F453535
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 488 | 262 | 487 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300002126|JGI24035J26624_1015562|JGI24035J26624_10155622 |
| Length | 196 |
| Sequence | MSYSKQHLREASEIVAKLDPTLCEKAVELLAAVRARGGRLFILGVGGSAGNASHAVNDFRKLAGIEAYAPTDNVSELTARTNDDGWPSVFAEWLKGSRLNGKDAILVLSVGGGSHNVSPNLVGALQLAKERGSAILGIVGRDGGYTAQVADVAIVIPTVNPANITPHTEAFQAVVWHLWISHPALKVAETKWESMK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 112 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 173 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 203 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 205 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 206 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 207 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 208 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 243 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 248 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 261 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 262 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0.2 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.41 |
| Nodule | 0 |
| Rhizoplane | 5.53 |
| Rhizosphere | 92.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_5376679 | 2162886012 | Bacteria | 906 |
| 2 | CNXas_1000001 | 3300000545 | Bacteria | 91563 |
| 3 | JGI24035J26624_1015562 | 3300002126 | Bacteria | 780 |
| 4 | rootH2_10000721 | 3300003320 | Bacteria | 45836 |
| 5 | Ga0065703_1018758 | 3300005272 | Bacteria | 13579 |
| 6 | Ga0065714_10134876 | 3300005288 | Bacteria | 1218 |
| 7 | Ga0065712_10000573 | 3300005290 | Bacteria | 13456 |
| 8 | Ga0065712_10008601 | 3300005290 | Unclassified | 2900 |
| 9 | Ga0065712_10023745 | 3300005290 | Bacteria | 1031 |
| 10 | Ga0065715_10002065 | 3300005293 | Bacteria | 6776 |
| 11 | Ga0065715_10009496 | 3300005293 | Unclassified | 4020 |
| 12 | Ga0065715_10105554 | 3300005293 | Unclassified | 2885 |
| 13 | Ga0065715_10112402 | 3300005293 | Bacteria | 2531 |
| 14 | Ga0065715_10349752 | 3300005293 | Bacteria | 953 |
| 15 | Ga0070676_10006268 | 3300005328 | Bacteria | 6354 |
| 16 | Ga0070676_10113891 | 3300005328 | Bacteria | 1688 |
| 17 | Ga0070683_100017316 | 3300005329 | Bacteria | 6368 |
| 18 | Ga0070683_100333309 | 3300005329 | Bacteria | 1445 |
| 19 | Ga0070690_100087326 | 3300005330 | Bacteria | 2048 |
| 20 | Ga0070690_100110619 | 3300005330 | Bacteria | 1833 |
| 21 | Ga0070670_100171527 | 3300005331 | Bacteria | 1882 |
| 22 | Ga0068869_100003463 | 3300005334 | Bacteria | 9647 |
| 23 | Ga0068869_100027986 | 3300005334 | Unclassified | 3934 |
| 24 | Ga0070666_10040986 | 3300005335 | Unclassified | 3093 |
| 25 | Ga0070680_100158169 | 3300005336 | Unclassified | 1904 |
| 26 | Ga0070682_100136674 | 3300005337 | Unclassified | 1666 |
| 27 | Ga0068868_100026335 | 3300005338 | Unclassified | 4431 |
| 28 | Ga0068868_100145469 | 3300005338 | Unclassified | 1949 |
| 29 | Ga0070689_100050771 | 3300005340 | Unclassified | 3205 |
| 30 | Ga0070689_100066480 | 3300005340 | Unclassified | 2809 |
| 31 | Ga0070687_100003550 | 3300005343 | Bacteria | 6073 |
| 32 | Ga0070661_100040652 | 3300005344 | Bacteria | 3393 |
| 33 | Ga0070661_100080737 | 3300005344 | Unclassified | 2400 |
| 34 | Ga0070668_100015168 | 3300005347 | Bacteria | 5758 |
| 35 | Ga0070669_100018560 | 3300005353 | Bacteria | 4970 |
| 36 | Ga0070669_100043052 | 3300005353 | Bacteria | 3287 |
| 37 | Ga0070669_100319157 | 3300005353 | Bacteria | 1254 |
| 38 | Ga0070675_100030828 | 3300005354 | Bacteria | 4331 |
| 39 | Ga0070675_100038169 | 3300005354 | Unclassified | 3913 |
| 40 | Ga0070675_100194796 | 3300005354 | Unclassified | 1757 |
| 41 | Ga0070671_100026689 | 3300005355 | Unclassified | 4749 |
| 42 | Ga0070671_100342934 | 3300005355 | Unclassified | 1275 |
| 43 | Ga0070674_100251664 | 3300005356 | Bacteria | 1388 |
| 44 | Ga0070673_100030088 | 3300005364 | Bacteria | 4058 |
| 45 | Ga0070673_100721119 | 3300005364 | Unclassified | 917 |
| 46 | Ga0070688_100004364 | 3300005365 | Bacteria | 7356 |
| 47 | Ga0070688_100058535 | 3300005365 | Unclassified | 2426 |
| 48 | Ga0070688_100067256 | 3300005365 | Bacteria | 2282 |
| 49 | Ga0070688_100089148 | 3300005365 | Unclassified | 2012 |
| 50 | Ga0070688_100230769 | 3300005365 | Unclassified | 1309 |
| 51 | Ga0070659_100018402 | 3300005366 | Bacteria | 5272 |
| 52 | Ga0070659_100453396 | 3300005366 | Unclassified | 1088 |
| 53 | Ga0070667_100071001 | 3300005367 | Unclassified | 2965 |
| 54 | Ga0070667_100240371 | 3300005367 | Bacteria | 1617 |
| 55 | Ga0070709_10127675 | 3300005434 | Bacteria | 1732 |
| 56 | Ga0070714_100811144 | 3300005435 | Unclassified | 907 |
| 57 | Ga0070713_100054568 | 3300005436 | Unclassified | 3316 |
| 58 | Ga0070713_100236371 | 3300005436 | Bacteria | 1662 |
| 59 | Ga0070713_100368601 | 3300005436 | Bacteria | 1336 |
| 60 | Ga0070713_100400500 | 3300005436 | Bacteria | 1282 |
| 61 | Ga0070713_100636382 | 3300005436 | Bacteria | 1015 |
| 62 | Ga0070710_10014716 | 3300005437 | Unclassified | 3942 |
| 63 | Ga0070710_10212857 | 3300005437 | Unclassified | 1226 |
| 64 | Ga0070701_10097779 | 3300005438 | Bacteria | 1620 |
| 65 | Ga0070711_100020899 | 3300005439 | Unclassified | 4226 |
| 66 | Ga0070711_100119790 | 3300005439 | Unclassified | 1945 |
| 67 | Ga0070705_100000850 | 3300005440 | Bacteria | 17152 |
| 68 | Ga0070700_100191717 | 3300005441 | Bacteria | 1429 |
| 69 | Ga0070694_100009414 | 3300005444 | Bacteria | 5995 |
| 70 | Ga0070694_100049910 | 3300005444 | Bacteria | 2819 |
| 71 | Ga0070708_100036050 | 3300005445 | Bacteria | 4312 |
| 72 | Ga0070708_100043453 | 3300005445 | Bacteria | 3949 |
| 73 | Ga0070708_100068697 | 3300005445 | Bacteria | 3185 |
| 74 | Ga0070708_100277914 | 3300005445 | Unclassified | 1576 |
| 75 | Ga0070708_100502593 | 3300005445 | Bacteria | 1144 |
| 76 | Ga0070663_100185665 | 3300005455 | Bacteria | 1616 |
| 77 | Ga0070678_100096613 | 3300005456 | Bacteria | 2279 |
| 78 | Ga0070662_100024490 | 3300005457 | Bacteria | 4158 |
| 79 | Ga0070662_100054016 | 3300005457 | Bacteria | 2910 |
| 80 | Ga0070681_10033106 | 3300005458 | Bacteria | 5188 |
| 81 | Ga0070685_10118580 | 3300005466 | Bacteria | 1641 |
| 82 | Ga0070706_100002884 | 3300005467 | Bacteria | 17131 |
| 83 | Ga0070706_100103216 | 3300005467 | Bacteria | 2651 |
| 84 | Ga0070706_100507520 | 3300005467 | Unclassified | 1122 |
| 85 | Ga0070707_100002697 | 3300005468 | Bacteria | 16885 |
| 86 | Ga0070707_100008675 | 3300005468 | Bacteria | 9431 |
| 87 | Ga0070707_100027339 | 3300005468 | Bacteria | 5427 |
| 88 | Ga0070707_100150623 | 3300005468 | Unclassified | 2265 |
| 89 | Ga0070707_100172233 | 3300005468 | Bacteria | 2109 |
| 90 | Ga0070707_100255725 | 3300005468 | Bacteria | 1704 |
| 91 | Ga0070698_100004923 | 3300005471 | Bacteria | 14651 |
| 92 | Ga0070698_100058213 | 3300005471 | Bacteria | 3907 |
| 93 | Ga0070699_100069023 | 3300005518 | Bacteria | 3071 |
| 94 | Ga0070699_100081466 | 3300005518 | Unclassified | 2821 |
| 95 | Ga0070699_100782434 | 3300005518 | Unclassified | 873 |
| 96 | Ga0070679_100012926 | 3300005530 | Bacteria | 7996 |
| 97 | Ga0070684_100081933 | 3300005535 | Bacteria | 2856 |
| 98 | Ga0070684_100307837 | 3300005535 | Unclassified | 1454 |
| 99 | Ga0070672_100049690 | 3300005543 | Bacteria | 3264 |
| 100 | Ga0070686_100067615 | 3300005544 | Unclassified | 2328 |
| 101 | Ga0070695_100005537 | 3300005545 | Bacteria | 7435 |
| 102 | Ga0070695_100266923 | 3300005545 | Bacteria | 1252 |
| 103 | Ga0070696_100112424 | 3300005546 | Bacteria | 1963 |
| 104 | Ga0070665_100003323 | 3300005548 | Bacteria | 17234 |
| 105 | Ga0070665_100011586 | 3300005548 | Bacteria | 8916 |
| 106 | Ga0070665_100074929 | 3300005548 | Unclassified | 3390 |
| 107 | Ga0070665_100133133 | 3300005548 | Bacteria | 2488 |
| 108 | Ga0070704_100000116 | 3300005549 | Bacteria | 28451 |
| 109 | Ga0070704_100362593 | 3300005549 | Unclassified | 1226 |
| 110 | Ga0068855_100000058 | 3300005563 | Bacteria | 134718 |
| 111 | Ga0068855_100221047 | 3300005563 | Bacteria | 2124 |
| 112 | Ga0070664_100060747 | 3300005564 | Bacteria | 3219 |
| 113 | Ga0070702_100500763 | 3300005615 | Unclassified | 892 |
| 114 | Ga0068859_100073666 | 3300005617 | Bacteria | 3453 |
| 115 | Ga0068864_100280937 | 3300005618 | Bacteria | 1554 |
| 116 | Ga0068861_100205514 | 3300005719 | Bacteria | 1656 |
| 117 | Ga0068861_100827667 | 3300005719 | Bacteria | 871 |
| 118 | Ga0068863_100141632 | 3300005841 | Bacteria | 2298 |
| 119 | Ga0068858_100096076 | 3300005842 | Bacteria | 2761 |
| 120 | Ga0068858_100381390 | 3300005842 | Bacteria | 1353 |
| 121 | Ga0068860_100158353 | 3300005843 | Unclassified | 2183 |
| 122 | Ga0068862_100075981 | 3300005844 | Bacteria | 2907 |
| 123 | Ga0068862_101770415 | 3300005844 | Bacteria | 627 |
| 124 | Ga0081455_10004845 | 3300005937 | Bacteria | 14934 |
| 125 | Ga0081455_10007688 | 3300005937 | Bacteria | 11316 |
| 126 | Ga0081455_10140554 | 3300005937 | Bacteria | 1876 |
| 127 | Ga0081455_10146372 | 3300005937 | Bacteria | 1827 |
| 128 | Ga0081540_1001895 | 3300005983 | Bacteria | 17513 |
| 129 | Ga0081540_1095076 | 3300005983 | Bacteria | 1300 |
| 130 | Ga0081539_10007439 | 3300005985 | Bacteria | 9984 |
| 131 | Ga0081539_10051929 | 3300005985 | Bacteria | 2307 |
| 132 | Ga0070717_10041558 | 3300006028 | Unclassified | 3748 |
| 133 | Ga0070717_10396660 | 3300006028 | Unclassified | 1239 |
| 134 | Ga0075432_10057389 | 3300006058 | Bacteria | 1381 |
| 135 | Ga0070715_10182754 | 3300006163 | Bacteria | 1053 |
| 136 | Ga0070715_10230644 | 3300006163 | Bacteria | 957 |
| 137 | Ga0070716_100002739 | 3300006173 | Bacteria | 8176 |
| 138 | Ga0070716_100064452 | 3300006173 | Bacteria | 2131 |
| 139 | Ga0070716_100479816 | 3300006173 | Unclassified | 913 |
| 140 | Ga0070712_100032248 | 3300006175 | Unclassified | 3536 |
| 141 | Ga0070712_100059274 | 3300006175 | Unclassified | 2695 |
| 142 | Ga0070712_100214830 | 3300006175 | Bacteria | 1519 |
| 143 | Ga0070712_100301003 | 3300006175 | Unclassified | 1298 |
| 144 | Ga0097621_100388187 | 3300006237 | Bacteria | 1248 |
| 145 | Ga0068871_100101456 | 3300006358 | Bacteria | 2412 |
| 146 | Ga0068871_100155110 | 3300006358 | Bacteria | 1955 |
| 147 | Ga0075428_100015909 | 3300006844 | Bacteria | 8322 |
| 148 | Ga0075428_100142897 | 3300006844 | Bacteria | 2602 |
| 149 | Ga0075428_100769692 | 3300006844 | Unclassified | 1024 |
| 150 | Ga0075431_100061420 | 3300006847 | Bacteria | 3877 |
| 151 | Ga0075431_100179683 | 3300006847 | Bacteria | 2172 |
| 152 | Ga0075433_10001383 | 3300006852 | Bacteria | 17853 |
| 153 | Ga0075433_10070179 | 3300006852 | Bacteria | 3079 |
| 154 | Ga0075434_100127613 | 3300006871 | Bacteria | 2561 |
| 155 | Ga0075434_100181774 | 3300006871 | Bacteria | 2123 |
| 156 | Ga0075434_100456433 | 3300006871 | Unclassified | 1299 |
| 157 | Ga0075429_100195463 | 3300006880 | Bacteria | 1772 |
| 158 | Ga0075436_100680107 | 3300006914 | Bacteria | 761 |
| 159 | Ga0097620_100073668 | 3300006931 | Bacteria | 3453 |
| 160 | Ga0075435_100002801 | 3300007076 | Bacteria | 11656 |
| 161 | Ga0075435_100233545 | 3300007076 | Bacteria | 1563 |
| 162 | Ga0099794_10018056 | 3300007265 | Bacteria | 3157 |
| 163 | Ga0105240_10287050 | 3300009093 | Bacteria | 1888 |
| 164 | Ga0111539_10050029 | 3300009094 | Bacteria | 4980 |
| 165 | Ga0111539_10128030 | 3300009094 | Bacteria | 2974 |
| 166 | Ga0111539_10220968 | 3300009094 | Bacteria | 2206 |
| 167 | Ga0111539_10231957 | 3300009094 | Bacteria | 2149 |
| 168 | Ga0111539_10259189 | 3300009094 | Unclassified | 2024 |
| 169 | Ga0111539_10259931 | 3300009094 | Unclassified | 2021 |
| 170 | Ga0105245_10008336 | 3300009098 | Bacteria | 9057 |
| 171 | Ga0105245_10023086 | 3300009098 | Bacteria | 5459 |
| 172 | Ga0105245_10110833 | 3300009098 | Bacteria | 2552 |
| 173 | Ga0105247_10103705 | 3300009101 | Bacteria | 1821 |
| 174 | Ga0114129_10008944 | 3300009147 | Bacteria | 14271 |
| 175 | Ga0114129_10049778 | 3300009147 | Bacteria | 5887 |
| 176 | Ga0114129_10189590 | 3300009147 | Bacteria | 2793 |
| 177 | Ga0114129_10379758 | 3300009147 | Bacteria | 1866 |
| 178 | Ga0114129_10728427 | 3300009147 | Bacteria | 1272 |
| 179 | Ga0114129_10800526 | 3300009147 | Bacteria | 1202 |
| 180 | Ga0105243_10021052 | 3300009148 | Bacteria | 4949 |
| 181 | Ga0105241_10001358 | 3300009174 | Bacteria | 18632 |
| 182 | Ga0105241_10005023 | 3300009174 | Bacteria | 9768 |
| 183 | Ga0105242_10227748 | 3300009176 | Bacteria | 1669 |
| 184 | Ga0105242_10787349 | 3300009176 | Bacteria | 940 |
| 185 | Ga0105248_10104746 | 3300009177 | Bacteria | 3189 |
| 186 | Ga0105248_10337085 | 3300009177 | Bacteria | 1698 |
| 187 | Ga0105237_10169999 | 3300009545 | Bacteria | 2179 |
| 188 | Ga0105237_10174969 | 3300009545 | Bacteria | 2147 |
| 189 | Ga0105238_10987121 | 3300009551 | Bacteria | 863 |
| 190 | Ga0105249_10003690 | 3300009553 | Bacteria | 13200 |
| 191 | Ga0105249_10264419 | 3300009553 | Unclassified | 1711 |
| 192 | Ga0105249_10305412 | 3300009553 | Bacteria | 1597 |
| 193 | Ga0099796_10243713 | 3300010159 | Bacteria | 744 |
| 194 | Ga0105239_10002874 | 3300010375 | Bacteria | 21541 |
| 195 | Ga0105239_10215557 | 3300010375 | Bacteria | 2152 |
| 196 | Ga0105239_10552305 | 3300010375 | Bacteria | 1312 |
| 197 | Ga0157371_10283549 | 3300013102 | Unclassified | 1197 |
| 198 | Ga0157369_10037595 | 3300013105 | Bacteria | 5300 |
| 199 | Ga0157369_10166977 | 3300013105 | Bacteria | 2320 |
| 200 | Ga0157374_10041547 | 3300013296 | Unclassified | 4239 |
| 201 | Ga0157374_10289711 | 3300013296 | Bacteria | 1618 |
| 202 | Ga0157374_10341311 | 3300013296 | Unclassified | 1487 |
| 203 | Ga0157378_10025962 | 3300013297 | Bacteria | 5162 |
| 204 | Ga0157378_10090409 | 3300013297 | Bacteria | 2782 |
| 205 | Ga0157378_10391958 | 3300013297 | Bacteria | 1366 |
| 206 | Ga0163162_10023977 | 3300013306 | Bacteria | 6021 |
| 207 | Ga0163162_10046179 | 3300013306 | Bacteria | 4366 |
| 208 | Ga0163162_10103819 | 3300013306 | Bacteria | 2936 |
| 209 | Ga0157372_10016934 | 3300013307 | Bacteria | 7825 |
| 210 | Ga0157372_10237353 | 3300013307 | Unclassified | 2115 |
| 211 | Ga0157372_10421985 | 3300013307 | Bacteria | 1555 |
| 212 | Ga0157375_10144508 | 3300013308 | Bacteria | 2508 |
| 213 | Ga0157375_10235290 | 3300013308 | Unclassified | 1991 |
| 214 | Ga0163163_10062327 | 3300014325 | Unclassified | 3695 |
| 215 | Ga0163163_11257930 | 3300014325 | Bacteria | 802 |
| 216 | Ga0157376_10052472 | 3300014969 | Bacteria | 3391 |
| 217 | Ga0157376_10325118 | 3300014969 | Unclassified | 1463 |
| 218 | Ga0213876_10019103 | 3300021384 | Bacteria | 3619 |
| 219 | Ga0213871_10014362 | 3300021441 | Bacteria | 1877 |
| 220 | Ga0213871_10038778 | 3300021441 | Bacteria | 1273 |
| 221 | Ga0207666_1000123 | 3300025271 | Bacteria | 12028 |
| 222 | Ga0207666_1001808 | 3300025271 | Bacteria | 2542 |
| 223 | Ga0207673_1001030 | 3300025290 | Bacteria | 2999 |
| 224 | Ga0207697_10001238 | 3300025315 | Bacteria | 13984 |
| 225 | Ga0207697_10001995 | 3300025315 | Viruses | 10827 |
| 226 | Ga0207697_10002939 | 3300025315 | Bacteria | 8606 |
| 227 | Ga0207697_10005559 | 3300025315 | Bacteria | 5840 |
| 228 | Ga0207697_10021493 | 3300025315 | Bacteria | 2641 |
| 229 | Ga0207697_10032032 | 3300025315 | Unclassified | 2151 |
| 230 | Ga0207697_10159021 | 3300025315 | Bacteria | 985 |
| 231 | Ga0207653_10008466 | 3300025885 | Bacteria | 3205 |
| 232 | Ga0207680_10014734 | 3300025903 | Unclassified | 4059 |
| 233 | Ga0207680_10074933 | 3300025903 | Bacteria | 2109 |
| 234 | Ga0207647_10093229 | 3300025904 | Bacteria | 1795 |
| 235 | Ga0207699_10147675 | 3300025906 | Bacteria | 1552 |
| 236 | Ga0207645_10000302 | 3300025907 | Bacteria | 41340 |
| 237 | Ga0207645_10040171 | 3300025907 | Bacteria | 2996 |
| 238 | Ga0207705_10077231 | 3300025909 | Bacteria | 2422 |
| 239 | Ga0207684_10003171 | 3300025910 | Bacteria | 16174 |
| 240 | Ga0207684_10003738 | 3300025910 | Bacteria | 14705 |
| 241 | Ga0207684_10072420 | 3300025910 | Unclassified | 2927 |
| 242 | Ga0207684_10525435 | 3300025910 | Unclassified | 1013 |
| 243 | Ga0207654_10006668 | 3300025911 | Bacteria | 5811 |
| 244 | Ga0207654_10164726 | 3300025911 | Bacteria | 1435 |
| 245 | Ga0207707_10225211 | 3300025912 | Unclassified | 1632 |
| 246 | Ga0207695_10002458 | 3300025913 | Bacteria | 27373 |
| 247 | Ga0207693_10005752 | 3300025915 | Bacteria | 10289 |
| 248 | Ga0207693_10014810 | 3300025915 | Bacteria | 6265 |
| 249 | Ga0207663_10070240 | 3300025916 | Unclassified | 2256 |
| 250 | Ga0207662_10000172 | 3300025918 | Bacteria | 30802 |
| 251 | Ga0207657_10167997 | 3300025919 | Bacteria | 1778 |
| 252 | Ga0207649_10084921 | 3300025920 | Bacteria | 2059 |
| 253 | Ga0207649_10173706 | 3300025920 | Bacteria | 1503 |
| 254 | Ga0207652_10118881 | 3300025921 | Unclassified | 2350 |
| 255 | Ga0207646_10002009 | 3300025922 | Bacteria | 24461 |
| 256 | Ga0207646_10032192 | 3300025922 | Bacteria | 4745 |
| 257 | Ga0207646_10254446 | 3300025922 | Bacteria | 1587 |
| 258 | Ga0207681_10020083 | 3300025923 | Bacteria | 4230 |
| 259 | Ga0207681_10111497 | 3300025923 | Unclassified | 1990 |
| 260 | Ga0207681_10245102 | 3300025923 | Bacteria | 1397 |
| 261 | Ga0207681_10660318 | 3300025923 | Bacteria | 867 |
| 262 | Ga0207694_10417367 | 3300025924 | Bacteria | 1117 |
| 263 | Ga0207650_10228549 | 3300025925 | Bacteria | 1500 |
| 264 | Ga0207659_10174701 | 3300025926 | Unclassified | 1697 |
| 265 | Ga0207659_10296711 | 3300025926 | Bacteria | 1326 |
| 266 | Ga0207687_10021588 | 3300025927 | Bacteria | 4278 |
| 267 | Ga0207687_10168816 | 3300025927 | Bacteria | 1686 |
| 268 | Ga0207687_10231011 | 3300025927 | Bacteria | 1461 |
| 269 | Ga0207700_10110012 | 3300025928 | Unclassified | 2215 |
| 270 | Ga0207700_10118909 | 3300025928 | Bacteria | 2139 |
| 271 | Ga0207700_10314776 | 3300025928 | Bacteria | 1355 |
| 272 | Ga0207664_10737977 | 3300025929 | Unclassified | 886 |
| 273 | Ga0207644_10021870 | 3300025931 | Bacteria | 4361 |
| 274 | Ga0207644_10120860 | 3300025931 | Unclassified | 1994 |
| 275 | Ga0207644_10138752 | 3300025931 | Unclassified | 1870 |
| 276 | Ga0207690_10057604 | 3300025932 | Bacteria | 2625 |
| 277 | Ga0207690_10644502 | 3300025932 | Unclassified | 868 |
| 278 | Ga0207706_10000429 | 3300025933 | Bacteria | 45047 |
| 279 | Ga0207706_10039496 | 3300025933 | Bacteria | 4184 |
| 280 | Ga0207686_10328437 | 3300025934 | Bacteria | 1145 |
| 281 | Ga0207709_10096602 | 3300025935 | Bacteria | 1944 |
| 282 | Ga0207670_10048557 | 3300025936 | Unclassified | 2833 |
| 283 | Ga0207670_10057761 | 3300025936 | Bacteria | 2633 |
| 284 | Ga0207670_10197104 | 3300025936 | Bacteria | 1527 |
| 285 | Ga0207670_10295521 | 3300025936 | Bacteria | 1267 |
| 286 | Ga0207669_10280123 | 3300025937 | Bacteria | 1257 |
| 287 | Ga0207704_10246722 | 3300025938 | Bacteria | 1338 |
| 288 | Ga0207665_10000451 | 3300025939 | Bacteria | 28242 |
| 289 | Ga0207665_10021258 | 3300025939 | Bacteria | 4266 |
| 290 | Ga0207691_10047677 | 3300025940 | Bacteria | 3931 |
| 291 | Ga0207691_10142258 | 3300025940 | Bacteria | 2113 |
| 292 | Ga0207691_10505079 | 3300025940 | Unclassified | 1027 |
| 293 | Ga0207711_10113759 | 3300025941 | Bacteria | 2410 |
| 294 | Ga0207689_10000110 | 3300025942 | Bacteria | 67347 |
| 295 | Ga0207689_10021613 | 3300025942 | Bacteria | 5410 |
| 296 | Ga0207661_10204013 | 3300025944 | Unclassified | 1739 |
| 297 | Ga0207661_10632821 | 3300025944 | Unclassified | 983 |
| 298 | Ga0207679_10285674 | 3300025945 | Bacteria | 1416 |
| 299 | Ga0207667_10000479 | 3300025949 | Bacteria | 53167 |
| 300 | Ga0207667_10618417 | 3300025949 | Bacteria | 1091 |
| 301 | Ga0207651_10073276 | 3300025960 | Bacteria | 2434 |
| 302 | Ga0207712_10020789 | 3300025961 | Bacteria | 4304 |
| 303 | Ga0207712_10266245 | 3300025961 | Unclassified | 1392 |
| 304 | Ga0207668_10024912 | 3300025972 | Unclassified | 3867 |
| 305 | Ga0207658_10016888 | 3300025986 | Bacteria | 5023 |
| 306 | Ga0207658_10302763 | 3300025986 | Bacteria | 1378 |
| 307 | Ga0207677_10017805 | 3300026023 | Unclassified | 4248 |
| 308 | Ga0207677_11071929 | 3300026023 | Bacteria | 733 |
| 309 | Ga0207703_10077323 | 3300026035 | Bacteria | 2762 |
| 310 | Ga0207703_10922818 | 3300026035 | Bacteria | 836 |
| 311 | Ga0207678_10030759 | 3300026067 | Bacteria | 4687 |
| 312 | Ga0207708_10021353 | 3300026075 | Bacteria | 4882 |
| 313 | Ga0207641_10182863 | 3300026088 | Bacteria | 1921 |
| 314 | Ga0207648_10273575 | 3300026089 | Bacteria | 1509 |
| 315 | Ga0207676_10209166 | 3300026095 | Bacteria | 1730 |
| 316 | Ga0207675_100102588 | 3300026118 | Bacteria | 2696 |
| 317 | Ga0207675_100201505 | 3300026118 | Unclassified | 1912 |
| 318 | Ga0207683_10348980 | 3300026121 | Bacteria | 1358 |
| 319 | Ga0209974_10101128 | 3300027876 | Bacteria | 1007 |
| 320 | Ga0207428_10023042 | 3300027907 | Bacteria | 5243 |
| 321 | Ga0268266_10003782 | 3300028379 | Bacteria | 14825 |
| 322 | Ga0268266_10177237 | 3300028379 | Unclassified | 1938 |
| 323 | Ga0268266_10600956 | 3300028379 | Bacteria | 1057 |
| 324 | Ga0268265_10245187 | 3300028380 | Bacteria | 1583 |
| 325 | Ga0268264_10109234 | 3300028381 | Unclassified | 2419 |
| 326 | Ga0268264_10446209 | 3300028381 | Bacteria | 1252 |
| 327 | Ga0265323_10009792 | 3300028653 | Bacteria | 3900 |
| 328 | Ga0265323_10014849 | 3300028653 | Bacteria | 3071 |
| 329 | Ga0265323_10021624 | 3300028653 | Bacteria | 2464 |
| 330 | Ga0265338_10171418 | 3300028800 | Bacteria | 1664 |
| 331 | Ga0265760_10034410 | 3300031090 | Bacteria | 1499 |
| 332 | Ga0265330_10000317 | 3300031235 | Bacteria | 34538 |
| 333 | Ga0265330_10044428 | 3300031235 | Bacteria | 1961 |
| 334 | Ga0265332_10001593 | 3300031238 | Bacteria | 12435 |
| 335 | Ga0265328_10141781 | 3300031239 | Bacteria | 902 |
| 336 | Ga0265320_10266380 | 3300031240 | Bacteria | 759 |
| 337 | Ga0265325_10062361 | 3300031241 | Bacteria | 1889 |
| 338 | Ga0265329_10002813 | 3300031242 | Bacteria | 7769 |
| 339 | Ga0265339_10029394 | 3300031249 | Bacteria | 3118 |
| 340 | Ga0265331_10021212 | 3300031250 | Bacteria | 3327 |
| 341 | Ga0265327_10001510 | 3300031251 | Bacteria | 28791 |
| 342 | Ga0265316_10000399 | 3300031344 | Bacteria | 49576 |
| 343 | Ga0265316_10005668 | 3300031344 | Bacteria | 12085 |
| 344 | Ga0265316_10016900 | 3300031344 | Bacteria | 6317 |
| 345 | Ga0265316_10032551 | 3300031344 | Bacteria | 4254 |
| 346 | Ga0265316_10037925 | 3300031344 | Bacteria | 3886 |
| 347 | Ga0265316_10321287 | 3300031344 | Bacteria | 1124 |
| 348 | Ga0307513_10051938 | 3300031456 | Bacteria | 4417 |
| 349 | Ga0307408_100418018 | 3300031548 | Unclassified | 1155 |
| 350 | Ga0265313_10012632 | 3300031595 | Bacteria | 5135 |
| 351 | Ga0265314_10000532 | 3300031711 | Bacteria | 49131 |
| 352 | Ga0265342_10000369 | 3300031712 | Bacteria | 49518 |
| 353 | Ga0265342_10021687 | 3300031712 | Bacteria | 4096 |
| 354 | Ga0265342_10039132 | 3300031712 | Bacteria | 2883 |
| 355 | Ga0265342_10201115 | 3300031712 | Unclassified | 1082 |
| 356 | Ga0265342_10245706 | 3300031712 | Bacteria | 957 |
| 357 | Ga0373944_0068353 | 3300035089 | Unclassified | 1153 |
| 358 | Ga0373935_0060037 | 3300035692 | Bacteria | 2432 |
| 359 | Ga0373935_0089073 | 3300035692 | Bacteria | 2017 |
| 360 | Ga0373935_0146708 | 3300035692 | Bacteria | 1598 |
| 361 | Ga0373935_0340781 | 3300035692 | Bacteria | 1067 |
| 362 | Ga0373927_0001751 | 3300035695 | Bacteria | 16203 |
| 363 | Ga0373927_0206173 | 3300035695 | Unclassified | 1291 |
| 364 | Ga0373927_0349768 | 3300035695 | Unclassified | 974 |
| 365 | Ga0373947_0235123 | 3300035725 | Bacteria | 1208 |
| 366 | Ga0373947_0587888 | 3300035725 | Unclassified | 759 |
| 367 | Ga0373937_0070632 | 3300036401 | Unclassified | 3221 |
| 368 | Ga0373925_0063780 | 3300037068 | Unclassified | 2773 |
| 369 | Ga0373925_0613539 | 3300037068 | Bacteria | 896 |
| 370 | Ga0395899_0000032 | 3300037312 | Bacteria | 312705 |
| 371 | Ga0395905_0400803 | 3300037471 | Bacteria | 1267 |
| 372 | Ga0436364_0080357 | 3300037853 | Unclassified | 2025 |
| 373 | Ga0436364_1008634 | 3300037853 | Bacteria | 2022 |
| 374 | Ga0436365_1522897 | 3300039437 | Bacteria | 27242 |
| 375 | Ga0436360_0616931 | 3300039438 | Bacteria | 1903 |
| 376 | Ga0436360_1315258 | 3300039438 | Bacteria | 1055 |
| 377 | Ga0436360_1325435 | 3300039438 | Unclassified | 3903 |
| 378 | Ga0436361_0388043 | 3300039447 | Bacteria | 1404 |
| 379 | Ga0436361_0557908 | 3300039447 | Bacteria | 2440 |
| 380 | Ga0436361_0700772 | 3300039447 | Unclassified | 2017 |
| 381 | Ga0436361_0893372 | 3300039447 | Bacteria | 9378 |
| 382 | Ga0436361_1179632 | 3300039447 | Bacteria | 3483 |
| 383 | Ga0436361_1191486 | 3300039447 | Unclassified | 975 |
| 384 | Ga0436362_0248233 | 3300039453 | Bacteria | 6489 |
| 385 | Ga0451807_0293516 | 3300041486 | Bacteria | 850 |
| 386 | Ga0451853_1143010 | 3300041512 | Bacteria | 1296 |
| 387 | Ga0439451_002607 | 3300042009 | Unclassified | 3665 |
| 388 | Ga0439444_0005426 | 3300042437 | Bacteria | 1892 |
| 389 | Ga0451577_0002312 | 3300042876 | Bacteria | 23042 |
| 390 | Ga0451577_0279471 | 3300042876 | Bacteria | 1512 |
| 391 | Ga0451577_0501808 | 3300042876 | Bacteria | 1101 |
| 392 | Ga0453683_0309552 | 3300044673 | Bacteria | 1011 |
| 393 | Ga0453684_0020796 | 3300044712 | Bacteria | 9863 |
| 394 | Ga0453684_0194454 | 3300044712 | Bacteria | 2370 |
| 395 | Ga0453684_0279045 | 3300044712 | Bacteria | 1906 |
| 396 | Ga0451576_0122983 | 3300045051 | Bacteria | 2702 |
| 397 | Ga0451576_0130410 | 3300045051 | Unclassified | 2620 |
| 398 | Ga0451576_0137441 | 3300045051 | Bacteria | 2549 |
| 399 | Ga0451576_0185237 | 3300045051 | Unclassified | 2174 |
| 400 | Ga0451576_0369722 | 3300045051 | Bacteria | 1502 |
| 401 | Ga0495629_0322023 | 3300046459 | Bacteria | 1057 |
| 402 | Ga0495630_0006461 | 3300046517 | Bacteria | 8339 |
| 403 | Ga0495630_0584004 | 3300046517 | Bacteria | 857 |
| 404 | Ga0495643_0000140 | 3300046522 | Bacteria | 115947 |
| 405 | Ga0495652_0051203 | 3300046529 | Bacteria | 3528 |
| 406 | Ga0495586_0024357 | 3300046535 | Unclassified | 3235 |
| 407 | Ga0495587_0226618 | 3300046536 | Bacteria | 1054 |
| 408 | Ga0495634_0035284 | 3300046642 | Unclassified | 3427 |
| 409 | Ga0495659_0241389 | 3300046664 | Bacteria | 751 |
| 410 | Ga0495599_0180367 | 3300046678 | Bacteria | 1302 |
| 411 | Ga0495658_0023116 | 3300046683 | Bacteria | 3297 |
| 412 | Ga0495658_0234834 | 3300046683 | Bacteria | 1151 |
| 413 | Ga0495613_0123373 | 3300046689 | Bacteria | 1859 |
| 414 | Ga0495624_0159582 | 3300046690 | Unclassified | 1378 |
| 415 | Ga0495624_0233331 | 3300046690 | Bacteria | 1114 |
| 416 | Ga0495600_0157503 | 3300046809 | Bacteria | 1469 |
| 417 | Ga0495581_0148013 | 3300047315 | Bacteria | 1371 |
| 418 | Ga0495581_0204574 | 3300047315 | Bacteria | 1155 |
| 419 | Ga0495674_0152644 | 3300047319 | Bacteria | 1936 |
| 420 | Ga0495680_0114720 | 3300047322 | Bacteria | 1994 |
| 421 | Ga0495684_0027005 | 3300047471 | Unclassified | 4410 |
| 422 | Ga0495602_0419471 | 3300048088 | Bacteria | 951 |
| 423 | Ga0496100_0156185 | 3300048903 | Bacteria | 1632 |
| 424 | Ga0496101_0026464 | 3300048904 | Bacteria | 4034 |
| 425 | Ga0496101_0108311 | 3300048904 | Bacteria | 2089 |
| 426 | Ga0496102_0179187 | 3300048905 | Unclassified | 1996 |
| 427 | Ga0496102_0907167 | 3300048905 | Unclassified | 803 |
| 428 | Ga0496103_0048797 | 3300048906 | Unclassified | 2617 |
| 429 | Ga0496104_0060283 | 3300048907 | Unclassified | 3595 |
| 430 | Ga0496104_0066756 | 3300048907 | Unclassified | 3416 |
| 431 | Ga0496104_0247574 | 3300048907 | Bacteria | 1695 |
| 432 | Ga0496105_0025727 | 3300048908 | Bacteria | 4794 |
| 433 | Ga0496105_0064221 | 3300048908 | Unclassified | 3029 |
| 434 | Ga0496105_0493120 | 3300048908 | Unclassified | 962 |
| 435 | Ga0496108_0017052 | 3300048911 | Bacteria | 5937 |
| 436 | Ga0496109_0114700 | 3300048912 | Unclassified | 2506 |
| 437 | Ga0496111_0094905 | 3300048914 | Unclassified | 2188 |
| 438 | Ga0496111_0416999 | 3300048914 | Unclassified | 992 |
| 439 | Ga0496111_0898798 | 3300048914 | Bacteria | 638 |
| 440 | Ga0496112_0066113 | 3300048915 | Bacteria | 3568 |
| 441 | Ga0496112_0158833 | 3300048915 | Unclassified | 2227 |
| 442 | Ga0496112_0187685 | 3300048915 | Bacteria | 2030 |
| 443 | Ga0496113_0005828 | 3300048916 | Bacteria | 7730 |
| 444 | Ga0496114_0065416 | 3300048917 | Bacteria | 3046 |
| 445 | Ga0496115_0010534 | 3300048918 | Bacteria | 6912 |
| 446 | Ga0496115_0125813 | 3300048918 | Unclassified | 2111 |
| 447 | Ga0496115_0872294 | 3300048918 | Bacteria | 696 |
| 448 | Ga0496126_0004587 | 3300048929 | Bacteria | 16384 |
| 449 | Ga0501037_0214866 | 3300049573 | Bacteria | 1355 |
| 450 | Ga0501047_0331523 | 3300049581 | Bacteria | 1360 |
| 451 | Ga0501075_0049006 | 3300049591 | Bacteria | 3175 |
| 452 | Ga0501076_0246810 | 3300049592 | Bacteria | 1461 |
| 453 | Ga0501253_033305 | 3300049683 | Bacteria | 997 |
| 454 | Ga0501079_0120443 | 3300049741 | Bacteria | 2041 |
| 455 | Ga0501044_0002707 | 3300049823 | Bacteria | 20144 |
| 456 | Ga0501045_0374888 | 3300049824 | Bacteria | 1059 |
| 457 | nmdc:mga05p37_106729_c1 | 3300050507 | Bacteria | 2448 |
| 458 | nmdc:mga05p37_1187644_c1 | 3300050507 | Bacteria | 790 |
| 459 | nmdc:mga05p37_284509_c1 | 3300050507 | Bacteria | 1970 |
| 460 | nmdc:mga05p37_41784_c1 | 3300050507 | Unclassified | 2378 |
| 461 | nmdc:mga05p37_536796_c1 | 3300050507 | Bacteria | 1334 |
| 462 | nmdc:mga09592_585617_c1 | 3300050508 | Bacteria | 957 |
| 463 | nmdc:mga06r32_135010_c1 | 3300050510 | Bacteria | 2442 |
| 464 | nmdc:mga06r32_282494_c1 | 3300050510 | Bacteria | 1647 |
| 465 | nmdc:mga08y16_61283_c1 | 3300050511 | Bacteria | 3929 |
| 466 | nmdc:mga0n895_153634_c1 | 3300050512 | Bacteria | 2332 |
| 467 | nmdc:mga0n895_154542_c1 | 3300050512 | Bacteria | 2325 |
| 468 | nmdc:mga0n895_290077_c1 | 3300050512 | Unclassified | 1659 |
| 469 | nmdc:mga0n895_5168_c1 | 3300050512 | Bacteria | 10861 |
| 470 | nmdc:mga0n895_585400_c1 | 3300050512 | Bacteria | 1119 |
| 471 | nmdc:mga0n895_747784_c1 | 3300050512 | Bacteria | 971 |
| 472 | nmdc:mga0n895_87431_c1 | 3300050512 | Bacteria | 3114 |
| 473 | nmdc:mga0n895_9204_c1 | 3300050512 | Bacteria | 8628 |
| 474 | nmdc:mga0rr50_4476_c1 | 3300050513 | Bacteria | 8225 |
| 475 | nmdc:mga0rr50_4911_c1 | 3300050513 | Bacteria | 7914 |
| 476 | nmdc:mga08x19_229260_c2 | 3300050514 | Bacteria | 975 |
| 477 | nmdc:mga08x19_9734_c1 | 3300050514 | Bacteria | 5757 |
| 478 | nmdc:mga0a205_113461_c1 | 3300050515 | Bacteria | 2609 |
| 479 | nmdc:mga0a205_1282_c1 | 3300050515 | Bacteria | 21168 |
| 480 | nmdc:mga0a205_1784_c1 | 3300050515 | Bacteria | 18598 |
| 481 | nmdc:mga0a205_18752_c1 | 3300050515 | Bacteria | 6511 |
| 482 | nmdc:mga0a205_394606_c1 | 3300050515 | Bacteria | 1248 |
| 483 | nmdc:mga0a205_63331_c1 | 3300050515 | Bacteria | 3573 |
| 484 | Ga0495619_0045681 | 3300053085 | Unclassified | 2878 |
| 485 | Ga0500556_0000211 | 3300053104 | Bacteria | 47457 |
| 486 | Ga0500637_0006632 | 3300053178 | Bacteria | 5720 |
| 487 | Ga0501084_0005991 | 3300054114 | Bacteria | 10001 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025935 | Ga0207709_10096602 | Ga0207709_100966021 | 174 |
| 2 | 3300028653 | Ga0265323_10021624 | Ga0265323_100216243 | 177 |
| 3 | 3300031344 | Ga0265316_10005668 | Ga0265316_100056686 | 177 |
| 4 | 3300048914 | Ga0496111_0898798 | Ga0496111_0898798_16_588 | 184 |
| 5 | 3300028800 | Ga0265338_10171418 | Ga0265338_101714182 | 185 |
| 6 | 3300031239 | Ga0265328_10141781 | Ga0265328_101417812 | 190 |
| 7 | 3300005468 | Ga0070707_100008675 | Ga0070707_1000086759 | 191 |
| 8 | 3300031548 | Ga0307408_100418018 | Ga0307408_1004180181 | 192 |
| 9 | 3300037853 | Ga0436364_1008634 | Ga0436364_1008634_729_1319 | 193 |
| 10 | 3300031090 | Ga0265760_10034410 | Ga0265760_100344102 | 194 |
| 11 | 3300053104 | Ga0500556_0000211 | Ga0500556_0000211_28059_28670 | 194 |
| 12 | iso_pu_bacteria | 2786546517 | 2787435677 | 194 |
| 13 | 3300049591 | Ga0501075_0049006 | Ga0501075_0049006_1460_2053 | 195 |
| 14 | 3300002126 | JGI24035J26624_1015562 | JGI24035J26624_10155622 | 196 |
| 15 | 3300005365 | Ga0070688_100004364 | Ga0070688_1000043645 | 196 |
| 16 | 3300005367 | Ga0070667_100240371 | Ga0070667_1002403712 | 196 |
| 17 | 3300005441 | Ga0070700_100191717 | Ga0070700_1001917171 | 196 |
| 18 | 3300005444 | Ga0070694_100049910 | Ga0070694_1000499101 | 196 |
| 19 | 3300005618 | Ga0068864_100280937 | Ga0068864_1002809372 | 196 |
| 20 | 3300005719 | Ga0068861_100205514 | Ga0068861_1002055142 | 196 |
| 21 | 3300005841 | Ga0068863_100141632 | Ga0068863_1001416323 | 196 |
| 22 | 3300013296 | Ga0157374_10289711 | Ga0157374_102897113 | 196 |
| 23 | 3300013297 | Ga0157378_10391958 | Ga0157378_103919582 | 196 |
| 24 | 3300014325 | Ga0163163_10062327 | Ga0163163_100623271 | 196 |
| 25 | 3300025315 | Ga0207697_10005559 | Ga0207697_100055595 | 196 |
| 26 | 3300025885 | Ga0207653_10008466 | Ga0207653_100084664 | 196 |
| 27 | 3300025904 | Ga0207647_10093229 | Ga0207647_100932292 | 196 |
| 28 | 3300025932 | Ga0207690_10057604 | Ga0207690_100576042 | 196 |
| 29 | 3300025986 | Ga0207658_10302763 | Ga0207658_103027632 | 196 |
| 30 | 3300026075 | Ga0207708_10021353 | Ga0207708_100213533 | 196 |
| 31 | 3300026088 | Ga0207641_10182863 | Ga0207641_101828632 | 196 |
| 32 | 3300026095 | Ga0207676_10209166 | Ga0207676_102091663 | 196 |
| 33 | 3300044712 | Ga0453684_0020796 | Ga0453684_0020796_2756_3349 | 197 |
| 34 | 3300045051 | Ga0451576_0185237 | Ga0451576_0185237_865_1458 | 197 |
| 35 | 2162886012 | MBSR1b_contig_5376679 | MBSR1b_0584.00001350 | 198 |
| 36 | 3300000545 | CNXas_1000001 | CNXas_100000120 | 198 |
| 37 | 3300003320 | rootH2_10000721 | rootH2_1000072122 | 198 |
| 38 | 3300005272 | Ga0065703_1018758 | Ga0065703_10187584 | 198 |
| 39 | 3300005288 | Ga0065714_10134876 | Ga0065714_101348762 | 198 |
| 40 | 3300005290 | Ga0065712_10000573 | Ga0065712_100005737 | 198 |
| 41 | 3300005290 | Ga0065712_10008601 | Ga0065712_100086013 | 198 |
| 42 | 3300005290 | Ga0065712_10023745 | Ga0065712_100237451 | 198 |
| 43 | 3300005293 | Ga0065715_10002065 | Ga0065715_100020654 | 198 |
| 44 | 3300005293 | Ga0065715_10009496 | Ga0065715_100094964 | 198 |
| 45 | 3300005293 | Ga0065715_10105554 | Ga0065715_101055544 | 198 |
| 46 | 3300005293 | Ga0065715_10112402 | Ga0065715_101124022 | 198 |
| 47 | 3300005293 | Ga0065715_10349752 | Ga0065715_103497522 | 198 |
| 48 | 3300005328 | Ga0070676_10006268 | Ga0070676_100062684 | 198 |
| 49 | 3300005328 | Ga0070676_10113891 | Ga0070676_101138912 | 198 |
| 50 | 3300005329 | Ga0070683_100017316 | Ga0070683_1000173165 | 198 |
| 51 | 3300005329 | Ga0070683_100333309 | Ga0070683_1003333092 | 198 |
| 52 | 3300005330 | Ga0070690_100087326 | Ga0070690_1000873262 | 198 |
| 53 | 3300005330 | Ga0070690_100110619 | Ga0070690_1001106192 | 198 |
| 54 | 3300005331 | Ga0070670_100171527 | Ga0070670_1001715273 | 198 |
| 55 | 3300005334 | Ga0068869_100003463 | Ga0068869_1000034636 | 198 |
| 56 | 3300005334 | Ga0068869_100027986 | Ga0068869_1000279863 | 198 |
| 57 | 3300005335 | Ga0070666_10040986 | Ga0070666_100409864 | 198 |
| 58 | 3300005336 | Ga0070680_100158169 | Ga0070680_1001581693 | 198 |
| 59 | 3300005337 | Ga0070682_100136674 | Ga0070682_1001366742 | 198 |
| 60 | 3300005338 | Ga0068868_100026335 | Ga0068868_1000263354 | 198 |
| 61 | 3300005338 | Ga0068868_100145469 | Ga0068868_1001454693 | 198 |
| 62 | 3300005340 | Ga0070689_100050771 | Ga0070689_1000507714 | 198 |
| 63 | 3300005340 | Ga0070689_100066480 | Ga0070689_1000664804 | 198 |
| 64 | 3300005343 | Ga0070687_100003550 | Ga0070687_1000035504 | 198 |
| 65 | 3300005344 | Ga0070661_100040652 | Ga0070661_1000406523 | 198 |
| 66 | 3300005344 | Ga0070661_100080737 | Ga0070661_1000807372 | 198 |
| 67 | 3300005347 | Ga0070668_100015168 | Ga0070668_1000151685 | 198 |
| 68 | 3300005353 | Ga0070669_100018560 | Ga0070669_1000185605 | 198 |
| 69 | 3300005353 | Ga0070669_100043052 | Ga0070669_1000430524 | 198 |
| 70 | 3300005353 | Ga0070669_100319157 | Ga0070669_1003191572 | 198 |
| 71 | 3300005354 | Ga0070675_100030828 | Ga0070675_1000308284 | 198 |
| 72 | 3300005354 | Ga0070675_100038169 | Ga0070675_1000381693 | 198 |
| 73 | 3300005354 | Ga0070675_100194796 | Ga0070675_1001947962 | 198 |
| 74 | 3300005355 | Ga0070671_100026689 | Ga0070671_1000266894 | 198 |
| 75 | 3300005355 | Ga0070671_100342934 | Ga0070671_1003429342 | 198 |
| 76 | 3300005356 | Ga0070674_100251664 | Ga0070674_1002516642 | 198 |
| 77 | 3300005364 | Ga0070673_100030088 | Ga0070673_1000300884 | 198 |
| 78 | 3300005364 | Ga0070673_100721119 | Ga0070673_1007211192 | 198 |
| 79 | 3300005365 | Ga0070688_100058535 | Ga0070688_1000585353 | 198 |
| 80 | 3300005365 | Ga0070688_100067256 | Ga0070688_1000672563 | 198 |
| 81 | 3300005365 | Ga0070688_100089148 | Ga0070688_1000891482 | 198 |
| 82 | 3300005365 | Ga0070688_100230769 | Ga0070688_1002307692 | 198 |
| 83 | 3300005366 | Ga0070659_100018402 | Ga0070659_1000184022 | 198 |
| 84 | 3300005366 | Ga0070659_100453396 | Ga0070659_1004533962 | 198 |
| 85 | 3300005367 | Ga0070667_100071001 | Ga0070667_1000710014 | 198 |
| 86 | 3300005434 | Ga0070709_10127675 | Ga0070709_101276752 | 198 |
| 87 | 3300005435 | Ga0070714_100811144 | Ga0070714_1008111442 | 198 |
| 88 | 3300005436 | Ga0070713_100054568 | Ga0070713_1000545684 | 198 |
| 89 | 3300005436 | Ga0070713_100236371 | Ga0070713_1002363713 | 198 |
| 90 | 3300005436 | Ga0070713_100368601 | Ga0070713_1003686011 | 198 |
| 91 | 3300005436 | Ga0070713_100400500 | Ga0070713_1004005002 | 198 |
| 92 | 3300005436 | Ga0070713_100636382 | Ga0070713_1006363822 | 198 |
| 93 | 3300005437 | Ga0070710_10014716 | Ga0070710_100147162 | 198 |
| 94 | 3300005437 | Ga0070710_10212857 | Ga0070710_102128572 | 198 |
| 95 | 3300005438 | Ga0070701_10097779 | Ga0070701_100977792 | 198 |
| 96 | 3300005439 | Ga0070711_100020899 | Ga0070711_1000208994 | 198 |
| 97 | 3300005439 | Ga0070711_100119790 | Ga0070711_1001197902 | 198 |
| 98 | 3300005440 | Ga0070705_100000850 | Ga0070705_10000085014 | 198 |
| 99 | 3300005444 | Ga0070694_100009414 | Ga0070694_1000094142 | 198 |
| 100 | 3300005445 | Ga0070708_100036050 | Ga0070708_1000360504 | 198 |
| 101 | 3300005445 | Ga0070708_100043453 | Ga0070708_1000434534 | 198 |
| 102 | 3300005445 | Ga0070708_100068697 | Ga0070708_1000686973 | 198 |
| 103 | 3300005445 | Ga0070708_100277914 | Ga0070708_1002779142 | 198 |
| 104 | 3300005445 | Ga0070708_100502593 | Ga0070708_1005025932 | 198 |
| 105 | 3300005455 | Ga0070663_100185665 | Ga0070663_1001856652 | 198 |
| 106 | 3300005456 | Ga0070678_100096613 | Ga0070678_1000966132 | 198 |
| 107 | 3300005457 | Ga0070662_100024490 | Ga0070662_1000244902 | 198 |
| 108 | 3300005457 | Ga0070662_100054016 | Ga0070662_1000540162 | 198 |
| 109 | 3300005458 | Ga0070681_10033106 | Ga0070681_100331065 | 198 |
| 110 | 3300005466 | Ga0070685_10118580 | Ga0070685_101185803 | 198 |
| 111 | 3300005467 | Ga0070706_100002884 | Ga0070706_10000288413 | 198 |
| 112 | 3300005467 | Ga0070706_100103216 | Ga0070706_1001032161 | 198 |
| 113 | 3300005467 | Ga0070706_100507520 | Ga0070706_1005075202 | 198 |
| 114 | 3300005468 | Ga0070707_100002697 | Ga0070707_10000269714 | 198 |
| 115 | 3300005468 | Ga0070707_100027339 | Ga0070707_1000273394 | 198 |
| 116 | 3300005468 | Ga0070707_100150623 | Ga0070707_1001506233 | 198 |
| 117 | 3300005468 | Ga0070707_100172233 | Ga0070707_1001722332 | 198 |
| 118 | 3300005468 | Ga0070707_100255725 | Ga0070707_1002557251 | 198 |
| 119 | 3300005471 | Ga0070698_100004923 | Ga0070698_10000492312 | 198 |
| 120 | 3300005471 | Ga0070698_100058213 | Ga0070698_1000582135 | 198 |
| 121 | 3300005518 | Ga0070699_100069023 | Ga0070699_1000690233 | 198 |
| 122 | 3300005518 | Ga0070699_100081466 | Ga0070699_1000814662 | 198 |
| 123 | 3300005518 | Ga0070699_100782434 | Ga0070699_1007824342 | 198 |
| 124 | 3300005530 | Ga0070679_100012926 | Ga0070679_1000129265 | 198 |
| 125 | 3300005535 | Ga0070684_100081933 | Ga0070684_1000819333 | 198 |
| 126 | 3300005535 | Ga0070684_100307837 | Ga0070684_1003078372 | 198 |
| 127 | 3300005543 | Ga0070672_100049690 | Ga0070672_1000496903 | 198 |
| 128 | 3300005544 | Ga0070686_100067615 | Ga0070686_1000676152 | 198 |
| 129 | 3300005545 | Ga0070695_100005537 | Ga0070695_1000055376 | 198 |
| 130 | 3300005545 | Ga0070695_100266923 | Ga0070695_1002669231 | 198 |
| 131 | 3300005546 | Ga0070696_100112424 | Ga0070696_1001124243 | 198 |
| 132 | 3300005548 | Ga0070665_100003323 | Ga0070665_10000332317 | 198 |
| 133 | 3300005548 | Ga0070665_100011586 | Ga0070665_1000115862 | 198 |
| 134 | 3300005548 | Ga0070665_100074929 | Ga0070665_1000749293 | 198 |
| 135 | 3300005548 | Ga0070665_100133133 | Ga0070665_1001331334 | 198 |
| 136 | 3300005549 | Ga0070704_100000116 | Ga0070704_1000001166 | 198 |
| 137 | 3300005549 | Ga0070704_100362593 | Ga0070704_1003625932 | 198 |
| 138 | 3300005563 | Ga0068855_100000058 | Ga0068855_100000058122 | 198 |
| 139 | 3300005563 | Ga0068855_100221047 | Ga0068855_1002210473 | 198 |
| 140 | 3300005564 | Ga0070664_100060747 | Ga0070664_1000607473 | 198 |
| 141 | 3300005615 | Ga0070702_100500763 | Ga0070702_1005007631 | 198 |
| 142 | 3300005617 | Ga0068859_100073666 | Ga0068859_1000736662 | 198 |
| 143 | 3300005719 | Ga0068861_100827667 | Ga0068861_1008276672 | 198 |
| 144 | 3300005842 | Ga0068858_100096076 | Ga0068858_1000960762 | 198 |
| 145 | 3300005842 | Ga0068858_100381390 | Ga0068858_1003813902 | 198 |
| 146 | 3300005843 | Ga0068860_100158353 | Ga0068860_1001583532 | 198 |
| 147 | 3300005844 | Ga0068862_100075981 | Ga0068862_1000759813 | 198 |
| 148 | 3300005844 | Ga0068862_101770415 | Ga0068862_1017704151 | 198 |
| 149 | 3300005937 | Ga0081455_10004845 | Ga0081455_100048458 | 198 |
| 150 | 3300005937 | Ga0081455_10007688 | Ga0081455_100076886 | 198 |
| 151 | 3300005937 | Ga0081455_10140554 | Ga0081455_101405542 | 198 |
| 152 | 3300005937 | Ga0081455_10146372 | Ga0081455_101463722 | 198 |
| 153 | 3300005983 | Ga0081540_1001895 | Ga0081540_10018954 | 198 |
| 154 | 3300005983 | Ga0081540_1095076 | Ga0081540_10950762 | 198 |
| 155 | 3300005985 | Ga0081539_10007439 | Ga0081539_100074394 | 198 |
| 156 | 3300005985 | Ga0081539_10051929 | Ga0081539_100519292 | 198 |
| 157 | 3300006028 | Ga0070717_10041558 | Ga0070717_100415582 | 198 |
| 158 | 3300006028 | Ga0070717_10396660 | Ga0070717_103966602 | 198 |
| 159 | 3300006058 | Ga0075432_10057389 | Ga0075432_100573893 | 198 |
| 160 | 3300006163 | Ga0070715_10182754 | Ga0070715_101827542 | 198 |
| 161 | 3300006163 | Ga0070715_10230644 | Ga0070715_102306442 | 198 |
| 162 | 3300006173 | Ga0070716_100002739 | Ga0070716_1000027393 | 198 |
| 163 | 3300006173 | Ga0070716_100064452 | Ga0070716_1000644523 | 198 |
| 164 | 3300006173 | Ga0070716_100479816 | Ga0070716_1004798162 | 198 |
| 165 | 3300006175 | Ga0070712_100032248 | Ga0070712_1000322484 | 198 |
| 166 | 3300006175 | Ga0070712_100059274 | Ga0070712_1000592744 | 198 |
| 167 | 3300006175 | Ga0070712_100214830 | Ga0070712_1002148303 | 198 |
| 168 | 3300006175 | Ga0070712_100301003 | Ga0070712_1003010032 | 198 |
| 169 | 3300006237 | Ga0097621_100388187 | Ga0097621_1003881872 | 198 |
| 170 | 3300006358 | Ga0068871_100101456 | Ga0068871_1001014562 | 198 |
| 171 | 3300006358 | Ga0068871_100155110 | Ga0068871_1001551102 | 198 |
| 172 | 3300006844 | Ga0075428_100015909 | Ga0075428_1000159092 | 198 |
| 173 | 3300006844 | Ga0075428_100142897 | Ga0075428_1001428973 | 198 |
| 174 | 3300006844 | Ga0075428_100769692 | Ga0075428_1007696922 | 198 |
| 175 | 3300006847 | Ga0075431_100061420 | Ga0075431_1000614205 | 198 |
| 176 | 3300006847 | Ga0075431_100179683 | Ga0075431_1001796832 | 198 |
| 177 | 3300006852 | Ga0075433_10001383 | Ga0075433_100013835 | 198 |
| 178 | 3300006852 | Ga0075433_10070179 | Ga0075433_100701794 | 198 |
| 179 | 3300006871 | Ga0075434_100127613 | Ga0075434_1001276132 | 198 |
| 180 | 3300006871 | Ga0075434_100181774 | Ga0075434_1001817743 | 198 |
| 181 | 3300006871 | Ga0075434_100456433 | Ga0075434_1004564332 | 198 |
| 182 | 3300006880 | Ga0075429_100195463 | Ga0075429_1001954633 | 198 |
| 183 | 3300006914 | Ga0075436_100680107 | Ga0075436_1006801072 | 198 |
| 184 | 3300006931 | Ga0097620_100073668 | Ga0097620_1000736684 | 198 |
| 185 | 3300007076 | Ga0075435_100002801 | Ga0075435_1000028015 | 198 |
| 186 | 3300007076 | Ga0075435_100233545 | Ga0075435_1002335452 | 198 |
| 187 | 3300007265 | Ga0099794_10018056 | Ga0099794_100180563 | 198 |
| 188 | 3300009093 | Ga0105240_10287050 | Ga0105240_102870502 | 198 |
| 189 | 3300009094 | Ga0111539_10050029 | Ga0111539_100500297 | 198 |
| 190 | 3300009094 | Ga0111539_10128030 | Ga0111539_101280302 | 198 |
| 191 | 3300009094 | Ga0111539_10220968 | Ga0111539_102209682 | 198 |
| 192 | 3300009094 | Ga0111539_10231957 | Ga0111539_102319573 | 198 |
| 193 | 3300009094 | Ga0111539_10259189 | Ga0111539_102591892 | 198 |
| 194 | 3300009094 | Ga0111539_10259931 | Ga0111539_102599312 | 198 |
| 195 | 3300009098 | Ga0105245_10008336 | Ga0105245_100083365 | 198 |
| 196 | 3300009098 | Ga0105245_10023086 | Ga0105245_100230865 | 198 |
| 197 | 3300009098 | Ga0105245_10110833 | Ga0105245_101108332 | 198 |
| 198 | 3300009101 | Ga0105247_10103705 | Ga0105247_101037053 | 198 |
| 199 | 3300009147 | Ga0114129_10008944 | Ga0114129_100089443 | 198 |
| 200 | 3300009147 | Ga0114129_10049778 | Ga0114129_100497786 | 198 |
| 201 | 3300009147 | Ga0114129_10189590 | Ga0114129_101895904 | 198 |
| 202 | 3300009147 | Ga0114129_10379758 | Ga0114129_103797582 | 198 |
| 203 | 3300009147 | Ga0114129_10728427 | Ga0114129_107284272 | 198 |
| 204 | 3300009147 | Ga0114129_10800526 | Ga0114129_108005262 | 198 |
| 205 | 3300009148 | Ga0105243_10021052 | Ga0105243_100210525 | 198 |
| 206 | 3300009174 | Ga0105241_10001358 | Ga0105241_1000135814 | 198 |
| 207 | 3300009174 | Ga0105241_10005023 | Ga0105241_100050239 | 198 |
| 208 | 3300009176 | Ga0105242_10227748 | Ga0105242_102277483 | 198 |
| 209 | 3300009176 | Ga0105242_10787349 | Ga0105242_107873492 | 198 |
| 210 | 3300009177 | Ga0105248_10104746 | Ga0105248_101047463 | 198 |
| 211 | 3300009177 | Ga0105248_10337085 | Ga0105248_103370852 | 198 |
| 212 | 3300009545 | Ga0105237_10169999 | Ga0105237_101699993 | 198 |
| 213 | 3300009545 | Ga0105237_10174969 | Ga0105237_101749692 | 198 |
| 214 | 3300009551 | Ga0105238_10987121 | Ga0105238_109871212 | 198 |
| 215 | 3300009553 | Ga0105249_10003690 | Ga0105249_100036908 | 198 |
| 216 | 3300009553 | Ga0105249_10264419 | Ga0105249_102644193 | 198 |
| 217 | 3300009553 | Ga0105249_10305412 | Ga0105249_103054123 | 198 |
| 218 | 3300010159 | Ga0099796_10243713 | Ga0099796_102437131 | 198 |
| 219 | 3300010375 | Ga0105239_10002874 | Ga0105239_1000287414 | 198 |
| 220 | 3300010375 | Ga0105239_10215557 | Ga0105239_102155572 | 198 |
| 221 | 3300010375 | Ga0105239_10552305 | Ga0105239_105523052 | 198 |
| 222 | 3300013102 | Ga0157371_10283549 | Ga0157371_102835492 | 198 |
| 223 | 3300013105 | Ga0157369_10037595 | Ga0157369_100375955 | 198 |
| 224 | 3300013105 | Ga0157369_10166977 | Ga0157369_101669773 | 198 |
| 225 | 3300013296 | Ga0157374_10041547 | Ga0157374_100415473 | 198 |
| 226 | 3300013296 | Ga0157374_10341311 | Ga0157374_103413112 | 198 |
| 227 | 3300013297 | Ga0157378_10025962 | Ga0157378_100259622 | 198 |
| 228 | 3300013297 | Ga0157378_10090409 | Ga0157378_100904093 | 198 |
| 229 | 3300013306 | Ga0163162_10023977 | Ga0163162_100239775 | 198 |
| 230 | 3300013306 | Ga0163162_10046179 | Ga0163162_100461793 | 198 |
| 231 | 3300013306 | Ga0163162_10103819 | Ga0163162_101038192 | 198 |
| 232 | 3300013307 | Ga0157372_10016934 | Ga0157372_100169345 | 198 |
| 233 | 3300013307 | Ga0157372_10237353 | Ga0157372_102373533 | 198 |
| 234 | 3300013307 | Ga0157372_10421985 | Ga0157372_104219852 | 198 |
| 235 | 3300013308 | Ga0157375_10144508 | Ga0157375_101445082 | 198 |
| 236 | 3300013308 | Ga0157375_10235290 | Ga0157375_102352903 | 198 |
| 237 | 3300014325 | Ga0163163_11257930 | Ga0163163_112579301 | 198 |
| 238 | 3300014969 | Ga0157376_10052472 | Ga0157376_100524723 | 198 |
| 239 | 3300014969 | Ga0157376_10325118 | Ga0157376_103251181 | 198 |
| 240 | 3300021384 | Ga0213876_10019103 | Ga0213876_100191034 | 198 |
| 241 | 3300021441 | Ga0213871_10014362 | Ga0213871_100143622 | 198 |
| 242 | 3300021441 | Ga0213871_10038778 | Ga0213871_100387782 | 198 |
| 243 | 3300025271 | Ga0207666_1000123 | Ga0207666_10001234 | 198 |
| 244 | 3300025271 | Ga0207666_1001808 | Ga0207666_10018083 | 198 |
| 245 | 3300025290 | Ga0207673_1001030 | Ga0207673_10010302 | 198 |
| 246 | 3300025315 | Ga0207697_10001238 | Ga0207697_1000123811 | 198 |
| 247 | 3300025315 | Ga0207697_10001995 | Ga0207697_100019952 | 198 |
| 248 | 3300025315 | Ga0207697_10002939 | Ga0207697_100029392 | 198 |
| 249 | 3300025315 | Ga0207697_10021493 | Ga0207697_100214933 | 198 |
| 250 | 3300025315 | Ga0207697_10032032 | Ga0207697_100320323 | 198 |
| 251 | 3300025315 | Ga0207697_10159021 | Ga0207697_101590211 | 198 |
| 252 | 3300025903 | Ga0207680_10014734 | Ga0207680_100147344 | 198 |
| 253 | 3300025903 | Ga0207680_10074933 | Ga0207680_100749332 | 198 |
| 254 | 3300025906 | Ga0207699_10147675 | Ga0207699_101476752 | 198 |
| 255 | 3300025907 | Ga0207645_10000302 | Ga0207645_1000030236 | 198 |
| 256 | 3300025907 | Ga0207645_10040171 | Ga0207645_100401712 | 198 |
| 257 | 3300025909 | Ga0207705_10077231 | Ga0207705_100772312 | 198 |
| 258 | 3300025910 | Ga0207684_10003171 | Ga0207684_100031718 | 198 |
| 259 | 3300025910 | Ga0207684_10003738 | Ga0207684_100037389 | 198 |
| 260 | 3300025910 | Ga0207684_10072420 | Ga0207684_100724204 | 198 |
| 261 | 3300025910 | Ga0207684_10525435 | Ga0207684_105254352 | 198 |
| 262 | 3300025911 | Ga0207654_10006668 | Ga0207654_100066684 | 198 |
| 263 | 3300025911 | Ga0207654_10164726 | Ga0207654_101647261 | 198 |
| 264 | 3300025912 | Ga0207707_10225211 | Ga0207707_102252112 | 198 |
| 265 | 3300025913 | Ga0207695_10002458 | Ga0207695_1000245825 | 198 |
| 266 | 3300025915 | Ga0207693_10005752 | Ga0207693_100057529 | 198 |
| 267 | 3300025915 | Ga0207693_10014810 | Ga0207693_100148103 | 198 |
| 268 | 3300025916 | Ga0207663_10070240 | Ga0207663_100702402 | 198 |
| 269 | 3300025918 | Ga0207662_10000172 | Ga0207662_100001723 | 198 |
| 270 | 3300025919 | Ga0207657_10167997 | Ga0207657_101679972 | 198 |
| 271 | 3300025920 | Ga0207649_10084921 | Ga0207649_100849212 | 198 |
| 272 | 3300025920 | Ga0207649_10173706 | Ga0207649_101737062 | 198 |
| 273 | 3300025921 | Ga0207652_10118881 | Ga0207652_101188813 | 198 |
| 274 | 3300025922 | Ga0207646_10002009 | Ga0207646_100020099 | 198 |
| 275 | 3300025922 | Ga0207646_10032192 | Ga0207646_100321924 | 198 |
| 276 | 3300025922 | Ga0207646_10254446 | Ga0207646_102544462 | 198 |
| 277 | 3300025923 | Ga0207681_10020083 | Ga0207681_100200832 | 198 |
| 278 | 3300025923 | Ga0207681_10111497 | Ga0207681_101114973 | 198 |
| 279 | 3300025923 | Ga0207681_10245102 | Ga0207681_102451022 | 198 |
| 280 | 3300025923 | Ga0207681_10660318 | Ga0207681_106603181 | 198 |
| 281 | 3300025924 | Ga0207694_10417367 | Ga0207694_104173671 | 198 |
| 282 | 3300025925 | Ga0207650_10228549 | Ga0207650_102285492 | 198 |
| 283 | 3300025926 | Ga0207659_10174701 | Ga0207659_101747012 | 198 |
| 284 | 3300025926 | Ga0207659_10296711 | Ga0207659_102967112 | 198 |
| 285 | 3300025927 | Ga0207687_10021588 | Ga0207687_100215884 | 198 |
| 286 | 3300025927 | Ga0207687_10168816 | Ga0207687_101688162 | 198 |
| 287 | 3300025927 | Ga0207687_10231011 | Ga0207687_102310112 | 198 |
| 288 | 3300025928 | Ga0207700_10110012 | Ga0207700_101100123 | 198 |
| 289 | 3300025928 | Ga0207700_10118909 | Ga0207700_101189094 | 198 |
| 290 | 3300025928 | Ga0207700_10314776 | Ga0207700_103147763 | 198 |
| 291 | 3300025929 | Ga0207664_10737977 | Ga0207664_107379772 | 198 |
| 292 | 3300025931 | Ga0207644_10021870 | Ga0207644_100218705 | 198 |
| 293 | 3300025931 | Ga0207644_10120860 | Ga0207644_101208602 | 198 |
| 294 | 3300025931 | Ga0207644_10138752 | Ga0207644_101387523 | 198 |
| 295 | 3300025932 | Ga0207690_10644502 | Ga0207690_106445021 | 198 |
| 296 | 3300025933 | Ga0207706_10000429 | Ga0207706_1000042913 | 198 |
| 297 | 3300025933 | Ga0207706_10039496 | Ga0207706_100394963 | 198 |
| 298 | 3300025934 | Ga0207686_10328437 | Ga0207686_103284372 | 198 |
| 299 | 3300025936 | Ga0207670_10048557 | Ga0207670_100485572 | 198 |
| 300 | 3300025936 | Ga0207670_10057761 | Ga0207670_100577613 | 198 |
| 301 | 3300025936 | Ga0207670_10197104 | Ga0207670_101971043 | 198 |
| 302 | 3300025936 | Ga0207670_10295521 | Ga0207670_102955212 | 198 |
| 303 | 3300025937 | Ga0207669_10280123 | Ga0207669_102801232 | 198 |
| 304 | 3300025938 | Ga0207704_10246722 | Ga0207704_102467222 | 198 |
| 305 | 3300025939 | Ga0207665_10000451 | Ga0207665_1000045120 | 198 |
| 306 | 3300025939 | Ga0207665_10021258 | Ga0207665_100212584 | 198 |
| 307 | 3300025940 | Ga0207691_10047677 | Ga0207691_100476774 | 198 |
| 308 | 3300025940 | Ga0207691_10142258 | Ga0207691_101422582 | 198 |
| 309 | 3300025940 | Ga0207691_10505079 | Ga0207691_105050792 | 198 |
| 310 | 3300025941 | Ga0207711_10113759 | Ga0207711_101137594 | 198 |
| 311 | 3300025942 | Ga0207689_10000110 | Ga0207689_1000011071 | 198 |
| 312 | 3300025942 | Ga0207689_10021613 | Ga0207689_100216133 | 198 |
| 313 | 3300025944 | Ga0207661_10204013 | Ga0207661_102040132 | 198 |
| 314 | 3300025944 | Ga0207661_10632821 | Ga0207661_106328212 | 198 |
| 315 | 3300025945 | Ga0207679_10285674 | Ga0207679_102856742 | 198 |
| 316 | 3300025949 | Ga0207667_10000479 | Ga0207667_100004793 | 198 |
| 317 | 3300025949 | Ga0207667_10618417 | Ga0207667_106184172 | 198 |
| 318 | 3300025960 | Ga0207651_10073276 | Ga0207651_100732763 | 198 |
| 319 | 3300025961 | Ga0207712_10020789 | Ga0207712_100207895 | 198 |
| 320 | 3300025961 | Ga0207712_10266245 | Ga0207712_102662452 | 198 |
| 321 | 3300025972 | Ga0207668_10024912 | Ga0207668_100249122 | 198 |
| 322 | 3300025986 | Ga0207658_10016888 | Ga0207658_100168885 | 198 |
| 323 | 3300026023 | Ga0207677_10017805 | Ga0207677_100178052 | 198 |
| 324 | 3300026023 | Ga0207677_11071929 | Ga0207677_110719292 | 198 |
| 325 | 3300026035 | Ga0207703_10077323 | Ga0207703_100773232 | 198 |
| 326 | 3300026035 | Ga0207703_10922818 | Ga0207703_109228181 | 198 |
| 327 | 3300026067 | Ga0207678_10030759 | Ga0207678_100307593 | 198 |
| 328 | 3300026089 | Ga0207648_10273575 | Ga0207648_102735752 | 198 |
| 329 | 3300026118 | Ga0207675_100102588 | Ga0207675_1001025884 | 198 |
| 330 | 3300026118 | Ga0207675_100201505 | Ga0207675_1002015053 | 198 |
| 331 | 3300026121 | Ga0207683_10348980 | Ga0207683_103489801 | 198 |
| 332 | 3300027876 | Ga0209974_10101128 | Ga0209974_101011282 | 198 |
| 333 | 3300027907 | Ga0207428_10023042 | Ga0207428_100230425 | 198 |
| 334 | 3300028379 | Ga0268266_10003782 | Ga0268266_1000378212 | 198 |
| 335 | 3300028379 | Ga0268266_10177237 | Ga0268266_101772373 | 198 |
| 336 | 3300028379 | Ga0268266_10600956 | Ga0268266_106009562 | 198 |
| 337 | 3300028380 | Ga0268265_10245187 | Ga0268265_102451873 | 198 |
| 338 | 3300028381 | Ga0268264_10109234 | Ga0268264_101092342 | 198 |
| 339 | 3300028381 | Ga0268264_10446209 | Ga0268264_104462092 | 198 |
| 340 | 3300028653 | Ga0265323_10009792 | Ga0265323_100097922 | 198 |
| 341 | 3300028653 | Ga0265323_10014849 | Ga0265323_100148493 | 198 |
| 342 | 3300031235 | Ga0265330_10000317 | Ga0265330_1000031721 | 198 |
| 343 | 3300031235 | Ga0265330_10044428 | Ga0265330_100444281 | 198 |
| 344 | 3300031238 | Ga0265332_10001593 | Ga0265332_100015938 | 198 |
| 345 | 3300031240 | Ga0265320_10266380 | Ga0265320_102663801 | 198 |
| 346 | 3300031241 | Ga0265325_10062361 | Ga0265325_100623612 | 198 |
| 347 | 3300031242 | Ga0265329_10002813 | Ga0265329_100028138 | 198 |
| 348 | 3300031249 | Ga0265339_10029394 | Ga0265339_100293941 | 198 |
| 349 | 3300031250 | Ga0265331_10021212 | Ga0265331_100212123 | 198 |
| 350 | 3300031251 | Ga0265327_10001510 | Ga0265327_100015107 | 198 |
| 351 | 3300031344 | Ga0265316_10000399 | Ga0265316_1000039935 | 198 |
| 352 | 3300031344 | Ga0265316_10016900 | Ga0265316_100169006 | 198 |
| 353 | 3300031344 | Ga0265316_10032551 | Ga0265316_100325514 | 198 |
| 354 | 3300031344 | Ga0265316_10037925 | Ga0265316_100379252 | 198 |
| 355 | 3300031344 | Ga0265316_10321287 | Ga0265316_103212871 | 198 |
| 356 | 3300031456 | Ga0307513_10051938 | Ga0307513_100519384 | 198 |
| 357 | 3300031595 | Ga0265313_10012632 | Ga0265313_100126327 | 198 |
| 358 | 3300031711 | Ga0265314_10000532 | Ga0265314_100005329 | 198 |
| 359 | 3300031712 | Ga0265342_10000369 | Ga0265342_100003699 | 198 |
| 360 | 3300031712 | Ga0265342_10021687 | Ga0265342_100216872 | 198 |
| 361 | 3300031712 | Ga0265342_10039132 | Ga0265342_100391323 | 198 |
| 362 | 3300031712 | Ga0265342_10201115 | Ga0265342_102011151 | 198 |
| 363 | 3300031712 | Ga0265342_10245706 | Ga0265342_102457062 | 198 |
| 364 | 3300035089 | Ga0373944_0068353 | Ga0373944_0068353_44_640 | 198 |
| 365 | 3300035692 | Ga0373935_0060037 | Ga0373935_0060037_1588_2199 | 198 |
| 366 | 3300035692 | Ga0373935_0089073 | Ga0373935_0089073_445_1053 | 198 |
| 367 | 3300035692 | Ga0373935_0146708 | Ga0373935_0146708_188_784 | 198 |
| 368 | 3300035692 | Ga0373935_0340781 | Ga0373935_0340781_356_952 | 198 |
| 369 | 3300035695 | Ga0373927_0001751 | Ga0373927_0001751_8532_9140 | 198 |
| 370 | 3300035695 | Ga0373927_0206173 | Ga0373927_0206173_637_1233 | 198 |
| 371 | 3300035695 | Ga0373927_0349768 | Ga0373927_0349768_282_881 | 198 |
| 372 | 3300035725 | Ga0373947_0235123 | Ga0373947_0235123_566_1162 | 198 |
| 373 | 3300035725 | Ga0373947_0587888 | Ga0373947_0587888_123_719 | 198 |
| 374 | 3300036401 | Ga0373937_0070632 | Ga0373937_0070632_1821_2417 | 198 |
| 375 | 3300037068 | Ga0373925_0063780 | Ga0373925_0063780_2006_2602 | 198 |
| 376 | 3300037068 | Ga0373925_0613539 | Ga0373925_0613539_267_863 | 198 |
| 377 | 3300037312 | Ga0395899_0000032 | Ga0395899_0000032_141873_142472 | 198 |
| 378 | 3300037471 | Ga0395905_0400803 | Ga0395905_0400803_536_1144 | 198 |
| 379 | 3300037853 | Ga0436364_0080357 | Ga0436364_0080357_1267_1866 | 198 |
| 380 | 3300039437 | Ga0436365_1522897 | Ga0436365_1522897_17558_18157 | 198 |
| 381 | 3300039438 | Ga0436360_0616931 | Ga0436360_0616931_470_1072 | 198 |
| 382 | 3300039438 | Ga0436360_1315258 | Ga0436360_1315258_86_700 | 198 |
| 383 | 3300039438 | Ga0436360_1325435 | Ga0436360_1325435_89_688 | 198 |
| 384 | 3300039447 | Ga0436361_0388043 | Ga0436361_0388043_155_766 | 198 |
| 385 | 3300039447 | Ga0436361_0557908 | Ga0436361_0557908_158_760 | 198 |
| 386 | 3300039447 | Ga0436361_0700772 | Ga0436361_0700772_1282_1944 | 198 |
| 387 | 3300039447 | Ga0436361_0893372 | Ga0436361_0893372_7244_7858 | 198 |
| 388 | 3300039447 | Ga0436361_1179632 | Ga0436361_1179632_803_1411 | 198 |
| 389 | 3300039447 | Ga0436361_1191486 | Ga0436361_1191486_164_784 | 198 |
| 390 | 3300039453 | Ga0436362_0248233 | Ga0436362_0248233_5626_6228 | 198 |
| 391 | 3300041486 | Ga0451807_0293516 | Ga0451807_0293516_189_800 | 198 |
| 392 | 3300041512 | Ga0451853_1143010 | Ga0451853_1143010_653_1249 | 198 |
| 393 | 3300042009 | Ga0439451_002607 | Ga0439451_002607_739_1335 | 198 |
| 394 | 3300042437 | Ga0439444_0005426 | Ga0439444_0005426_902_1498 | 198 |
| 395 | 3300042876 | Ga0451577_0002312 | Ga0451577_0002312_20648_21244 | 198 |
| 396 | 3300042876 | Ga0451577_0279471 | Ga0451577_0279471_51_650 | 198 |
| 397 | 3300042876 | Ga0451577_0501808 | Ga0451577_0501808_358_957 | 198 |
| 398 | 3300044673 | Ga0453683_0309552 | Ga0453683_0309552_102_710 | 198 |
| 399 | 3300044712 | Ga0453684_0194454 | Ga0453684_0194454_506_1102 | 198 |
| 400 | 3300044712 | Ga0453684_0279045 | Ga0453684_0279045_428_1027 | 198 |
| 401 | 3300045051 | Ga0451576_0122983 | Ga0451576_0122983_1733_2332 | 198 |
| 402 | 3300045051 | Ga0451576_0130410 | Ga0451576_0130410_1817_2428 | 198 |
| 403 | 3300045051 | Ga0451576_0137441 | Ga0451576_0137441_1637_2236 | 198 |
| 404 | 3300045051 | Ga0451576_0369722 | Ga0451576_0369722_734_1330 | 198 |
| 405 | 3300046459 | Ga0495629_0322023 | Ga0495629_0322023_323_919 | 198 |
| 406 | 3300046517 | Ga0495630_0006461 | Ga0495630_0006461_2035_2631 | 198 |
| 407 | 3300046517 | Ga0495630_0584004 | Ga0495630_0584004_108_704 | 198 |
| 408 | 3300046522 | Ga0495643_0000140 | Ga0495643_0000140_7614_8210 | 198 |
| 409 | 3300046529 | Ga0495652_0051203 | Ga0495652_0051203_2841_3437 | 198 |
| 410 | 3300046535 | Ga0495586_0024357 | Ga0495586_0024357_1461_2057 | 198 |
| 411 | 3300046536 | Ga0495587_0226618 | Ga0495587_0226618_238_834 | 198 |
| 412 | 3300046642 | Ga0495634_0035284 | Ga0495634_0035284_1892_2488 | 198 |
| 413 | 3300046664 | Ga0495659_0241389 | Ga0495659_0241389_111_710 | 198 |
| 414 | 3300046678 | Ga0495599_0180367 | Ga0495599_0180367_308_904 | 198 |
| 415 | 3300046683 | Ga0495658_0023116 | Ga0495658_0023116_1311_1907 | 198 |
| 416 | 3300046683 | Ga0495658_0234834 | Ga0495658_0234834_10_606 | 198 |
| 417 | 3300046689 | Ga0495613_0123373 | Ga0495613_0123373_237_833 | 198 |
| 418 | 3300046690 | Ga0495624_0159582 | Ga0495624_0159582_375_971 | 198 |
| 419 | 3300046690 | Ga0495624_0233331 | Ga0495624_0233331_505_1101 | 198 |
| 420 | 3300046809 | Ga0495600_0157503 | Ga0495600_0157503_362_958 | 198 |
| 421 | 3300047315 | Ga0495581_0148013 | Ga0495581_0148013_316_912 | 198 |
| 422 | 3300047315 | Ga0495581_0204574 | Ga0495581_0204574_133_729 | 198 |
| 423 | 3300047319 | Ga0495674_0152644 | Ga0495674_0152644_480_1076 | 198 |
| 424 | 3300047322 | Ga0495680_0114720 | Ga0495680_0114720_640_1236 | 198 |
| 425 | 3300047471 | Ga0495684_0027005 | Ga0495684_0027005_1933_2529 | 198 |
| 426 | 3300048088 | Ga0495602_0419471 | Ga0495602_0419471_35_631 | 198 |
| 427 | 3300048903 | Ga0496100_0156185 | Ga0496100_0156185_154_750 | 198 |
| 428 | 3300048904 | Ga0496101_0026464 | Ga0496101_0026464_497_1093 | 198 |
| 429 | 3300048904 | Ga0496101_0108311 | Ga0496101_0108311_428_1024 | 198 |
| 430 | 3300048905 | Ga0496102_0179187 | Ga0496102_0179187_1118_1714 | 198 |
| 431 | 3300048905 | Ga0496102_0907167 | Ga0496102_0907167_85_681 | 198 |
| 432 | 3300048906 | Ga0496103_0048797 | Ga0496103_0048797_780_1376 | 198 |
| 433 | 3300048907 | Ga0496104_0060283 | Ga0496104_0060283_1998_2594 | 198 |
| 434 | 3300048907 | Ga0496104_0066756 | Ga0496104_0066756_1602_2198 | 198 |
| 435 | 3300048907 | Ga0496104_0247574 | Ga0496104_0247574_758_1354 | 198 |
| 436 | 3300048908 | Ga0496105_0025727 | Ga0496105_0025727_1950_2546 | 198 |
| 437 | 3300048908 | Ga0496105_0064221 | Ga0496105_0064221_2122_2718 | 198 |
| 438 | 3300048908 | Ga0496105_0493120 | Ga0496105_0493120_200_796 | 198 |
| 439 | 3300048911 | Ga0496108_0017052 | Ga0496108_0017052_2729_3325 | 198 |
| 440 | 3300048912 | Ga0496109_0114700 | Ga0496109_0114700_601_1197 | 198 |
| 441 | 3300048914 | Ga0496111_0094905 | Ga0496111_0094905_321_917 | 198 |
| 442 | 3300048914 | Ga0496111_0416999 | Ga0496111_0416999_308_904 | 198 |
| 443 | 3300048915 | Ga0496112_0066113 | Ga0496112_0066113_336_932 | 198 |
| 444 | 3300048915 | Ga0496112_0158833 | Ga0496112_0158833_1447_2043 | 198 |
| 445 | 3300048915 | Ga0496112_0187685 | Ga0496112_0187685_379_975 | 198 |
| 446 | 3300048916 | Ga0496113_0005828 | Ga0496113_0005828_3839_4435 | 198 |
| 447 | 3300048917 | Ga0496114_0065416 | Ga0496114_0065416_1299_1895 | 198 |
| 448 | 3300048918 | Ga0496115_0010534 | Ga0496115_0010534_5898_6494 | 198 |
| 449 | 3300048918 | Ga0496115_0125813 | Ga0496115_0125813_869_1465 | 198 |
| 450 | 3300048918 | Ga0496115_0872294 | Ga0496115_0872294_71_667 | 198 |
| 451 | 3300048929 | Ga0496126_0004587 | Ga0496126_0004587_7760_8374 | 198 |
| 452 | 3300049573 | Ga0501037_0214866 | Ga0501037_0214866_715_1326 | 198 |
| 453 | 3300049581 | Ga0501047_0331523 | Ga0501047_0331523_671_1276 | 198 |
| 454 | 3300049592 | Ga0501076_0246810 | Ga0501076_0246810_677_1276 | 198 |
| 455 | 3300049683 | Ga0501253_033305 | Ga0501253_033305_188_799 | 198 |
| 456 | 3300049741 | Ga0501079_0120443 | Ga0501079_0120443_173_772 | 198 |
| 457 | 3300049823 | Ga0501044_0002707 | Ga0501044_0002707_12185_12796 | 198 |
| 458 | 3300049824 | Ga0501045_0374888 | Ga0501045_0374888_314_910 | 198 |
| 459 | 3300050507 | nmdc:mga05p37_106729_c1 | nmdc:mga05p37_106729_c1_1793_2389 | 198 |
| 460 | 3300050507 | nmdc:mga05p37_1187644_c1 | nmdc:mga05p37_1187644_c1_82_681 | 198 |
| 461 | 3300050507 | nmdc:mga05p37_284509_c1 | nmdc:mga05p37_284509_c1_784_1380 | 198 |
| 462 | 3300050507 | nmdc:mga05p37_41784_c1 | nmdc:mga05p37_41784_c1_1358_1999 | 198 |
| 463 | 3300050507 | nmdc:mga05p37_536796_c1 | nmdc:mga05p37_536796_c1_450_1055 | 198 |
| 464 | 3300050508 | nmdc:mga09592_585617_c1 | nmdc:mga09592_585617_c1_34_633 | 198 |
| 465 | 3300050510 | nmdc:mga06r32_135010_c1 | nmdc:mga06r32_135010_c1_1539_2138 | 198 |
| 466 | 3300050510 | nmdc:mga06r32_282494_c1 | nmdc:mga06r32_282494_c1_522_1163 | 198 |
| 467 | 3300050511 | nmdc:mga08y16_61283_c1 | nmdc:mga08y16_61283_c1_2487_3086 | 198 |
| 468 | 3300050512 | nmdc:mga0n895_153634_c1 | nmdc:mga0n895_153634_c1_885_1484 | 198 |
| 469 | 3300050512 | nmdc:mga0n895_154542_c1 | nmdc:mga0n895_154542_c1_351_950 | 198 |
| 470 | 3300050512 | nmdc:mga0n895_290077_c1 | nmdc:mga0n895_290077_c1_519_1160 | 198 |
| 471 | 3300050512 | nmdc:mga0n895_5168_c1 | nmdc:mga0n895_5168_c1_8713_9312 | 198 |
| 472 | 3300050512 | nmdc:mga0n895_585400_c1 | nmdc:mga0n895_585400_c1_17_613 | 198 |
| 473 | 3300050512 | nmdc:mga0n895_747784_c1 | nmdc:mga0n895_747784_c1_175_771 | 198 |
| 474 | 3300050512 | nmdc:mga0n895_87431_c1 | nmdc:mga0n895_87431_c1_775_1395 | 198 |
| 475 | 3300050512 | nmdc:mga0n895_9204_c1 | nmdc:mga0n895_9204_c1_949_1548 | 198 |
| 476 | 3300050513 | nmdc:mga0rr50_4476_c1 | nmdc:mga0rr50_4476_c1_989_1609 | 198 |
| 477 | 3300050513 | nmdc:mga0rr50_4911_c1 | nmdc:mga0rr50_4911_c1_6672_7271 | 198 |
| 478 | 3300050514 | nmdc:mga08x19_229260_c2 | nmdc:mga08x19_229260_c2_163_783 | 198 |
| 479 | 3300050514 | nmdc:mga08x19_9734_c1 | nmdc:mga08x19_9734_c1_114_713 | 198 |
| 480 | 3300050515 | nmdc:mga0a205_113461_c1 | nmdc:mga0a205_113461_c1_1635_2234 | 198 |
| 481 | 3300050515 | nmdc:mga0a205_1282_c1 | nmdc:mga0a205_1282_c1_16345_16944 | 198 |
| 482 | 3300050515 | nmdc:mga0a205_1784_c1 | nmdc:mga0a205_1784_c1_5856_6455 | 198 |
| 483 | 3300050515 | nmdc:mga0a205_18752_c1 | nmdc:mga0a205_18752_c1_2536_3135 | 198 |
| 484 | 3300050515 | nmdc:mga0a205_394606_c1 | nmdc:mga0a205_394606_c1_260_856 | 198 |
| 485 | 3300050515 | nmdc:mga0a205_63331_c1 | nmdc:mga0a205_63331_c1_2194_2793 | 198 |
| 486 | 3300053085 | Ga0495619_0045681 | Ga0495619_0045681_1381_1977 | 198 |
| 487 | 3300053178 | Ga0500637_0006632 | Ga0500637_0006632_2821_3420 | 198 |
| 488 | 3300054114 | Ga0501084_0005991 | Ga0501084_0005991_2146_2787 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5i01-assembly1.cif.gz_C | structure of phosphoheptose isomerase gmha from neisseria gonorrhoeae | 0.8621 | 4 | 182 |
| 5i01-assembly1.cif.gz_B | structure of phosphoheptose isomerase gmha from neisseria gonorrhoeae | 0.8518 | 4 | 182 |
| 2x3y-assembly1.cif.gz_C | crystal structure of gmha from burkholderia pseudomallei | 0.8394 | 3 | 182 |
| 2x3y-assembly2.cif.gz_H | crystal structure of gmha from burkholderia pseudomallei | 0.8366 | 3 | 182 |
| 7en5-assembly1.cif.gz_A | the crystal structure of escherichia coli murr in complex with n-acetylglucosamine-6-phosphate | 0.834 | 11 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5i01C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8621 | 4 | 182 | 3.40.50.10490 |
| af_P0ACS7_105_289_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8423 | 8 | 182 | 3.40.50.10490 |
| 2x3yA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8397 | 3 | 182 | 3.40.50.10490 |
| af_P46118_92_277_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8305 | 5 | 183 | 3.40.50.10490 |
| 2i2wB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8264 | 5 | 182 | 3.40.50.10490 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6RC29-F1-model_v4 | Sugar isomerase | 0.9878 | 105 | 196 |
GO:0016853
GO:0097367 GO:1901135 |
| AF-A0A7V8T0J9-F1-model_v4 | Sugar isomerase | 0.9738 | 88 | 194 |
GO:0016853
GO:0097367 GO:1901135 |
| AF-A0A381ZCB5-F1-model_v4 | SIS domain-containing protein | 0.9682 | 1 | 189 |
GO:0097367
GO:1901135 |
| AF-A0A2V5XBY7-F1-model_v4 | Sugar isomerase | 0.9677 | 98 | 195 |
GO:0016853
GO:0097367 GO:1901135 |
| AF-A0A2V8KU17-F1-model_v4 | D,D-heptose 1,7-bisphosphate phosphatase | 0.9653 | 1 | 196 |
GO:0005737
GO:0005975 GO:0016791 GO:0097367 GO:1901135 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar