 Bacteria 2123
156 Ga0075434_100456433 3300006871 Unclassified 1299
157 Ga0075429_100195463 3300006880 Bacteria 1772
158 Ga0075436_100680107 3300006914 Bacteria 761
159 Ga0097620_100073668 3300006931 Bacteria 3453
160 Ga0075435_100002801 3300007076 Bacteria 11656
161 Ga0075435_100233545 3300007076 Bacteria 1563
162 Ga0099794_10018056 3300007265 Bacteria 3157
163 Ga0105240_10287050 3300009093 Bacteria 1888
164 Ga0111539_10050029 3300009094 Bacteria 4980
165 Ga0111539_10128030 3300009094 Bacteria 2974
166 Ga0111539_10220968 3300009094 Bacteria 2206
167 Ga0111539_10231957 3300009094 Bacteria 2149
168 Ga0111539_10259189 3300009094 Unclassified 2024
169 Ga0111539_10259931 3300009094 Unclassified 2021
170 Ga0105245_10008336 3300009098 Bacteria 9057
171 Ga0105245_10023086 3300009098 Bacteria 5459
172 Ga0105245_10110833 3300009098 Bacteria 2552
173 Ga0105247_10103705 3300009101 Bacteria 1821
174 Ga0114129_10008944 3300009147 Bacteria 14271
175 Ga0114129_10049778 3300009147 Bacteria 5887
176 Ga0114129_10189590 3300009147 Bacteria 2793
177 Ga0114129_10379758 3300009147 Bacteria 1866
178 Ga0114129_10728427 3300009147 Bacteria 1272
179 Ga0114129_10800526 3300009147 Bacteria 1202
180 Ga0105243_10021052 3300009148 Bacteria 4949
181 Ga0105241_10001358 3300009174 Bacteria 18632
182 Ga0105241_10005023 3300009174 Bacteria 9768
183 Ga0105242_10227748 3300009176 Bacteria 1669
184 Ga0105242_10787349 3300009176 Bacteria 940
185 Ga0105248_10104746 3300009177 Bacteria 3189
186 Ga0105248_10337085 3300009177 Bacteria 1698
187 Ga0105237_10169999 3300009545 Bacteria 2179
188 Ga0105237_10174969 3300009545 Bacteria 2147
189 Ga0105238_10987121 3300009551 Bacteria 863
190 Ga0105249_10003690 3300009553 Bacteria 13200
191 Ga0105249_10264419 3300009553 Unclassified 1711
192 Ga0105249_10305412 3300009553 Bacteria 1597
193 Ga0099796_10243713 3300010159 Bacteria 744
194 Ga0105239_10002874 3300010375 Bacteria 21541
195 Ga0105239_10215557 3300010375 Bacteria 2152
196 Ga0105239_10552305 3300010375 Bacteria 1312
197 Ga0157371_10283549 3300013102 Unclassified 1197
198 Ga0157369_10037595 3300013105 Bacteria 5300
199 Ga0157369_10166977 3300013105 Bacteria 2320
200 Ga0157374_10041547 3300013296 Unclassified 4239
201 Ga0157374_10289711 3300013296 Bacteria 1618
202 Ga0157374_10341311 3300013296 Unclassified 1487
203 Ga0157378_10025962 3300013297 Bacteria 5162
204 Ga0157378_10090409 3300013297 Bacteria 2782
205 Ga0157378_10391958 3300013297 Bacteria 1366
206 Ga0163162_10023977 3300013306 Bacteria 6021
207 Ga0163162_10046179 3300013306 Bacteria 4366
208 Ga0163162_10103819 3300013306 Bacteria 2936
209 Ga0157372_10016934 3300013307 Bacteria 7825
210 Ga0157372_10237353 3300013307 Unclassified 2115
211 Ga0157372_10421985 3300013307 Bacteria 1555
212 Ga0157375_10144508 3300013308 Bacteria 2508
213 Ga0157375_10235290 3300013308 Unclassified 1991
214 Ga0163163_10062327 3300014325 Unclassified 3695
215 Ga0163163_11257930 3300014325 Bacteria 802
216 Ga0157376_10052472 3300014969 Bacteria 3391
217 Ga0157376_10325118 3300014969 Unclassified 1463
218 Ga0213876_10019103 3300021384 Bacteria 3619
219 Ga0213871_10014362 3300021441 Bacteria 1877
220 Ga0213871_10038778 3300021441 Bacteria 1273
221 Ga0207666_1000123 3300025271 Bacteria 12028
222 Ga0207666_1001808 3300025271 Bacteria 2542
223 Ga0207673_1001030 3300025290 Bacteria 2999
224 Ga0207697_10001238 3300025315 Bacteria 13984
225 Ga0207697_10001995 3300025315 Viruses 10827
226 Ga0207697_10002939 3300025315 Bacteria 8606
227 Ga0207697_10005559 3300025315 Bacteria 5840
228 Ga0207697_10021493 3300025315 Bacteria 2641
229 Ga0207697_10032032 3300025315 Unclassified 2151
230 Ga0207697_10159021 3300025315 Bacteria 985
231 Ga0207653_10008466 3300025885 Bacteria 3205
232 Ga0207680_10014734 3300025903 Unclassified 4059
233 Ga0207680_10074933 3300025903 Bacteria 2109
234 Ga0207647_10093229 3300025904 Bacteria 1795
235 Ga0207699_10147675 3300025906 Bacteria 1552
236 Ga0207645_10000302 3300025907 Bacteria 41340
237 Ga0207645_10040171 3300025907 Bacteria 2996
238 Ga0207705_10077231 3300025909 Bacteria 2422
239 Ga0207684_10003171 3300025910 Bacteria 16174
240 Ga0207684_10003738 3300025910 Bacteria 14705
241 Ga0207684_10072420 3300025910 Unclassified 2927
242 Ga0207684_10525435 3300025910 Unclassified 1013
243 Ga0207654_10006668 3300025911 Bacteria 5811
244 Ga0207654_10164726 3300025911 Bacteria 1435
245 Ga0207707_10225211 3300025912 Unclassified 1632
246 Ga0207695_10002458 3300025913 Bacteria 27373
247 Ga0207693_10005752 3300025915 Bacteria 10289
248 Ga0207693_10014810 3300025915 Bacteria 6265
249 Ga0207663_10070240 3300025916 Unclassified 2256
250 Ga0207662_10000172 3300025918 Bacteria 30802
251 Ga0207657_10167997 3300025919 Bacteria 1778
252 Ga0207649_10084921 3300025920 Bacteria 2059
253 Ga0207649_10173706 3300025920 Bacteria 1503
254 Ga0207652_10118881 3300025921 Unclassified 2350
255 Ga0207646_10002009 3300025922 Bacteria 24461
256 Ga0207646_10032192 3300025922 Bacteria 4745
257 Ga0207646_10254446 3300025922 Bacteria 1587
258 Ga0207681_10020083 3300025923 Bacteria 4230
259 Ga0207681_10111497 3300025923 Unclassified 1990
260 Ga0207681_10245102 3300025923 Bacteria 1397
261 Ga0207681_10660318 3300025923 Bacteria 867
262 Ga0207694_10417367 3300025924 Bacteria 1117
263 Ga0207650_10228549 3300025925 Bacteria 1500
264 Ga0207659_10174701 3300025926 Unclassified 1697
265 Ga0207659_10296711 3300025926 Bacteria 1326
266 Ga0207687_10021588 3300025927 Bacteria 4278
267 Ga0207687_10168816 3300025927 Bacteria 1686
268 Ga0207687_10231011 3300025927 Bacteria 1461
269 Ga0207700_10110012 3300025928 Unclassified 2215
270 Ga0207700_10118909 3300025928 Bacteria 2139
271 Ga0207700_10314776 3300025928 Bacteria 1355
272 Ga0207664_10737977 3300025929 Unclassified 886
273 Ga0207644_10021870 3300025931 Bacteria 4361
274 Ga0207644_10120860 3300025931 Unclassified 1994
275 Ga0207644_10138752 3300025931 Unclassified 1870
276 Ga0207690_10057604 3300025932 Bacteria 2625
277 Ga0207690_10644502 3300025932 Unclassified 868
278 Ga0207706_10000429 3300025933 Bacteria 45047
279 Ga0207706_10039496 3300025933 Bacteria 4184
280 Ga0207686_10328437 3300025934 Bacteria 1145
281 Ga0207709_10096602 3300025935 Bacteria 1944
282 Ga0207670_10048557 3300025936 Unclassified 2833
283 Ga0207670_10057761 3300025936 Bacteria 2633
284 Ga0207670_10197104 3300025936 Bacteria 1527
285 Ga0207670_10295521 3300025936 Bacteria 1267
286 Ga0207669_10280123 3300025937 Bacteria 1257
287 Ga0207704_10246722 3300025938 Bacteria 1338
288 Ga0207665_10000451 3300025939 Bacteria 28242
289 Ga0207665_10021258 3300025939 Bacteria 4266
290 Ga0207691_10047677 3300025940 Bacteria 3931
291 Ga0207691_10142258 3300025940 Bacteria 2113
292 Ga0207691_10505079 3300025940 Unclassified 1027
293 Ga0207711_10113759 3300025941 Bacteria 2410
294 Ga0207689_10000110 3300025942 Bacteria 67347
295 Ga0207689_10021613 3300025942 Bacteria 5410
296 Ga0207661_10204013 3300025944 Unclassified 1739
297 Ga0207661_10632821 3300025944 Unclassified 983
298 Ga0207679_10285674 3300025945 Bacteria 1416
299 Ga0207667_10000479 3300025949 Bacteria 53167
300 Ga0207667_10618417 3300025949 Bacteria 1091
301 Ga0207651_10073276 3300025960 Bacteria 2434
302 Ga0207712_10020789 3300025961 Bacteria 4304
303 Ga0207712_10266245 3300025961 Unclassified 1392
304 Ga0207668_10024912 3300025972 Unclassified 3867
305 Ga0207658_10016888 3300025986 Bacteria 5023
306 Ga0207658_10302763 3300025986 Bacteria 1378
307 Ga0207677_10017805 3300026023 Unclassified 4248
308 Ga0207677_11071929 3300026023 Bacteria 733
309 Ga0207703_10077323 3300026035 Bacteria 2762
310 Ga0207703_10922818 3300026035 Bacteria 836
311 Ga0207678_10030759 3300026067 Bacteria 4687
312 Ga0207708_10021353 3300026075 Bacteria 4882
313 Ga0207641_10182863 3300026088 Bacteria 1921
314 Ga0207648_10273575 3300026089 Bacteria 1509
315 Ga0207676_10209166 3300026095 Bacteria 1730
316 Ga0207675_100102588 3300026118 Bacteria 2696
317 Ga0207675_100201505 3300026118 Unclassified 1912
318 Ga0207683_10348980 3300026121 Bacteria 1358
319 Ga0209974_10101128 3300027876 Bacteria 1007
320 Ga0207428_10023042 3300027907 Bacteria 5243
321 Ga0268266_10003782 3300028379 Bacteria 14825
322 Ga0268266_10177237 3300028379 Unclassified 1938
323 Ga0268266_10600956 3300028379 Bacteria 1057
324 Ga0268265_10245187 3300028380 Bacteria 1583
325 Ga0268264_10109234 3300028381 Unclassified 2419
326 Ga0268264_10446209 3300028381 Bacteria 1252
327 Ga0265323_10009792 3300028653 Bacteria 3900
328 Ga0265323_10014849 3300028653 Bacteria 3071
329 Ga0265323_10021624 3300028653 Bacteria 2464
330 Ga0265338_10171418 3300028800 Bacteria 1664
331 Ga0265760_10034410 3300031090 Bacteria 1499
332 Ga0265330_10000317 3300031235 Bacteria 34538
333 Ga0265330_10044428 3300031235 Bacteria 1961
334 Ga0265332_10001593 3300031238 Bacteria 12435
335 Ga0265328_10141781 3300031239 Bacteria 902
336 Ga0265320_10266380 3300031240 Bacteria 759
337 Ga0265325_10062361 3300031241 Bacteria 1889
338 Ga0265329_10002813 3300031242 Bacteria 7769
339 Ga0265339_10029394 3300031249 Bacteria 3118
340 Ga0265331_10021212 3300031250 Bacteria 3327
341 Ga0265327_10001510 3300031251 Bacteria 28791
342 Ga0265316_10000399 3300031344 Bacteria 49576
343 Ga0265316_10005668 3300031344 Bacteria 12085
344 Ga0265316_10016900 3300031344 Bacteria 6317
345 Ga0265316_10032551 3300031344 Bacteria 4254
346 Ga0265316_10037925 3300031344 Bacteria 3886
347 Ga0265316_10321287 3300031344 Bacteria 1124
348 Ga0307513_10051938 3300031456 Bacteria 4417
349 Ga0307408_100418018 3300031548 Unclassified 1155
350 Ga0265313_10012632 3300031595 Bacteria 5135
351 Ga0265314_10000532 3300031711 Bacteria 49131
352 Ga0265342_10000369 3300031712 Bacteria 49518
353 Ga0265342_10021687 3300031712 Bacteria 4096
354 Ga0265342_10039132 3300031712 Bacteria 2883
355 Ga0265342_10201115 3300031712 Unclassified 1082
356 Ga0265342_10245706 3300031712 Bacteria 957
357 Ga0373944_0068353 3300035089 Unclassified 1153
358 Ga0373935_0060037 3300035692 Bacteria 2432
359 Ga0373935_0089073 3300035692 Bacteria 2017
360 Ga0373935_0146708 3300035692 Bacteria 1598
361 Ga0373935_0340781 3300035692 Bacteria 1067
362 Ga0373927_0001751 3300035695 Bacteria 16203
363 Ga0373927_0206173 3300035695 Unclassified 1291
364 Ga0373927_0349768 3300035695 Unclassified 974
365 Ga0373947_0235123 3300035725 Bacteria 1208
366 Ga0373947_0587888 3300035725 Unclassified 759
367 Ga0373937_0070632 3300036401 Unclassified 3221
368 Ga0373925_0063780 3300037068 Unclassified 2773
369 Ga0373925_0613539 3300037068 Bacteria 896
370 Ga0395899_0000032 3300037312 Bacteria 312705
371 Ga0395905_0400803 3300037471 Bacteria 1267
372 Ga0436364_0080357 3300037853 Unclassified 2025
373 Ga0436364_1008634 3300037853 Bacteria 2022
374 Ga0436365_1522897 3300039437 Bacteria 27242
375 Ga0436360_0616931 3300039438 Bacteria 1903
376 Ga0436360_1315258 3300039438 Bacteria 1055
377 Ga0436360_1325435 3300039438 Unclassified 3903
378 Ga0436361_0388043 3300039447 Bacteria 1404
379 Ga0436361_0557908 3300039447 Bacteria 2440
380 Ga0436361_0700772 3300039447 Unclassified 2017
381 Ga0436361_0893372 3300039447 Bacteria 9378
382 Ga0436361_1179632 3300039447 Bacteria 3483
383 Ga0436361_1191486 3300039447 Unclassified 975
384 Ga0436362_0248233 3300039453 Bacteria 6489
385 Ga0451807_0293516 3300041486 Bacteria 850
386 Ga0451853_1143010 3300041512 Bacteria 1296
387 Ga0439451_002607 3300042009 Unclassified 3665
388 Ga0439444_0005426 3300042437 Bacteria 1892
389 Ga0451577_0002312 3300042876 Bacteria 23042
390 Ga0451577_0279471 3300042876 Bacteria 1512
391 Ga0451577_0501808 3300042876 Bacteria 1101
392 Ga0453683_0309552 3300044673 Bacteria 1011
393 Ga0453684_0020796 3300044712 Bacteria 9863
394 Ga0453684_0194454 3300044712 Bacteria 2370
395 Ga0453684_0279045 3300044712 Bacteria 1906
396 Ga0451576_0122983 3300045051 Bacteria 2702
397 Ga0451576_0130410 3300045051 Unclassified 2620
398 Ga0451576_0137441 3300045051 Bacteria 2549
399 Ga0451576_0185237 3300045051 Unclassified 2174
400 Ga0451576_0369722 3300045051 Bacteria 1502
401 Ga0495629_0322023 3300046459 Bacteria 1057
402 Ga0495630_0006461 3300046517 Bacteria 8339
403 Ga0495630_0584004 3300046517 Bacteria 857
404 Ga0495643_0000140 3300046522 Bacteria 115947
405 Ga0495652_0051203 3300046529 Bacteria 3528
406 Ga0495586_0024357 3300046535 Unclassified 3235
407 Ga0495587_0226618 3300046536 Bacteria 1054
408 Ga0495634_0035284 3300046642 Unclassified 3427
409 Ga0495659_0241389 3300046664 Bacteria 751
410 Ga0495599_0180367 3300046678 Bacteria 1302
411 Ga0495658_0023116 3300046683 Bacteria 3297
412 Ga0495658_0234834 3300046683 Bacteria 1151
413 Ga0495613_0123373 3300046689 Bacteria 1859
414 Ga0495624_0159582 3300046690 Unclassified 1378
415 Ga0495624_0233331 3300046690 Bacteria 1114
416 Ga0495600_0157503 3300046809 Bacteria 1469
417 Ga0495581_0148013 3300047315 Bacteria 1371
418 Ga0495581_0204574 3300047315 Bacteria 1155
419 Ga0495674_0152644 3300047319 Bacteria 1936
420 Ga0495680_0114720 3300047322 Bacteria 1994
421 Ga0495684_0027005 3300047471 Unclassified 4410
422 Ga0495602_0419471 3300048088 Bacteria 951
423 Ga0496100_0156185 3300048903 Bacteria 1632
424 Ga0496101_0026464 3300048904 Bacteria 4034
425 Ga0496101_0108311 3300048904 Bacteria 2089
426 Ga0496102_0179187 3300048905 Unclassified 1996
427 Ga0496102_0907167 3300048905 Unclassified 803
428 Ga0496103_0048797 3300048906 Unclassified 2617
429 Ga0496104_0060283 3300048907 Unclassified 3595
430 Ga0496104_0066756 3300048907 Unclassified 3416
431 Ga0496104_0247574 3300048907 Bacteria 1695
432 Ga0496105_0025727 3300048908 Bacteria 4794
433 Ga0496105_0064221 3300048908 Unclassified 3029
434 Ga0496105_0493120 3300048908 Unclassified 962
435 Ga0496108_0017052 3300048911 Bacteria 5937
436 Ga0496109_0114700 3300048912 Unclassified 2506
437 Ga0496111_0094905 3300048914 Unclassified 2188
438 Ga0496111_0416999 3300048914 Unclassified 992
439 Ga0496111_0898798 3300048914 Bacteria 638
440 Ga0496112_0066113 3300048915 Bacteria 3568
441 Ga0496112_0158833 3300048915 Unclassified 2227
442 Ga0496112_0187685 3300048915 Bacteria 2030
443 Ga0496113_0005828 3300048916 Bacteria 7730
444 Ga0496114_0065416 3300048917 Bacteria 3046
445 Ga0496115_0010534 3300048918 Bacteria 6912
446 Ga0496115_0125813 3300048918 Unclassified 2111
447 Ga0496115_0872294 3300048918 Bacteria 696
448 Ga0496126_0004587 3300048929 Bacteria 16384
449 Ga0501037_0214866 3300049573 Bacteria 1355
450 Ga0501047_0331523 3300049581 Bacteria 1360
451 Ga0501075_0049006 3300049591 Bacteria 3175
452 Ga0501076_0246810 3300049592 Bacteria 1461
453 Ga0501253_033305 3300049683 Bacteria 997
454 Ga0501079_0120443 3300049741 Bacteria 2041
455 Ga0501044_0002707 3300049823 Bacteria 20144
456 Ga0501045_0374888 3300049824 Bacteria 1059
457 nmdc:mga05p37_106729_c1 3300050507 Bacteria 2448
458 nmdc:mga05p37_1187644_c1 3300050507 Bacteria 790
459 nmdc:mga05p37_284509_c1 3300050507 Bacteria 1970
460 nmdc:mga05p37_41784_c1 3300050507 Unclassified 2378
461 nmdc:mga05p37_536796_c1 3300050507 Bacteria 1334
462 nmdc:mga09592_585617_c1 3300050508 Bacteria 957
463 nmdc:mga06r32_135010_c1 3300050510 Bacteria 2442
464 nmdc:mga06r32_282494_c1 3300050510 Bacteria 1647
465 nmdc:mga08y16_61283_c1 3300050511 Bacteria 3929
466 nmdc:mga0n895_153634_c1 3300050512 Bacteria 2332
467 nmdc:mga0n895_154542_c1 3300050512 Bacteria 2325
468 nmdc:mga0n895_290077_c1 3300050512 Unclassified 1659
469 nmdc:mga0n895_5168_c1 3300050512 Bacteria 10861
470 nmdc:mga0n895_585400_c1 3300050512 Bacteria 1119
471 nmdc:mga0n895_747784_c1 3300050512 Bacteria 971
472 nmdc:mga0n895_87431_c1 3300050512 Bacteria 3114
473 nmdc:mga0n895_9204_c1 3300050512 Bacteria 8628
474 nmdc:mga0rr50_4476_c1 3300050513 Bacteria 8225
475 nmdc:mga0rr50_4911_c1 3300050513 Bacteria 7914
476 nmdc:mga08x19_229260_c2 3300050514 Bacteria 975
477 nmdc:mga08x19_9734_c1 3300050514 Bacteria 5757
478 nmdc:mga0a205_113461_c1 3300050515 Bacteria 2609
479 nmdc:mga0a205_1282_c1 3300050515 Bacteria 21168
480 nmdc:mga0a205_1784_c1 3300050515 Bacteria 18598
481 nmdc:mga0a205_18752_c1 3300050515 Bacteria 6511
482 nmdc:mga0a205_394606_c1 3300050515 Bacteria 1248
483 nmdc:mga0a205_63331_c1 3300050515 Bacteria 3573
484 Ga0495619_0045681 3300053085 Unclassified 2878
485 Ga0500556_0000211 3300053104 Bacteria 47457
486 Ga0500637_0006632 3300053178 Bacteria 5720
487 Ga0501084_0005991 3300054114 Bacteria 10001

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025935 Ga0207709_10096602 Ga0207709_100966021 174
2 3300028653 Ga0265323_10021624 Ga0265323_100216243 177
3 3300031344 Ga0265316_10005668 Ga0265316_100056686 177
4 3300048914 Ga0496111_0898798 Ga0496111_0898798_16_588 184
5 3300028800 Ga0265338_10171418 Ga0265338_101714182 185
6 3300031239 Ga0265328_10141781 Ga0265328_101417812 190
7 3300005468 Ga0070707_100008675 Ga0070707_1000086759 191
8 3300031548 Ga0307408_100418018 Ga0307408_1004180181 192
9 3300037853 Ga0436364_1008634 Ga0436364_1008634_729_1319 193
10 3300031090 Ga0265760_10034410 Ga0265760_100344102 194
11 3300053104 Ga0500556_0000211 Ga0500556_0000211_28059_28670 194
12 iso_pu_bacteria 2786546517 2787435677 194
13 3300049591 Ga0501075_0049006 Ga0501075_0049006_1460_2053 195
14 3300002126 JGI24035J26624_1015562 JGI24035J26624_10155622 196
15 3300005365 Ga0070688_100004364 Ga0070688_1000043645 196
16 3300005367 Ga0070667_100240371 Ga0070667_1002403712 196
17 3300005441 Ga0070700_100191717 Ga0070700_1001917171 196
18 3300005444 Ga0070694_100049910 Ga0070694_1000499101 196
19 3300005618 Ga0068864_100280937 Ga0068864_1002809372 196
20 3300005719 Ga0068861_100205514 Ga0068861_1002055142 196
21 3300005841 Ga0068863_100141632 Ga0068863_1001416323 196
22 3300013296 Ga0157374_10289711 Ga0157374_102897113 196
23 3300013297 Ga0157378_10391958 Ga0157378_103919582 196
24 3300014325 Ga0163163_10062327 Ga0163163_100623271 196
25 3300025315 Ga0207697_10005559 Ga0207697_100055595 196
26 3300025885 Ga0207653_10008466 Ga0207653_100084664 196
27 3300025904 Ga0207647_10093229 Ga0207647_100932292 196
28 3300025932 Ga0207690_10057604 Ga0207690_100576042 196
29 3300025986 Ga0207658_10302763 Ga0207658_103027632 196
30 3300026075 Ga0207708_10021353 Ga0207708_100213533 196
31 3300026088 Ga0207641_10182863 Ga0207641_101828632 196
32 3300026095 Ga0207676_10209166 Ga0207676_102091663 196
33 3300044712 Ga0453684_0020796 Ga0453684_0020796_2756_3349 197
34 3300045051 Ga0451576_0185237 Ga0451576_0185237_865_1458 197
35 2162886012 MBSR1b_contig_5376679 MBSR1b_0584.00001350 198
36 3300000545 CNXas_1000001 CNXas_100000120 198
37 3300003320 rootH2_10000721 rootH2_1000072122 198
38 3300005272 Ga0065703_1018758 Ga0065703_10187584 198
39 3300005288 Ga0065714_10134876 Ga0065714_101348762 198
40 3300005290 Ga0065712_10000573 Ga0065712_100005737 198
41 3300005290 Ga0065712_10008601 Ga0065712_100086013 198
42 3300005290 Ga0065712_10023745 Ga0065712_100237451 198
43 3300005293 Ga0065715_10002065 Ga0065715_100020654 198
44 3300005293 Ga0065715_10009496 Ga0065715_100094964 198
45 3300005293 Ga0065715_10105554 Ga0065715_101055544 198
46 3300005293 Ga0065715_10112402 Ga0065715_101124022 198
47 3300005293 Ga0065715_10349752 Ga0065715_103497522 198
48 3300005328 Ga0070676_10006268 Ga0070676_100062684 198
49 3300005328 Ga0070676_10113891 Ga0070676_101138912 198
50 3300005329 Ga0070683_100017316 Ga0070683_1000173165 198
51 3300005329 Ga0070683_100333309 Ga0070683_1003333092 198
52 3300005330 Ga0070690_100087326 Ga0070690_1000873262 198
53 3300005330 Ga0070690_100110619 Ga0070690_1001106192 198
54 3300005331 Ga0070670_100171527 Ga0070670_1001715273 198
55 3300005334 Ga0068869_100003463 Ga0068869_1000034636 198
56 3300005334 Ga0068869_100027986 Ga0068869_1000279863 198
57 3300005335 Ga0070666_10040986 Ga0070666_100409864 198
58 3300005336 Ga0070680_100158169 Ga0070680_1001581693 198
59 3300005337 Ga0070682_100136674 Ga0070682_1001366742 198
60 3300005338 Ga0068868_100026335 Ga0068868_1000263354 198
61 3300005338 Ga0068868_100145469 Ga0068868_1001454693 198
62 3300005340 Ga0070689_100050771 Ga0070689_1000507714 198
63 3300005340 Ga0070689_100066480 Ga0070689_1000664804 198
64 3300005343 Ga0070687_100003550 Ga0070687_1000035504 198
65 3300005344 Ga0070661_100040652 Ga0070661_1000406523 198
66 3300005344 Ga0070661_100080737 Ga0070661_1000807372 198
67 3300005347 Ga0070668_100015168 Ga0070668_1000151685 198
68 3300005353 Ga0070669_100018560 Ga0070669_1000185605 198
69 3300005353 Ga0070669_100043052 Ga0070669_1000430524 198
70 3300005353 Ga0070669_100319157 Ga0070669_1003191572 198
71 3300005354 Ga0070675_100030828 Ga0070675_1000308284 198
72 3300005354 Ga0070675_100038169 Ga0070675_1000381693 198
73 3300005354 Ga0070675_100194796 Ga0070675_1001947962 198
74 3300005355 Ga0070671_100026689 Ga0070671_1000266894 198
75 3300005355 Ga0070671_100342934 Ga0070671_1003429342 198
76 3300005356 Ga0070674_100251664 Ga0070674_1002516642 198
77 3300005364 Ga0070673_100030088 Ga0070673_1000300884 198
78 3300005364 Ga0070673_100721119 Ga0070673_1007211192 198
79 3300005365 Ga0070688_100058535 Ga0070688_1000585353 198
80 3300005365 Ga0070688_100067256 Ga0070688_1000672563 198
81 3300005365 Ga0070688_100089148 Ga0070688_1000891482 198
82 3300005365 Ga0070688_100230769 Ga0070688_1002307692 198
83 3300005366 Ga0070659_100018402 Ga0070659_1000184022 198
84 3300005366 Ga0070659_100453396 Ga0070659_1004533962 198
85 3300005367 Ga0070667_100071001 Ga0070667_1000710014 198
86 3300005434 Ga0070709_10127675 Ga0070709_101276752 198
87 3300005435 Ga0070714_100811144 Ga0070714_1008111442 198
88 3300005436 Ga0070713_100054568 Ga0070713_1000545684 198
89 3300005436 Ga0070713_100236371 Ga0070713_1002363713 198
90 3300005436 Ga0070713_100368601 Ga0070713_1003686011 198
91 3300005436 Ga0070713_100400500 Ga0070713_1004005002 198
92 3300005436 Ga0070713_100636382 Ga0070713_1006363822 198
93 3300005437 Ga0070710_10014716 Ga0070710_100147162 198
94 3300005437 Ga0070710_10212857 Ga0070710_102128572 198
95 3300005438 Ga0070701_10097779 Ga0070701_100977792 198
96 3300005439 Ga0070711_100020899 Ga0070711_1000208994 198
97 3300005439 Ga0070711_100119790 Ga0070711_1001197902 198
98 3300005440 Ga0070705_100000850 Ga0070705_10000085014 198
99 3300005444 Ga0070694_100009414 Ga0070694_1000094142 198
100 3300005445 Ga0070708_100036050 Ga0070708_1000360504 198
101 3300005445 Ga0070708_100043453 Ga0070708_1000434534 198
102 3300005445 Ga0070708_100068697 Ga0070708_1000686973 198
103 3300005445 Ga0070708_100277914 Ga0070708_1002779142 198
104 3300005445 Ga0070708_100502593 Ga0070708_1005025932 198
105 3300005455 Ga0070663_100185665 Ga0070663_1001856652 198
106 3300005456 Ga0070678_100096613 Ga0070678_1000966132 198
107 3300005457 Ga0070662_100024490 Ga0070662_1000244902 198
108 3300005457 Ga0070662_100054016 Ga0070662_1000540162 198
109 3300005458 Ga0070681_10033106 Ga0070681_100331065 198
110 3300005466 Ga0070685_10118580 Ga0070685_101185803 198
111 3300005467 Ga0070706_100002884 Ga0070706_10000288413 198
112 3300005467 Ga0070706_100103216 Ga0070706_1001032161 198
113 3300005467 Ga0070706_100507520 Ga0070706_1005075202 198
114 3300005468 Ga0070707_100002697 Ga0070707_10000269714 198
115 3300005468 Ga0070707_100027339 Ga0070707_1000273394 198
116 3300005468 Ga0070707_100150623 Ga0070707_1001506233 198
117 3300005468 Ga0070707_100172233 Ga0070707_1001722332 198
118 3300005468 Ga0070707_100255725 Ga0070707_1002557251 198
119 3300005471 Ga0070698_100004923 Ga0070698_10000492312 198
120 3300005471 Ga0070698_100058213 Ga0070698_1000582135 198
121 3300005518 Ga0070699_100069023 Ga0070699_1000690233 198
122 3300005518 Ga0070699_100081466 Ga0070699_1000814662 198
123 3300005518 Ga0070699_100782434 Ga0070699_1007824342 198
124 3300005530 Ga0070679_100012926 Ga0070679_1000129265 198
125 3300005535 Ga0070684_100081933 Ga0070684_1000819333 198
126 3300005535 Ga0070684_100307837 Ga0070684_1003078372 198
127 3300005543 Ga0070672_100049690 Ga0070672_1000496903 198
128 3300005544 Ga0070686_100067615 Ga0070686_1000676152 198
129 3300005545 Ga0070695_100005537 Ga0070695_1000055376 198
130 3300005545 Ga0070695_100266923 Ga0070695_1002669231 198
131 3300005546 Ga0070696_100112424 Ga0070696_1001124243 198
132 3300005548 Ga0070665_100003323 Ga0070665_10000332317 198
133 3300005548 Ga0070665_100011586 Ga0070665_1000115862 198
134 3300005548 Ga0070665_100074929 Ga0070665_1000749293 198
135 3300005548 Ga0070665_100133133 Ga0070665_1001331334 198
136 3300005549 Ga0070704_100000116 Ga0070704_1000001166 198
137 3300005549 Ga0070704_100362593 Ga0070704_1003625932 198
138 3300005563 Ga0068855_100000058 Ga0068855_100000058122 198
139 3300005563 Ga0068855_100221047 Ga0068855_1002210473 198
140 3300005564 Ga0070664_100060747 Ga0070664_1000607473 198
141 3300005615 Ga0070702_100500763 Ga0070702_1005007631 198
142 3300005617 Ga0068859_100073666 Ga0068859_1000736662 198
143 3300005719 Ga0068861_100827667 Ga0068861_1008276672 198
144 3300005842 Ga0068858_100096076 Ga0068858_1000960762 198
145 3300005842 Ga0068858_100381390 Ga0068858_1003813902 198
146 3300005843 Ga0068860_100158353 Ga0068860_1001583532 198
147 3300005844 Ga0068862_100075981 Ga0068862_1000759813 198
148 3300005844 Ga0068862_101770415 Ga0068862_1017704151 198
149 3300005937 Ga0081455_10004845 Ga0081455_100048458 198
150 3300005937 Ga0081455_10007688 Ga0081455_100076886 198
151 3300005937 Ga0081455_10140554 Ga0081455_101405542 198
152 3300005937 Ga0081455_10146372 Ga0081455_101463722 198
153 3300005983 Ga0081540_1001895 Ga0081540_10018954 198
154 3300005983 Ga0081540_1095076 Ga0081540_10950762 198
155 3300005985 Ga0081539_10007439 Ga0081539_100074394 198
156 3300005985 Ga0081539_10051929 Ga0081539_100519292 198
157 3300006028 Ga0070717_10041558 Ga0070717_100415582 198
158 3300006028 Ga0070717_10396660 Ga0070717_103966602 198
159 3300006058 Ga0075432_10057389 Ga0075432_100573893 198
160 3300006163 Ga0070715_10182754 Ga0070715_101827542 198
161 3300006163 Ga0070715_10230644 Ga0070715_102306442 198
162 3300006173 Ga0070716_100002739 Ga0070716_1000027393 198
163 3300006173 Ga0070716_100064452 Ga0070716_1000644523 198
164 3300006173 Ga0070716_100479816 Ga0070716_1004798162 198
165 3300006175 Ga0070712_100032248 Ga0070712_1000322484 198
166 3300006175 Ga0070712_100059274 Ga0070712_1000592744 198
167 3300006175 Ga0070712_100214830 Ga0070712_1002148303 198
168 3300006175 Ga0070712_100301003 Ga0070712_1003010032 198
169 3300006237 Ga0097621_100388187 Ga0097621_1003881872 198
170 3300006358 Ga0068871_100101456 Ga0068871_1001014562 198
171 3300006358 Ga0068871_100155110 Ga0068871_1001551102 198
172 3300006844 Ga0075428_100015909 Ga0075428_1000159092 198
173 3300006844 Ga0075428_100142897 Ga0075428_1001428973 198
174 3300006844 Ga0075428_100769692 Ga0075428_1007696922 198
175 3300006847 Ga0075431_100061420 Ga0075431_1000614205 198
176 3300006847 Ga0075431_100179683 Ga0075431_1001796832 198
177 3300006852 Ga0075433_10001383 Ga0075433_100013835 198
178 3300006852 Ga0075433_10070179 Ga0075433_100701794 198
179 3300006871 Ga0075434_100127613 Ga0075434_1001276132 198
180 3300006871 Ga0075434_100181774 Ga0075434_1001817743 198
181 3300006871 Ga0075434_100456433 Ga0075434_1004564332 198
182 3300006880 Ga0075429_100195463 Ga0075429_1001954633 198
183 3300006914 Ga0075436_100680107 Ga0075436_1006801072 198
184 3300006931 Ga0097620_100073668 Ga0097620_1000736684 198
185 3300007076 Ga0075435_100002801 Ga0075435_1000028015 198
186 3300007076 Ga0075435_100233545 Ga0075435_1002335452 198
187 3300007265 Ga0099794_10018056 Ga0099794_100180563 198
188 3300009093 Ga0105240_10287050 Ga0105240_102870502 198
189 3300009094 Ga0111539_10050029 Ga0111539_100500297 198
190 3300009094 Ga0111539_10128030 Ga0111539_101280302 198
191 3300009094 Ga0111539_10220968 Ga0111539_102209682 198
192 3300009094 Ga0111539_10231957 Ga0111539_102319573 198
193 3300009094 Ga0111539_10259189 Ga0111539_102591892 198
194 3300009094 Ga0111539_10259931 Ga0111539_102599312 198
195 3300009098 Ga0105245_10008336 Ga0105245_100083365 198
196 3300009098 Ga0105245_10023086 Ga0105245_100230865 198
197 3300009098 Ga0105245_10110833 Ga0105245_101108332 198
198 3300009101 Ga0105247_10103705 Ga0105247_101037053 198
199 3300009147 Ga0114129_10008944 Ga0114129_100089443 198
200 3300009147 Ga0114129_10049778 Ga0114129_100497786 198
201 3300009147 Ga0114129_10189590 Ga0114129_101895904 198
202 3300009147 Ga0114129_10379758 Ga0114129_103797582 198
203 3300009147 Ga0114129_10728427 Ga0114129_107284272 198
204 3300009147 Ga0114129_10800526 Ga0114129_108005262 198
205 3300009148 Ga0105243_10021052 Ga0105243_100210525 198
206 3300009174 Ga0105241_10001358 Ga0105241_1000135814 198
207 3300009174 Ga0105241_10005023 Ga0105241_100050239 198
208 3300009176 Ga0105242_10227748 Ga0105242_102277483 198
209 3300009176 Ga0105242_10787349 Ga0105242_107873492 198
210 3300009177 Ga0105248_10104746 Ga0105248_101047463 198
211 3300009177 Ga0105248_10337085 Ga0105248_103370852 198
212 3300009545 Ga0105237_10169999 Ga0105237_101699993 198
213 3300009545 Ga0105237_10174969 Ga0105237_101749692 198
214 3300009551 Ga0105238_10987121 Ga0105238_109871212 198
215 3300009553 Ga0105249_10003690 Ga0105249_100036908 198
216 3300009553 Ga0105249_10264419 Ga0105249_102644193 198
217 3300009553 Ga0105249_10305412 Ga0105249_103054123 198
218 3300010159 Ga0099796_10243713 Ga0099796_102437131 198
219 3300010375 Ga0105239_10002874 Ga0105239_1000287414 198
220 3300010375 Ga0105239_10215557 Ga0105239_102155572 198
221 3300010375 Ga0105239_10552305 Ga0105239_105523052 198
222 3300013102 Ga0157371_10283549 Ga0157371_102835492 198
223 3300013105 Ga0157369_10037595 Ga0157369_100375955 198
224 3300013105 Ga0157369_10166977 Ga0157369_101669773 198
225 3300013296 Ga0157374_10041547 Ga0157374_100415473 198
226 3300013296 Ga0157374_10341311 Ga0157374_103413112 198
227 3300013297 Ga0157378_10025962 Ga0157378_100259622 198
228 3300013297 Ga0157378_10090409 Ga0157378_100904093 198
229 3300013306 Ga0163162_10023977 Ga0163162_100239775 198
230 3300013306 Ga0163162_10046179 Ga0163162_100461793 198
231 3300013306 Ga0163162_10103819 Ga0163162_101038192 198
232 3300013307 Ga0157372_10016934 Ga0157372_100169345 198
233 3300013307 Ga0157372_10237353 Ga0157372_102373533 198
234 3300013307 Ga0157372_10421985 Ga0157372_104219852 198
235 3300013308 Ga0157375_10144508 Ga0157375_101445082 198
236 3300013308 Ga0157375_10235290 Ga0157375_102352903 198
237 3300014325 Ga0163163_11257930 Ga0163163_112579301 198
238 3300014969 Ga0157376_10052472 Ga0157376_100524723 198
239 3300014969 Ga0157376_10325118 Ga0157376_103251181 198
240 3300021384 Ga0213876_10019103 Ga0213876_100191034 198
241 3300021441 Ga0213871_10014362 Ga0213871_100143622 198
242 3300021441 Ga0213871_10038778 Ga0213871_100387782 198
243 3300025271 Ga0207666_1000123 Ga0207666_10001234 198
244 3300025271 Ga0207666_1001808 Ga0207666_10018083 198
245 3300025290 Ga0207673_1001030 Ga0207673_10010302 198
246 3300025315 Ga0207697_10001238 Ga0207697_1000123811 198
247 3300025315 Ga0207697_10001995 Ga0207697_100019952 198
248 3300025315 Ga0207697_10002939 Ga0207697_100029392 198
249 3300025315 Ga0207697_10021493 Ga0207697_100214933 198
250 3300025315 Ga0207697_10032032 Ga0207697_100320323 198
251 3300025315 Ga0207697_10159021 Ga0207697_101590211 198
252 3300025903 Ga0207680_10014734 Ga0207680_100147344 198
253 3300025903 Ga0207680_10074933 Ga0207680_100749332 198
254 3300025906 Ga0207699_10147675 Ga0207699_101476752 198
255 3300025907 Ga0207645_10000302 Ga0207645_1000030236 198
256 3300025907 Ga0207645_10040171 Ga0207645_100401712 198
257 3300025909 Ga0207705_10077231 Ga0207705_100772312 198
258 3300025910 Ga0207684_10003171 Ga0207684_100031718 198
259 3300025910 Ga0207684_10003738 Ga0207684_100037389 198
260 3300025910 Ga0207684_10072420 Ga0207684_100724204 198
261 3300025910 Ga0207684_10525435 Ga0207684_105254352 198
262 3300025911 Ga0207654_10006668 Ga0207654_100066684 198
263 3300025911 Ga0207654_10164726 Ga0207654_101647261 198
264 3300025912 Ga0207707_10225211 Ga0207707_102252112 198
265 3300025913 Ga0207695_10002458 Ga0207695_1000245825 198
266 3300025915 Ga0207693_10005752 Ga0207693_100057529 198
267 3300025915 Ga0207693_10014810 Ga0207693_100148103 198
268 3300025916 Ga0207663_10070240 Ga0207663_100702402 198
269 3300025918 Ga0207662_10000172 Ga0207662_100001723 198
270 3300025919 Ga0207657_10167997 Ga0207657_101679972 198
271 3300025920 Ga0207649_10084921 Ga0207649_100849212 198
272 3300025920 Ga0207649_10173706 Ga0207649_101737062 198
273 3300025921 Ga0207652_10118881 Ga0207652_101188813 198
274 3300025922 Ga0207646_10002009 Ga0207646_100020099 198
275 3300025922 Ga0207646_10032192 Ga0207646_100321924 198
276 3300025922 Ga0207646_10254446 Ga0207646_102544462 198
277 3300025923 Ga0207681_10020083 Ga0207681_100200832 198
278 3300025923 Ga0207681_10111497 Ga0207681_101114973 198
279 3300025923 Ga0207681_10245102 Ga0207681_102451022 198
280 3300025923 Ga0207681_10660318 Ga0207681_106603181 198
281 3300025924 Ga0207694_10417367 Ga0207694_104173671 198
282 3300025925 Ga0207650_10228549 Ga0207650_102285492 198
283 3300025926 Ga0207659_10174701 Ga0207659_101747012 198
284 3300025926 Ga0207659_10296711 Ga0207659_102967112 198
285 3300025927 Ga0207687_10021588 Ga0207687_100215884 198
286 3300025927 Ga0207687_10168816 Ga0207687_101688162 198
287 3300025927 Ga0207687_10231011 Ga0207687_102310112 198
288 3300025928 Ga0207700_10110012 Ga0207700_101100123 198
289 3300025928 Ga0207700_10118909 Ga0207700_101189094 198
290 3300025928 Ga0207700_10314776 Ga0207700_103147763 198
291 3300025929 Ga0207664_10737977 Ga0207664_107379772 198
292 3300025931 Ga0207644_10021870 Ga0207644_100218705 198
293 3300025931 Ga0207644_10120860 Ga0207644_101208602 198
294 3300025931 Ga0207644_10138752 Ga0207644_101387523 198
295 3300025932 Ga0207690_10644502 Ga0207690_106445021 198
296 3300025933 Ga0207706_10000429 Ga0207706_1000042913 198
297 3300025933 Ga0207706_10039496 Ga0207706_100394963 198
298 3300025934 Ga0207686_10328437 Ga0207686_103284372 198
299 3300025936 Ga0207670_10048557 Ga0207670_100485572 198
300 3300025936 Ga0207670_10057761 Ga0207670_100577613 198
301 3300025936 Ga0207670_10197104 Ga0207670_101971043 198
302 3300025936 Ga0207670_10295521 Ga0207670_102955212 198
303 3300025937 Ga0207669_10280123 Ga0207669_102801232 198
304 3300025938 Ga0207704_10246722 Ga0207704_102467222 198
305 3300025939 Ga0207665_10000451 Ga0207665_1000045120 198
306 3300025939 Ga0207665_10021258 Ga0207665_100212584 198
307 3300025940 Ga0207691_10047677 Ga0207691_100476774 198
308 3300025940 Ga0207691_10142258 Ga0207691_101422582 198
309 3300025940 Ga0207691_10505079 Ga0207691_105050792 198
310 3300025941 Ga0207711_10113759 Ga0207711_101137594 198
311 3300025942 Ga0207689_10000110 Ga0207689_1000011071 198
312 3300025942 Ga0207689_10021613 Ga0207689_100216133 198
313 3300025944 Ga0207661_10204013 Ga0207661_102040132 198
314 3300025944 Ga0207661_10632821 Ga0207661_106328212 198
315 3300025945 Ga0207679_10285674 Ga0207679_102856742 198
316 3300025949 Ga0207667_10000479 Ga0207667_100004793 198
317 3300025949 Ga0207667_10618417 Ga0207667_106184172 198
318 3300025960 Ga0207651_10073276 Ga0207651_100732763 198
319 3300025961 Ga0207712_10020789 Ga0207712_100207895 198
320 3300025961 Ga0207712_10266245 Ga0207712_102662452 198
321 3300025972 Ga0207668_10024912 Ga0207668_100249122 198
322 3300025986 Ga0207658_10016888 Ga0207658_100168885 198
323 3300026023 Ga0207677_10017805 Ga0207677_100178052 198
324 3300026023 Ga0207677_11071929 Ga0207677_110719292 198
325 3300026035 Ga0207703_10077323 Ga0207703_100773232 198
326 3300026035 Ga0207703_10922818 Ga0207703_109228181 198
327 3300026067 Ga0207678_10030759 Ga0207678_100307593 198
328 3300026089 Ga0207648_10273575 Ga0207648_102735752 198
329 3300026118 Ga0207675_100102588 Ga0207675_1001025884 198
330 3300026118 Ga0207675_100201505 Ga0207675_1002015053 198
331 3300026121 Ga0207683_10348980 Ga0207683_103489801 198
332 3300027876 Ga0209974_10101128 Ga0209974_101011282 198
333 3300027907 Ga0207428_10023042 Ga0207428_100230425 198
334 3300028379 Ga0268266_10003782 Ga0268266_1000378212 198
335 3300028379 Ga0268266_10177237 Ga0268266_101772373 198
336 3300028379 Ga0268266_10600956 Ga0268266_106009562 198
337 3300028380 Ga0268265_10245187 Ga0268265_102451873 198
338 3300028381 Ga0268264_10109234 Ga0268264_101092342 198
339 3300028381 Ga0268264_10446209 Ga0268264_104462092 198
340 3300028653 Ga0265323_10009792 Ga0265323_100097922 198
341 3300028653 Ga0265323_10014849 Ga0265323_100148493 198
342 3300031235 Ga0265330_10000317 Ga0265330_1000031721 198
343 3300031235 Ga0265330_10044428 Ga0265330_100444281 198
344 3300031238 Ga0265332_10001593 Ga0265332_100015938 198
345 3300031240 Ga0265320_10266380 Ga0265320_102663801 198
346 3300031241 Ga0265325_10062361 Ga0265325_100623612 198
347 3300031242 Ga0265329_10002813 Ga0265329_100028138 198
348 3300031249 Ga0265339_10029394 Ga0265339_100293941 198
349 3300031250 Ga0265331_10021212 Ga0265331_100212123 198
350 3300031251 Ga0265327_10001510 Ga0265327_100015107 198
351 3300031344 Ga0265316_10000399 Ga0265316_1000039935 198
352 3300031344 Ga0265316_10016900 Ga0265316_100169006 198
353 3300031344 Ga0265316_10032551 Ga0265316_100325514 198
354 3300031344 Ga0265316_10037925 Ga0265316_100379252 198
355 3300031344 Ga0265316_10321287 Ga0265316_103212871 198
356 3300031456 Ga0307513_10051938 Ga0307513_100519384 198
357 3300031595 Ga0265313_10012632 Ga0265313_100126327 198
358 3300031711 Ga0265314_10000532 Ga0265314_100005329 198
359 3300031712 Ga0265342_10000369 Ga0265342_100003699 198
360 3300031712 Ga0265342_10021687 Ga0265342_100216872 198
361 3300031712 Ga0265342_10039132 Ga0265342_100391323 198
362 3300031712 Ga0265342_10201115 Ga0265342_102011151 198
363 3300031712 Ga0265342_10245706 Ga0265342_102457062 198
364 3300035089 Ga0373944_0068353 Ga0373944_0068353_44_640 198
365 3300035692 Ga0373935_0060037 Ga0373935_0060037_1588_2199 198
366 3300035692 Ga0373935_0089073 Ga0373935_0089073_445_1053 198
367 3300035692 Ga0373935_0146708 Ga0373935_0146708_188_784 198
368 3300035692 Ga0373935_0340781 Ga0373935_0340781_356_952 198
369 3300035695 Ga0373927_0001751 Ga0373927_0001751_8532_9140 198
370 3300035695 Ga0373927_0206173 Ga0373927_0206173_637_1233 198
371 3300035695 Ga0373927_0349768 Ga0373927_0349768_282_881 198
372 3300035725 Ga0373947_0235123 Ga0373947_0235123_566_1162 198
373 3300035725 Ga0373947_0587888 Ga0373947_0587888_123_719 198
374 3300036401 Ga0373937_0070632 Ga0373937_0070632_1821_2417 198
375 3300037068 Ga0373925_0063780 Ga0373925_0063780_2006_2602 198
376 3300037068 Ga0373925_0613539 Ga0373925_0613539_267_863 198
377 3300037312 Ga0395899_0000032 Ga0395899_0000032_141873_142472 198
378 3300037471 Ga0395905_0400803 Ga0395905_0400803_536_1144 198
379 3300037853 Ga0436364_0080357 Ga0436364_0080357_1267_1866 198
380 3300039437 Ga0436365_1522897 Ga0436365_1522897_17558_18157 198
381 3300039438 Ga0436360_0616931 Ga0436360_0616931_470_1072 198
382 3300039438 Ga0436360_1315258 Ga0436360_1315258_86_700 198
383 3300039438 Ga0436360_1325435 Ga0436360_1325435_89_688 198
384 3300039447 Ga0436361_0388043 Ga0436361_0388043_155_766 198
385 3300039447 Ga0436361_0557908 Ga0436361_0557908_158_760 198
386 3300039447 Ga0436361_0700772 Ga0436361_0700772_1282_1944 198
387 3300039447 Ga0436361_0893372 Ga0436361_0893372_7244_7858 198
388 3300039447 Ga0436361_1179632 Ga0436361_1179632_803_1411 198
389 3300039447 Ga0436361_1191486 Ga0436361_1191486_164_784 198
390 3300039453 Ga0436362_0248233 Ga0436362_0248233_5626_6228 198
391 3300041486 Ga0451807_0293516 Ga0451807_0293516_189_800 198
392 3300041512 Ga0451853_1143010 Ga0451853_1143010_653_1249 198
393 3300042009 Ga0439451_002607 Ga0439451_002607_739_1335 198
394 3300042437 Ga0439444_0005426 Ga0439444_0005426_902_1498 198
395 3300042876 Ga0451577_0002312 Ga0451577_0002312_20648_21244 198
396 3300042876 Ga0451577_0279471 Ga0451577_0279471_51_650 198
397 3300042876 Ga0451577_0501808 Ga0451577_0501808_358_957 198
398 3300044673 Ga0453683_0309552 Ga0453683_0309552_102_710 198
399 3300044712 Ga0453684_0194454 Ga0453684_0194454_506_1102 198
400 3300044712 Ga0453684_0279045 Ga0453684_0279045_428_1027 198
401 3300045051 Ga0451576_0122983 Ga0451576_0122983_1733_2332 198
402 3300045051 Ga0451576_0130410 Ga0451576_0130410_1817_2428 198
403 3300045051 Ga0451576_0137441 Ga0451576_0137441_1637_2236 198
404 3300045051 Ga0451576_0369722 Ga0451576_0369722_734_1330 198
405 3300046459 Ga0495629_0322023 Ga0495629_0322023_323_919 198
406 3300046517 Ga0495630_0006461 Ga0495630_0006461_2035_2631 198
407 3300046517 Ga0495630_0584004 Ga0495630_0584004_108_704 198
408 3300046522 Ga0495643_0000140 Ga0495643_0000140_7614_8210 198
409 3300046529 Ga0495652_0051203 Ga0495652_0051203_2841_3437 198
410 3300046535 Ga0495586_0024357 Ga0495586_0024357_1461_2057 198
411 3300046536 Ga0495587_0226618 Ga0495587_0226618_238_834 198
412 3300046642 Ga0495634_0035284 Ga0495634_0035284_1892_2488 198
413 3300046664 Ga0495659_0241389 Ga0495659_0241389_111_710 198
414 3300046678 Ga0495599_0180367 Ga0495599_0180367_308_904 198
415 3300046683 Ga0495658_0023116 Ga0495658_0023116_1311_1907 198
416 3300046683 Ga0495658_0234834 Ga0495658_0234834_10_606 198
417 3300046689 Ga0495613_0123373 Ga0495613_0123373_237_833 198
418 3300046690 Ga0495624_0159582 Ga0495624_0159582_375_971 198
419 3300046690 Ga0495624_0233331 Ga0495624_0233331_505_1101 198
420 3300046809 Ga0495600_0157503 Ga0495600_0157503_362_958 198
421 3300047315 Ga0495581_0148013 Ga0495581_0148013_316_912 198
422 3300047315 Ga0495581_0204574 Ga0495581_0204574_133_729 198
423 3300047319 Ga0495674_0152644 Ga0495674_0152644_480_1076 198
424 3300047322 Ga0495680_0114720 Ga0495680_0114720_640_1236 198
425 3300047471 Ga0495684_0027005 Ga0495684_0027005_1933_2529 198
426 3300048088 Ga0495602_0419471 Ga0495602_0419471_35_631 198
427 3300048903 Ga0496100_0156185 Ga0496100_0156185_154_750 198
428 3300048904 Ga0496101_0026464 Ga0496101_0026464_497_1093 198
429 3300048904 Ga0496101_0108311 Ga0496101_0108311_428_1024 198
430 3300048905 Ga0496102_0179187 Ga0496102_0179187_1118_1714 198
431 3300048905 Ga0496102_0907167 Ga0496102_0907167_85_681 198
432 3300048906 Ga0496103_0048797 Ga0496103_0048797_780_1376 198
433 3300048907 Ga0496104_0060283 Ga0496104_0060283_1998_2594 198
434 3300048907 Ga0496104_0066756 Ga0496104_0066756_1602_2198 198
435 3300048907 Ga0496104_0247574 Ga0496104_0247574_758_1354 198
436 3300048908 Ga0496105_0025727 Ga0496105_0025727_1950_2546 198
437 3300048908 Ga0496105_0064221 Ga0496105_0064221_2122_2718 198
438 3300048908 Ga0496105_0493120 Ga0496105_0493120_200_796 198
439 3300048911 Ga0496108_0017052 Ga0496108_0017052_2729_3325 198
440 3300048912 Ga0496109_0114700 Ga0496109_0114700_601_1197 198
441 3300048914 Ga0496111_0094905 Ga0496111_0094905_321_917 198
442 3300048914 Ga0496111_0416999 Ga0496111_0416999_308_904 198
443 3300048915 Ga0496112_0066113 Ga0496112_0066113_336_932 198
444 3300048915 Ga0496112_0158833 Ga0496112_0158833_1447_2043 198
445 3300048915 Ga0496112_0187685 Ga0496112_0187685_379_975 198
446 3300048916 Ga0496113_0005828 Ga0496113_0005828_3839_4435 198
447 3300048917 Ga0496114_0065416 Ga0496114_0065416_1299_1895 198
448 3300048918 Ga0496115_0010534 Ga0496115_0010534_5898_6494 198
449 3300048918 Ga0496115_0125813 Ga0496115_0125813_869_1465 198
450 3300048918 Ga0496115_0872294 Ga0496115_0872294_71_667 198
451 3300048929 Ga0496126_0004587 Ga0496126_0004587_7760_8374 198
452 3300049573 Ga0501037_0214866 Ga0501037_0214866_715_1326 198
453 3300049581 Ga0501047_0331523 Ga0501047_0331523_671_1276 198
454 3300049592 Ga0501076_0246810 Ga0501076_0246810_677_1276 198
455 3300049683 Ga0501253_033305 Ga0501253_033305_188_799 198
456 3300049741 Ga0501079_0120443 Ga0501079_0120443_173_772 198
457 3300049823 Ga0501044_0002707 Ga0501044_0002707_12185_12796 198
458 3300049824 Ga0501045_0374888 Ga0501045_0374888_314_910 198
459 3300050507 nmdc:mga05p37_106729_c1 nmdc:mga05p37_106729_c1_1793_2389 198
460 3300050507 nmdc:mga05p37_1187644_c1 nmdc:mga05p37_1187644_c1_82_681 198
461 3300050507 nmdc:mga05p37_284509_c1 nmdc:mga05p37_284509_c1_784_1380 198
462 3300050507 nmdc:mga05p37_41784_c1 nmdc:mga05p37_41784_c1_1358_1999 198
463 3300050507 nmdc:mga05p37_536796_c1 nmdc:mga05p37_536796_c1_450_1055 198
464 3300050508 nmdc:mga09592_585617_c1 nmdc:mga09592_585617_c1_34_633 198
465 3300050510 nmdc:mga06r32_135010_c1 nmdc:mga06r32_135010_c1_1539_2138 198
466 3300050510 nmdc:mga06r32_282494_c1 nmdc:mga06r32_282494_c1_522_1163 198
467 3300050511 nmdc:mga08y16_61283_c1 nmdc:mga08y16_61283_c1_2487_3086 198
468 3300050512 nmdc:mga0n895_153634_c1 nmdc:mga0n895_153634_c1_885_1484 198
469 3300050512 nmdc:mga0n895_154542_c1 nmdc:mga0n895_154542_c1_351_950 198
470 3300050512 nmdc:mga0n895_290077_c1 nmdc:mga0n895_290077_c1_519_1160 198
471 3300050512 nmdc:mga0n895_5168_c1 nmdc:mga0n895_5168_c1_8713_9312 198
472 3300050512 nmdc:mga0n895_585400_c1 nmdc:mga0n895_585400_c1_17_613 198
473 3300050512 nmdc:mga0n895_747784_c1 nmdc:mga0n895_747784_c1_175_771 198
474 3300050512 nmdc:mga0n895_87431_c1 nmdc:mga0n895_87431_c1_775_1395 198
475 3300050512 nmdc:mga0n895_9204_c1 nmdc:mga0n895_9204_c1_949_1548 198
476 3300050513 nmdc:mga0rr50_4476_c1 nmdc:mga0rr50_4476_c1_989_1609 198
477 3300050513 nmdc:mga0rr50_4911_c1 nmdc:mga0rr50_4911_c1_6672_7271 198
478 3300050514 nmdc:mga08x19_229260_c2 nmdc:mga08x19_229260_c2_163_783 198
479 3300050514 nmdc:mga08x19_9734_c1 nmdc:mga08x19_9734_c1_114_713 198
480 3300050515 nmdc:mga0a205_113461_c1 nmdc:mga0a205_113461_c1_1635_2234 198
481 3300050515 nmdc:mga0a205_1282_c1 nmdc:mga0a205_1282_c1_16345_16944 198
482 3300050515 nmdc:mga0a205_1784_c1 nmdc:mga0a205_1784_c1_5856_6455 198
483 3300050515 nmdc:mga0a205_18752_c1 nmdc:mga0a205_18752_c1_2536_3135 198
484 3300050515 nmdc:mga0a205_394606_c1 nmdc:mga0a205_394606_c1_260_856 198
485 3300050515 nmdc:mga0a205_63331_c1 nmdc:mga0a205_63331_c1_2194_2793 198
486 3300053085 Ga0495619_0045681 Ga0495619_0045681_1381_1977 198
487 3300053178 Ga0500637_0006632 Ga0500637_0006632_2821_3420 198
488 3300054114 Ga0501084_0005991 Ga0501084_0005991_2146_2787 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13580

SIS_2

SIS domain

2

140

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i01-assembly1.cif.gz_C structure of phosphoheptose isomerase gmha from neisseria gonorrhoeae 0.8621 4 182
5i01-assembly1.cif.gz_B structure of phosphoheptose isomerase gmha from neisseria gonorrhoeae 0.8518 4 182
2x3y-assembly1.cif.gz_C crystal structure of gmha from burkholderia pseudomallei 0.8394 3 182
2x3y-assembly2.cif.gz_H crystal structure of gmha from burkholderia pseudomallei 0.8366 3 182
7en5-assembly1.cif.gz_A the crystal structure of escherichia coli murr in complex with n-acetylglucosamine-6-phosphate 0.834 11 182
ID Description Score Start End Superfamily
5i01C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8621 4 182 3.40.50.10490
af_P0ACS7_105_289_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8423 8 182 3.40.50.10490
2x3yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8397 3 182 3.40.50.10490
af_P46118_92_277_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8305 5 183 3.40.50.10490
2i2wB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8264 5 182 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A2V6RC29-F1-model_v4 Sugar isomerase 0.9878 105 196 GO:0016853
GO:0097367
GO:1901135
AF-A0A7V8T0J9-F1-model_v4 Sugar isomerase 0.9738 88 194 GO:0016853
GO:0097367
GO:1901135
AF-A0A381ZCB5-F1-model_v4 SIS domain-containing protein 0.9682 1 189 GO:0097367
GO:1901135
AF-A0A2V5XBY7-F1-model_v4 Sugar isomerase 0.9677 98 195 GO:0016853
GO:0097367
GO:1901135
AF-A0A2V8KU17-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9653 1 196 GO:0005737
GO:0005975
GO:0016791
GO:0097367
GO:1901135

Feature Viewer

pLDDT pTM Quality
91.22 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map