F453480

General Info

Members Datasets Scaffolds Average Seq Length
487 248 974 198

Family's Representative Sequence

Representative Sequence 3300042006|Ga0439432_088431|Ga0439432_088431_113_823
Length 236
Sequence MRLDPRPGVAATRPGYRRVAIDAAYGVNHRYDVRRRRLMADPIEDVIGDYRAFAAQQRDRLATRGIDITPYALSHLAYRVPEWDQYVHVRGLIERHAVANRENVWNGRPISLIVPAEPLEVLDGKVVPLIELIPPVHQRVYKMGLEHLGVVVGDTFDAFVEAHKPVLTGQQFQGPNSIPDPVYILMEDFTHVKFYRLSLRASVELVEGPFDDGFHHADDWVPQRLVTATGPNPLPR

Samples

Sample ID Description Type Environment
1 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
166 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
167 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
168 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
172 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
173 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
179 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
180 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.11
Nodule 0
Rhizoplane 6.57
Rhizosphere 89.32
Stem 0
Stem Tuber 0
Unclassified 5.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439432_088431 3300042006 Bacteria 934
2 JGI24744J21845_10021241 3300002077 Bacteria 1278
3 JGI24034J26672_10034862 3300002239 Bacteria 830
4 Ga0070676_10179419 3300005328 Bacteria 1376
5 Ga0070683_100249145 3300005329 Bacteria 1689
6 Ga0070683_100839991 3300005329 Bacteria 881
7 Ga0070683_101034597 3300005329 Bacteria 788
8 Ga0070683_101091660 3300005329 Bacteria 766
9 Ga0070690_100058467 3300005330 Bacteria 2476
10 Ga0070670_100013556 3300005331 Bacteria 6986
11 Ga0068869_100362980 3300005334 Bacteria 1183
12 Ga0068869_100724859 3300005334 Bacteria 850
13 Ga0070666_10241695 3300005335 Bacteria 1277
14 Ga0070680_100926654 3300005336 Bacteria 752
15 Ga0070682_100075290 3300005337 Bacteria 2170
16 Ga0070682_100281320 3300005337 Bacteria 1213
17 Ga0070682_100473642 3300005337 Bacteria 964
18 Ga0070660_100939083 3300005339 Bacteria 730
19 Ga0070689_100011550 3300005340 Bacteria 6328
20 Ga0070689_100709667 3300005340 Unclassified 879
21 Ga0070687_100026232 3300005343 Bacteria 2804
22 Ga0070661_100046390 3300005344 Bacteria 3179
23 Ga0070661_100091079 3300005344 Bacteria 2258
24 Ga0070668_100606030 3300005347 Bacteria 958
25 Ga0070675_100006774 3300005354 Bacteria 8802
26 Ga0070671_100796751 3300005355 Bacteria 823
27 Ga0070674_100005759 3300005356 Bacteria 7190
28 Ga0070674_100036252 3300005356 Bacteria 3309
29 Ga0070674_100165240 3300005356 Bacteria 1682
30 Ga0070673_100540322 3300005364 Unclassified 1058
31 Ga0070673_101117523 3300005364 Bacteria 736
32 Ga0070688_100035454 3300005365 Bacteria 3031
33 Ga0070688_100398016 3300005365 Bacteria 1019
34 Ga0070659_100041354 3300005366 Bacteria 3603
35 Ga0070659_100061346 3300005366 Bacteria 2972
36 Ga0070659_100066299 3300005366 Bacteria 2861
37 Ga0070701_10003039 3300005438 Bacteria 6572
38 Ga0070705_100034373 3300005440 Bacteria 2833
39 Ga0070705_100252866 3300005440 Bacteria 1238
40 Ga0070700_100160147 3300005441 Bacteria 1548
41 Ga0070700_100488263 3300005441 Bacteria 945
42 Ga0070694_100000658 3300005444 Bacteria 19077
43 Ga0070694_100239645 3300005444 Bacteria 1368
44 Ga0070708_100060273 3300005445 Bacteria 3386
45 Ga0070708_100095635 3300005445 Bacteria 2712
46 Ga0070708_100142606 3300005445 Bacteria 2223
47 Ga0070708_100154977 3300005445 Bacteria 2132
48 Ga0070708_100766058 3300005445 Unclassified 907
49 Ga0070663_100046616 3300005455 Bacteria 3068
50 Ga0070663_100685538 3300005455 Bacteria 870
51 Ga0070678_100429819 3300005456 Bacteria 1153
52 Ga0070678_100542174 3300005456 Bacteria 1032
53 Ga0070678_100984140 3300005456 Bacteria 775
54 Ga0070662_100007118 3300005457 Bacteria 7240
55 Ga0070662_100348408 3300005457 Bacteria 1213
56 Ga0068867_100015619 3300005459 Bacteria 5388
57 Ga0068867_100027815 3300005459 Bacteria 4067
58 Ga0070685_10001705 3300005466 Bacteria 11549
59 Ga0070685_10033994 3300005466 Bacteria 2869
60 Ga0070706_100042846 3300005467 Bacteria 4182
61 Ga0070707_100042880 3300005468 Bacteria 4332
62 Ga0070707_100067224 3300005468 Bacteria 3447
63 Ga0070707_100207115 3300005468 Bacteria 1911
64 Ga0070698_100026381 3300005471 Bacteria 6047
65 Ga0070698_100031383 3300005471 Bacteria 5509
66 Ga0070698_100442195 3300005471 Bacteria 1235
67 Ga0070699_100007812 3300005518 Bacteria 9298
68 Ga0070699_100069498 3300005518 Bacteria 3060
69 Ga0070699_100318336 3300005518 Bacteria 1398
70 Ga0070699_100470147 3300005518 Bacteria 1141
71 Ga0070699_100556077 3300005518 Bacteria 1045
72 Ga0070684_100177432 3300005535 Bacteria 1936
73 Ga0070684_100616103 3300005535 Bacteria 1009
74 Ga0070697_100027505 3300005536 Bacteria 4550
75 Ga0068853_100193302 3300005539 Bacteria 1850
76 Ga0068853_100445035 3300005539 Bacteria 1218
77 Ga0070672_100264653 3300005543 Bacteria 1451
78 Ga0070672_100275553 3300005543 Bacteria 1421
79 Ga0070686_100079766 3300005544 Bacteria 2164
80 Ga0070696_100218339 3300005546 Bacteria 1430
81 Ga0070696_100427607 3300005546 Unclassified 1041
82 Ga0070693_100008108 3300005547 Bacteria 5159
83 Ga0070693_100851381 3300005547 Bacteria 680
84 Ga0070704_100170459 3300005549 Bacteria 1730
85 Ga0070704_100552967 3300005549 Bacteria 1006
86 Ga0068855_100167289 3300005563 Bacteria 2492
87 Ga0068855_100305053 3300005563 Bacteria 1763
88 Ga0070664_100131620 3300005564 Bacteria 2197
89 Ga0068857_100648467 3300005577 Bacteria 1000
90 Ga0068857_100770834 3300005577 Bacteria 917
91 Ga0068857_100839404 3300005577 Bacteria 879
92 Ga0068854_100110462 3300005578 Bacteria 2073
93 Ga0068854_100181698 3300005578 Bacteria 1643
94 Ga0070702_100009002 3300005615 Bacteria 4864
95 Ga0070702_100062497 3300005615 Bacteria 2171
96 Ga0068852_100006428 3300005616 Bacteria 8494
97 Ga0068859_100030821 3300005617 Bacteria 5382
98 Ga0068859_100562513 3300005617 Bacteria 1234
99 Ga0068859_101044253 3300005617 Bacteria 898
100 Ga0068864_100121392 3300005618 Bacteria 2337
101 Ga0068864_100522505 3300005618 Bacteria 1144
102 Ga0068866_10048162 3300005718 Bacteria 2153
103 Ga0068861_100100954 3300005719 Bacteria 2294
104 Ga0068870_10106160 3300005840 Bacteria 1596
105 Ga0068870_10153250 3300005840 Bacteria 1359
106 Ga0068863_100955037 3300005841 Bacteria 859
107 Ga0068858_100049567 3300005842 Bacteria 3888
108 Ga0068858_100563028 3300005842 Bacteria 1104
109 Ga0068860_100006449 3300005843 Bacteria 11782
110 Ga0068860_100026000 3300005843 Bacteria 5646
111 Ga0068860_100118358 3300005843 Bacteria 2535
112 Ga0068860_101054184 3300005843 Bacteria 832
113 Ga0068862_100229973 3300005844 Bacteria 1682
114 Ga0081539_10030779 3300005985 Bacteria 3325
115 Ga0075365_10129550 3300006038 Bacteria 1745
116 Ga0075368_10002098 3300006042 Bacteria 6441
117 Ga0075363_100006915 3300006048 Bacteria 5187
118 Ga0075364_10047084 3300006051 Bacteria 2808
119 Ga0075364_10083413 3300006051 Bacteria 2115
120 Ga0075362_10027543 3300006177 Bacteria 2434
121 Ga0075367_10050170 3300006178 Bacteria 2463
122 Ga0075367_10146173 3300006178 Bacteria 1466
123 Ga0097621_100018687 3300006237 Bacteria 5302
124 Ga0097621_100274925 3300006237 Bacteria 1481
125 Ga0068871_100245654 3300006358 Bacteria 1558
126 Ga0075428_100238630 3300006844 Bacteria 1962
127 Ga0075430_100496852 3300006846 Unclassified 1007
128 Ga0075431_100283448 3300006847 Bacteria 1677
129 Ga0075433_10118173 3300006852 Bacteria 2353
130 Ga0075433_10429796 3300006852 Bacteria 1164
131 Ga0075434_101160177 3300006871 Bacteria 785
132 Ga0075429_100717712 3300006880 Bacteria 876
133 Ga0068865_100174559 3300006881 Bacteria 1650
134 Ga0097620_100030821 3300006931 Bacteria 5382
135 Ga0097620_100562492 3300006931 Bacteria 1234
136 Ga0097620_101044203 3300006931 Bacteria 898
137 Ga0075435_100152440 3300007076 Bacteria 1944
138 Ga0105250_10209772 3300009092 Bacteria 823
139 Ga0111539_10014954 3300009094 Bacteria 9674
140 Ga0111539_10062044 3300009094 Bacteria 4426
141 Ga0105245_10152857 3300009098 Bacteria 2184
142 Ga0105245_10203049 3300009098 Bacteria 1904
143 Ga0105245_10381867 3300009098 Bacteria 1403
144 Ga0105245_10495199 3300009098 Bacteria 1237
145 Ga0105247_10021713 3300009101 Bacteria 3863
146 Ga0114129_10311120 3300009147 Bacteria 2097
147 Ga0114129_10493757 3300009147 Bacteria 1600
148 Ga0114129_10512673 3300009147 Bacteria 1565
149 Ga0105243_10226583 3300009148 Bacteria 1656
150 Ga0105243_10227173 3300009148 Bacteria 1654
151 Ga0105243_10269600 3300009148 Bacteria 1528
152 Ga0105243_10577687 3300009148 Bacteria 1078
153 Ga0105243_10846346 3300009148 Unclassified 905
154 Ga0105241_10677340 3300009174 Bacteria 939
155 Ga0105241_10709273 3300009174 Unclassified 919
156 Ga0105242_10522188 3300009176 Bacteria 1133
157 Ga0105242_10591947 3300009176 Bacteria 1070
158 Ga0105242_10596343 3300009176 Bacteria 1066
159 Ga0105248_10094072 3300009177 Bacteria 3375
160 Ga0105248_10365341 3300009177 Bacteria 1625
161 Ga0105237_10161548 3300009545 Bacteria 2239
162 Ga0105237_10987302 3300009545 Bacteria 849
163 Ga0105237_11232198 3300009545 Bacteria 755
164 Ga0105238_10051655 3300009551 Bacteria 4135
165 Ga0105238_10167792 3300009551 Bacteria 2171
166 Ga0105249_10020057 3300009553 Bacteria 5971
167 Ga0105249_10031473 3300009553 Bacteria 4798
168 Ga0105239_10251963 3300010375 Bacteria 1983
169 Ga0105239_10792448 3300010375 Bacteria 1086
170 Ga0105246_10008652 3300011119 Bacteria 6259
171 Ga0105246_10151503 3300011119 Bacteria 1756
172 Ga0105246_10278073 3300011119 Bacteria 1341
173 Ga0157324_1012488 3300012506 Bacteria 753
174 Ga0157378_10027497 3300013297 Bacteria 5019
175 Ga0157378_11801357 3300013297 Bacteria 660
176 Ga0163162_10047247 3300013306 Bacteria 4314
177 Ga0163162_10291924 3300013306 Bacteria 1762
178 Ga0163162_11849524 3300013306 Bacteria 691
179 Ga0157372_11583270 3300013307 Bacteria 754
180 Ga0157375_10052702 3300013308 Bacteria 4001
181 Ga0157375_10230175 3300013308 Bacteria 2012
182 Ga0157375_10688589 3300013308 Bacteria 1176
183 Ga0163163_10102583 3300014325 Bacteria 2884
184 Ga0163163_10419441 3300014325 Bacteria 1397
185 Ga0163163_10579383 3300014325 Bacteria 1185
186 Ga0163163_11416217 3300014325 Bacteria 757
187 Ga0157380_10010216 3300014326 Bacteria 6746
188 Ga0157380_10230603 3300014326 Bacteria 1663
189 Ga0157380_10443286 3300014326 Bacteria 1245
190 Ga0157380_10615802 3300014326 Bacteria 1077
191 Ga0157380_10995957 3300014326 Bacteria 871
192 Ga0157380_11587415 3300014326 Bacteria 709
193 Ga0157377_10009033 3300014745 Bacteria 4881
194 Ga0157377_10086283 3300014745 Bacteria 1844
195 Ga0157379_10246676 3300014968 Bacteria 1620
196 Ga0157379_10549679 3300014968 Bacteria 1074
197 Ga0157379_11244357 3300014968 Bacteria 717
198 Ga0163161_10021291 3300017792 Bacteria 4558
199 Ga0163161_10222632 3300017792 Bacteria 1462
200 Ga0207656_10201164 3300025321 Bacteria 962
201 Ga0207688_10002591 3300025901 Bacteria 9782
202 Ga0207688_10153600 3300025901 Bacteria 1361
203 Ga0207645_10278577 3300025907 Bacteria 1110
204 Ga0207643_10001211 3300025908 Bacteria 15257
205 Ga0207643_10027268 3300025908 Bacteria 3166
206 Ga0207684_10002138 3300025910 Bacteria 20242
207 Ga0207684_10061481 3300025910 Bacteria 3189
208 Ga0207684_10095823 3300025910 Bacteria 2532
209 Ga0207654_10262706 3300025911 Bacteria 1161
210 Ga0207662_10000414 3300025918 Bacteria 18818
211 Ga0207657_10405626 3300025919 Bacteria 1072
212 Ga0207646_10010616 3300025922 Bacteria 8970
213 Ga0207646_10013791 3300025922 Bacteria 7709
214 Ga0207646_10035863 3300025922 Bacteria 4477
215 Ga0207646_10057114 3300025922 Unclassified 3487
216 Ga0207646_10109014 3300025922 Bacteria 2484
217 Ga0207646_10833206 3300025922 Bacteria 820
218 Ga0207694_10288379 3300025924 Bacteria 1349
219 Ga0207650_10093704 3300025925 Bacteria 2299
220 Ga0207659_10116148 3300025926 Bacteria 2042
221 Ga0207659_10597697 3300025926 Bacteria 940
222 Ga0207687_10462502 3300025927 Bacteria 1054
223 Ga0207644_10979854 3300025931 Bacteria 709
224 Ga0207690_10067738 3300025932 Bacteria 2449
225 Ga0207690_10472324 3300025932 Bacteria 1011
226 Ga0207706_10005239 3300025933 Bacteria 12093
227 Ga0207706_10050286 3300025933 Bacteria 3683
228 Ga0207706_10125898 3300025933 Bacteria 2254
229 Ga0207686_10089630 3300025934 Bacteria 2028
230 Ga0207686_10383142 3300025934 Bacteria 1067
231 Ga0207709_10140659 3300025935 Bacteria 1658
232 Ga0207709_10207896 3300025935 Bacteria 1403
233 Ga0207670_10042809 3300025936 Bacteria 2986
234 Ga0207670_10085198 3300025936 Bacteria 2220
235 Ga0207670_10625121 3300025936 Unclassified 886
236 Ga0207669_10011076 3300025937 Bacteria 4373
237 Ga0207669_10015821 3300025937 Bacteria 3815
238 Ga0207669_10341169 3300025937 Bacteria 1154
239 Ga0207691_10240946 3300025940 Bacteria 1563
240 Ga0207691_10410144 3300025940 Bacteria 1155
241 Ga0207711_10130571 3300025941 Bacteria 2252
242 Ga0207689_10838893 3300025942 Bacteria 776
243 Ga0207661_10244441 3300025944 Bacteria 1593
244 Ga0207661_10532862 3300025944 Bacteria 1075
245 Ga0207661_10705191 3300025944 Bacteria 928
246 Ga0207679_10201089 3300025945 Bacteria 1664
247 Ga0207679_10460115 3300025945 Bacteria 1130
248 Ga0207667_10338214 3300025949 Bacteria 1536
249 Ga0207667_11036208 3300025949 Bacteria 806
250 Ga0207651_10188033 3300025960 Bacteria 1645
251 Ga0207712_10024579 3300025961 Bacteria 3992
252 Ga0207712_10060504 3300025961 Bacteria 2685
253 Ga0207668_10321483 3300025972 Bacteria 1284
254 Ga0207668_10792598 3300025972 Bacteria 838
255 Ga0207640_10516741 3300025981 Bacteria 997
256 Ga0207703_10073013 3300026035 Bacteria 2837
257 Ga0207703_10143976 3300026035 Bacteria 2071
258 Ga0207639_10107589 3300026041 Bacteria 2265
259 Ga0207639_10191292 3300026041 Bacteria 1748
260 Ga0207639_10511468 3300026041 Bacteria 1098
261 Ga0207678_10007915 3300026067 Bacteria 9369
262 Ga0207708_10002212 3300026075 Bacteria 14373
263 Ga0207708_10154793 3300026075 Bacteria 1807
264 Ga0207708_10278603 3300026075 Bacteria 1355
265 Ga0207708_10439950 3300026075 Bacteria 1084
266 Ga0207641_11017918 3300026088 Bacteria 825
267 Ga0207648_10022767 3300026089 Bacteria 5622
268 Ga0207648_10054411 3300026089 Bacteria 3495
269 Ga0207648_11188549 3300026089 Unclassified 716
270 Ga0207676_10091592 3300026095 Bacteria 2498
271 Ga0207676_10119848 3300026095 Bacteria 2217
272 Ga0207676_11108621 3300026095 Bacteria 782
273 Ga0207674_10107281 3300026116 Bacteria 2770
274 Ga0207674_10729374 3300026116 Bacteria 956
275 Ga0207675_100008164 3300026118 Bacteria 9866
276 Ga0207683_10059663 3300026121 Bacteria 3351
277 Ga0207698_10228417 3300026142 Bacteria 1688
278 Ga0207698_10980848 3300026142 Bacteria 855
279 Ga0210002_1028780 3300027617 Bacteria 918
280 Ga0209983_1005750 3300027665 Unclassified 2559
281 Ga0209998_10001652 3300027717 Bacteria 5336
282 Ga0209813_10018921 3300027866 Bacteria 1908
283 Ga0209974_10006617 3300027876 Bacteria 4034
284 Ga0207428_10083112 3300027907 Bacteria 2498
285 Ga0207428_10301405 3300027907 Bacteria 1186
286 Ga0268266_10897952 3300028379 Bacteria 857
287 Ga0268266_11086174 3300028379 Bacteria 774
288 Ga0268265_10204386 3300028380 Bacteria 1716
289 Ga0268264_10064798 3300028381 Bacteria 3076
290 Ga0268264_11602424 3300028381 Bacteria 662
291 Ga0307408_100039482 3300031548 Bacteria 3337
292 Ga0307408_100205507 3300031548 Bacteria 1597
293 Ga0316575_10234454 3300031665 Bacteria 768
294 Ga0316576_10060878 3300031727 Bacteria 2766
295 Ga0316576_10089686 3300031727 Unclassified 2290
296 Ga0316578_10017183 3300031728 Bacteria 3933
297 Ga0307405_10010023 3300031731 Bacteria 4888
298 Ga0307413_10210390 3300031824 Bacteria 1412
299 Ga0307413_10636155 3300031824 Bacteria 878
300 Ga0307410_10000755 3300031852 Bacteria 13555
301 Ga0307410_10338640 3300031852 Bacteria 1198
302 Ga0307407_10126336 3300031903 Bacteria 1629
303 Ga0307412_10207616 3300031911 Bacteria 1492
304 Ga0307412_10237707 3300031911 Bacteria 1407
305 Ga0307409_100328825 3300031995 Bacteria 1433
306 Ga0307409_100745226 3300031995 Bacteria 983
307 Ga0307409_100804111 3300031995 Bacteria 948
308 Ga0307416_100007702 3300032002 Bacteria 6878
309 Ga0307416_100024033 3300032002 Bacteria 4438
310 Ga0307416_100954058 3300032002 Bacteria 960
311 Ga0307414_10233638 3300032004 Bacteria 1518
312 Ga0307415_100001863 3300032126 Bacteria 10339
313 Ga0307415_100175963 3300032126 Bacteria 1674
314 Ga0316583_10078662 3300032133 Bacteria 1152
315 Ga0373950_0050940 3300034818 Bacteria 813
316 Ga0373958_0013369 3300034819 Bacteria 1421
317 Ga0373959_0079911 3300034820 Bacteria 752
318 Ga0373932_0115174 3300035112 Bacteria 891
319 Ga0373960_0030599 3300035121 Bacteria 1500
320 Ga0316574_0046696 3300035398 Bacteria 2686
321 Ga0316574_0090859 3300035398 Bacteria 1946
322 Ga0316574_0096778 3300035398 Bacteria 1886
323 Ga0316574_0111693 3300035398 Unclassified 1752
324 Ga0316574_0226660 3300035398 Bacteria 1196
325 Ga0316582_0186224 3300036647 Unclassified 1413
326 Ga0316584_0034660 3300036712 Unclassified 3742
327 Ga0395905_0070480 3300037471 Unclassified 3276
328 Ga0395901_0722740 3300038443 Bacteria 991
329 Ga0439431_0107485 3300041997 Unclassified 771
330 Ga0439462_0091760 3300042015 Bacteria 834
331 Ga0450911_009143 3300042115 Bacteria 1394
332 Ga0450911_014170 3300042115 Bacteria 1062
333 Ga0450910_024539 3300042147 Bacteria 925
334 Ga0450910_031432 3300042147 Bacteria 835
335 Ga0439459_0031491 3300042438 Bacteria 1082
336 Ga0439464_0106058 3300042439 Bacteria 857
337 Ga0451577_0044768 3300042876 Bacteria 3961
338 Ga0453684_0252005 3300044712 Bacteria 2027
339 Ga0453684_0631147 3300044712 Bacteria 1171
340 Ga0451576_0432704 3300045051 Bacteria 1381
341 Ga0466967_0206774 3300045976 Bacteria 1861
342 Ga0495617_160178 3300046452 Bacteria 714
343 Ga0495641_0039376 3300046461 Bacteria 2205
344 Ga0495594_0485649 3300046499 Bacteria 702
345 Ga0495644_0137554 3300046523 Bacteria 932
346 Ga0495598_0191668 3300046537 Bacteria 734
347 Ga0496100_0145404 3300048903 Bacteria 1685
348 Ga0496100_0659507 3300048903 Bacteria 815
349 Ga0496101_0058544 3300048904 Bacteria 2791
350 Ga0496101_0168903 3300048904 Bacteria 1680
351 Ga0496102_0028734 3300048905 Bacteria 4970
352 Ga0496102_0062730 3300048905 Bacteria 3403
353 Ga0496102_0118523 3300048905 Bacteria 2471
354 Ga0496102_0124928 3300048905 Bacteria 2404
355 Ga0496102_0383856 3300048905 Unclassified 1322
356 Ga0496103_0015070 3300048906 Bacteria 4595
357 Ga0496104_0271867 3300048907 Bacteria 1607
358 Ga0496105_0227795 3300048908 Bacteria 1515
359 Ga0496106_0306319 3300048909 Bacteria 1274
360 Ga0496106_0399642 3300048909 Bacteria 1104
361 Ga0496107_0126388 3300048910 Bacteria 1886
362 Ga0496107_0179140 3300048910 Bacteria 1574
363 Ga0496107_0641163 3300048910 Bacteria 783
364 Ga0496108_0260376 3300048911 Bacteria 1509
365 Ga0496109_0003301 3300048912 Bacteria 13471
366 Ga0496109_0064022 3300048912 Bacteria 3364
367 Ga0496109_0157617 3300048912 Bacteria 2126
368 Ga0496110_0019013 3300048913 Bacteria 5774
369 Ga0496110_0094174 3300048913 Bacteria 2682
370 Ga0496111_0217737 3300048914 Bacteria 1418
371 Ga0496112_0018634 3300048915 Bacteria 6541
372 Ga0496112_0088687 3300048915 Bacteria 3061
373 Ga0496113_0623506 3300048916 Bacteria 863
374 Ga0496113_1052479 3300048916 Bacteria 639
375 Ga0496114_0095620 3300048917 Bacteria 2528
376 Ga0496114_0106222 3300048917 Bacteria 2402
377 Ga0496114_0159137 3300048917 Bacteria 1962
378 Ga0496114_0708466 3300048917 Unclassified 882
379 Ga0501031_0189778 3300049568 Bacteria 1342
380 Ga0501031_0205430 3300049568 Bacteria 1285
381 Ga0501031_0310095 3300049568 Bacteria 1022
382 Ga0501031_0384506 3300049568 Bacteria 908
383 Ga0501033_0371975 3300049570 Bacteria 999
384 Ga0501033_0403503 3300049570 Bacteria 953
385 Ga0501034_0027740 3300049571 Bacteria 5757
386 Ga0501036_0060666 3300049572 Bacteria 3204
387 Ga0501036_0075468 3300049572 Bacteria 2851
388 Ga0501036_0319474 3300049572 Bacteria 1297
389 Ga0501038_0055952 3300049574 Bacteria 3388
390 Ga0501039_0053464 3300049575 Bacteria 3125
391 Ga0501039_0079678 3300049575 Bacteria 2548
392 Ga0501039_0407373 3300049575 Bacteria 1068
393 Ga0501040_0054141 3300049576 Bacteria 2750
394 Ga0501040_0182635 3300049576 Bacteria 1487
395 Ga0501040_0430211 3300049576 Bacteria 949
396 Ga0501040_0523902 3300049576 Unclassified 855
397 Ga0501041_0041282 3300049577 Bacteria 2802
398 Ga0501041_0105976 3300049577 Bacteria 1742
399 Ga0501041_0205893 3300049577 Bacteria 1234
400 Ga0501041_0555095 3300049577 Bacteria 732
401 Ga0501042_0110727 3300049578 Bacteria 1977
402 Ga0501042_0137265 3300049578 Bacteria 1763
403 Ga0501042_0342296 3300049578 Bacteria 1081
404 Ga0501046_0117101 3300049580 Bacteria 2030
405 Ga0501046_0189772 3300049580 Bacteria 1533
406 Ga0501048_0105164 3300049582 Bacteria 1992
407 Ga0501048_0375982 3300049582 Unclassified 1014
408 Ga0501048_0468965 3300049582 Bacteria 902
409 Ga0501048_0513055 3300049582 Bacteria 860
410 Ga0501067_0073729 3300049583 Bacteria 1891
411 Ga0501068_0414300 3300049584 Bacteria 870
412 Ga0501069_0260066 3300049585 Bacteria 1013
413 Ga0501069_0305028 3300049585 Bacteria 934
414 Ga0501070_0347747 3300049586 Bacteria 1204
415 Ga0501071_0506235 3300049587 Bacteria 926
416 Ga0501072_0101318 3300049588 Bacteria 2289
417 Ga0501072_0129159 3300049588 Bacteria 2014
418 Ga0501072_0845417 3300049588 Bacteria 716
419 Ga0501073_0001292 3300049589 Bacteria 18392
420 Ga0501073_0182684 3300049589 Bacteria 1452
421 Ga0501074_0011391 3300049590 Bacteria 6464
422 Ga0501074_0119071 3300049590 Bacteria 1888
423 Ga0501074_0554309 3300049590 Bacteria 814
424 Ga0501075_0051883 3300049591 Bacteria 3084
425 Ga0501075_0115392 3300049591 Bacteria 2042
426 Ga0501075_0180707 3300049591 Bacteria 1609
427 Ga0501075_0295753 3300049591 Bacteria 1233
428 Ga0501075_0384501 3300049591 Bacteria 1070
429 Ga0501076_0024878 3300049592 Bacteria 4631
430 Ga0501076_0064764 3300049592 Bacteria 2913
431 Ga0501076_0158849 3300049592 Unclassified 1841
432 Ga0501076_0225444 3300049592 Bacteria 1532
433 Ga0501076_0248206 3300049592 Bacteria 1456
434 Ga0501076_0556367 3300049592 Bacteria 946
435 Ga0501077_0216622 3300049593 Unclassified 1217
436 Ga0501079_0364807 3300049741 Bacteria 1132
437 Ga0501079_0450693 3300049741 Unclassified 1010
438 Ga0501079_0628070 3300049741 Bacteria 846
439 Ga0501080_0052641 3300049742 Bacteria 3789
440 Ga0501080_0417857 3300049742 Bacteria 1205
441 Ga0501080_0926845 3300049742 Bacteria 758
442 Ga0501081_0104279 3300049743 Bacteria 2007
443 Ga0501081_0163593 3300049743 Bacteria 1604
444 Ga0501081_0191793 3300049743 Bacteria 1480
445 Ga0501081_0204610 3300049743 Bacteria 1432
446 Ga0501081_0505916 3300049743 Bacteria 900
447 Ga0501083_0542086 3300049744 Bacteria 757
448 Ga0501044_0233745 3300049823 Bacteria 1785
449 Ga0501045_0024131 3300049824 Bacteria 4365
450 Ga0501045_0092996 3300049824 Bacteria 2230
451 Ga0501045_0118859 3300049824 Bacteria 1962
452 Ga0501045_0206853 3300049824 Bacteria 1462
453 nmdc:mga03683_122317_c1 3300050489 Bacteria 1158
454 nmdc:mga03683_180608_c1 3300050489 Bacteria 962
455 nmdc:mga03n38_152985_c1 3300050490 Bacteria 1162
456 nmdc:mga03n38_17509_c1 3300050490 Bacteria 2808
457 nmdc:mga03n38_242612_c1 3300050490 Bacteria 949
458 nmdc:mga00v17_28188_c1 3300050491 Bacteria 3288
459 nmdc:mga0yw44_101519_c1 3300050492 Bacteria 1833
460 nmdc:mga0yw44_16171_c1 3300050492 Bacteria 4024
461 nmdc:mga06z11_116643_c1 3300050494 Bacteria 1485
462 nmdc:mga04h51_139764_c1 3300050495 Unclassified 918
463 nmdc:mga04h51_22489_c1 3300050495 Bacteria 1908
464 nmdc:mga05p37_375870_c1 3300050507 Bacteria 1666
465 nmdc:mga06r32_13074_c1 3300050510 Bacteria 7513
466 nmdc:mga08y16_1188036_c1 3300050511 Bacteria 734
467 nmdc:mga08y16_326595_c1 3300050511 Bacteria 1579
468 nmdc:mga08y16_707035_c1 3300050511 Bacteria 1007
469 nmdc:mga08y16_8211_c1 3300050511 Bacteria 10923
470 nmdc:mga0rr50_44994_c1 3300050513 Bacteria 3241
471 nmdc:mga0a205_109363_c1 3300050515 Bacteria 2662
472 nmdc:mga0a205_148461_c1 3300050515 Bacteria 2244
473 Ga0501084_0075367 3300054114 Bacteria 2826
474 Ga0501084_0090478 3300054114 Bacteria 2569
475 Ga0501084_0168799 3300054114 Bacteria 1847
476 Ga0501084_0229531 3300054114 Bacteria 1567
477 Ga0501084_0308900 3300054114 Bacteria 1335
478 Ga0501084_0517870 3300054114 Bacteria 1008
479 Ga0590071_037206 3300059421 Bacteria 1168
480 Ga0501082_0010155 3300060353 Bacteria 8109
481 Ga0501082_0105429 3300060353 Bacteria 2439
482 Ga0501082_0415239 3300060353 Bacteria 1175
483 Ga0501082_0881969 3300060353 Bacteria 783
484 Ga0530510_0000517 3300061734 Bacteria 24636
485 Ga0530510_0024742 3300061734 Bacteria 4289
486 Ga0530510_0085828 3300061734 Bacteria 2293
487 Ga0530510_0141761 3300061734 Unclassified 1771
488 Ga0439432_088431
489 JGI24744J21845_10021241
490 JGI24034J26672_10034862
491 Ga0070676_10179419
492 Ga0070683_100249145
493 Ga0070683_100839991
494 Ga0070683_101034597
495 Ga0070683_101091660
496 Ga0070690_100058467
497 Ga0070670_100013556
498 Ga0068869_100362980
499 Ga0068869_100724859
500 Ga0070666_10241695
501 Ga0070680_100926654
502 Ga0070682_100075290
503 Ga0070682_100281320
504 Ga0070682_100473642
505 Ga0070660_100939083
506 Ga0070689_100011550
507 Ga0070689_100709667
508 Ga0070687_100026232
509 Ga0070661_100046390
510 Ga0070661_100091079
511 Ga0070668_100606030
512 Ga0070675_100006774
513 Ga0070671_100796751
514 Ga0070674_100005759
515 Ga0070674_100036252
516 Ga0070674_100165240
517 Ga0070673_100540322
518 Ga0070673_101117523
519 Ga0070688_100035454
520 Ga0070688_100398016
521 Ga0070659_100041354
522 Ga0070659_100061346
523 Ga0070659_100066299
524 Ga0070701_10003039
525 Ga0070705_100034373
526 Ga0070705_100252866
527 Ga0070700_100160147
528 Ga0070700_100488263
529 Ga0070694_100000658
530 Ga0070694_100239645
531 Ga0070708_100060273
532 Ga0070708_100095635
533 Ga0070708_100142606
534 Ga0070708_100154977
535 Ga0070708_100766058
536 Ga0070663_100046616
537 Ga0070663_100685538
538 Ga0070678_100429819
539 Ga0070678_100542174
540 Ga0070678_100984140
541 Ga0070662_100007118
542 Ga0070662_100348408
543 Ga0068867_100015619
544 Ga0068867_100027815
545 Ga0070685_10001705
546 Ga0070685_10033994
547 Ga0070706_100042846
548 Ga0070707_100042880
549 Ga0070707_100067224
550 Ga0070707_100207115
551 Ga0070698_100026381
552 Ga0070698_100031383
553 Ga0070698_100442195
554 Ga0070699_100007812
555 Ga0070699_100069498
556 Ga0070699_100318336
557 Ga0070699_100470147
558 Ga0070699_100556077
559 Ga0070684_100177432
560 Ga0070684_100616103
561 Ga0070697_100027505
562 Ga0068853_100193302
563 Ga0068853_100445035
564 Ga0070672_100264653
565 Ga0070672_100275553
566 Ga0070686_100079766
567 Ga0070696_100218339
568 Ga0070696_100427607
569 Ga0070693_100008108
570 Ga0070693_100851381
571 Ga0070704_100170459
572 Ga0070704_100552967
573 Ga0068855_100167289
574 Ga0068855_100305053
575 Ga0070664_100131620
576 Ga0068857_100648467
577 Ga0068857_100770834
578 Ga0068857_100839404
579 Ga0068854_100110462
580 Ga0068854_100181698
581 Ga0070702_100009002
582 Ga0070702_100062497
583 Ga0068852_100006428
584 Ga0068859_100030821
585 Ga0068859_100562513
586 Ga0068859_101044253
587 Ga0068864_100121392
588 Ga0068864_100522505
589 Ga0068866_10048162
590 Ga0068861_100100954
591 Ga0068870_10106160
592 Ga0068870_10153250
593 Ga0068863_100955037
594 Ga0068858_100049567
595 Ga0068858_100563028
596 Ga0068860_100006449
597 Ga0068860_100026000
598 Ga0068860_100118358
599 Ga0068860_101054184
600 Ga0068862_100229973
601 Ga0081539_10030779
602 Ga0075365_10129550
603 Ga0075368_10002098
604 Ga0075363_100006915
605 Ga0075364_10047084
606 Ga0075364_10083413
607 Ga0075362_10027543
608 Ga0075367_10050170
609 Ga0075367_10146173
610 Ga0097621_100018687
611 Ga0097621_100274925
612 Ga0068871_100245654
613 Ga0075428_100238630
614 Ga0075430_100496852
615 Ga0075431_100283448
616 Ga0075433_10118173
617 Ga0075433_10429796
618 Ga0075434_101160177
619 Ga0075429_100717712
620 Ga0068865_100174559
621 Ga0097620_100030821
622 Ga0097620_100562492
623 Ga0097620_101044203
624 Ga0075435_100152440
625 Ga0105250_10209772
626 Ga0111539_10014954
627 Ga0111539_10062044
628 Ga0105245_10152857
629 Ga0105245_10203049
630 Ga0105245_10381867
631 Ga0105245_10495199
632 Ga0105247_10021713
633 Ga0114129_10311120
634 Ga0114129_10493757
635 Ga0114129_10512673
636 Ga0105243_10226583
637 Ga0105243_10227173
638 Ga0105243_10269600
639 Ga0105243_10577687
640 Ga0105243_10846346
641 Ga0105241_10677340
642 Ga0105241_10709273
643 Ga0105242_10522188
644 Ga0105242_10591947
645 Ga0105242_10596343
646 Ga0105248_10094072
647 Ga0105248_10365341
648 Ga0105237_10161548
649 Ga0105237_10987302
650 Ga0105237_11232198
651 Ga0105238_10051655
652 Ga0105238_10167792
653 Ga0105249_10020057
654 Ga0105249_10031473
655 Ga0105239_10251963
656 Ga0105239_10792448
657 Ga0105246_10008652
658 Ga0105246_10151503
659 Ga0105246_10278073
660 Ga0157324_1012488
661 Ga0157378_10027497
662 Ga0157378_11801357
663 Ga0163162_10047247
664 Ga0163162_10291924
665 Ga0163162_11849524
666 Ga0157372_11583270
667 Ga0157375_10052702
668 Ga0157375_10230175
669 Ga0157375_10688589
670 Ga0163163_10102583
671 Ga0163163_10419441
672 Ga0163163_10579383
673 Ga0163163_11416217
674 Ga0157380_10010216
675 Ga0157380_10230603
676 Ga0157380_10443286
677 Ga0157380_10615802
678 Ga0157380_10995957
679 Ga0157380_11587415
680 Ga0157377_10009033
681 Ga0157377_10086283
682 Ga0157379_10246676
683 Ga0157379_10549679
684 Ga0157379_11244357
685 Ga0163161_10021291
686 Ga0163161_10222632
687 Ga0207656_10201164
688 Ga0207688_10002591
689 Ga0207688_10153600
690 Ga0207645_10278577
691 Ga0207643_10001211
692 Ga0207643_10027268
693 Ga0207684_10002138
694 Ga0207684_10061481
695 Ga0207684_10095823
696 Ga0207654_10262706
697 Ga0207662_10000414
698 Ga0207657_10405626
699 Ga0207646_10010616
700 Ga0207646_10013791
701 Ga0207646_10035863
702 Ga0207646_10057114
703 Ga0207646_10109014
704 Ga0207646_10833206
705 Ga0207694_10288379
706 Ga0207650_10093704
707 Ga0207659_10116148
708 Ga0207659_10597697
709 Ga0207687_10462502
710 Ga0207644_10979854
711 Ga0207690_10067738
712 Ga0207690_10472324
713 Ga0207706_10005239
714 Ga0207706_10050286
715 Ga0207706_10125898
716 Ga0207686_10089630
717 Ga0207686_10383142
718 Ga0207709_10140659
719 Ga0207709_10207896
720 Ga0207670_10042809
721 Ga0207670_10085198
722 Ga0207670_10625121
723 Ga0207669_10011076
724 Ga0207669_10015821
725 Ga0207669_10341169
726 Ga0207691_10240946
727 Ga0207691_10410144
728 Ga0207711_10130571
729 Ga0207689_10838893
730 Ga0207661_10244441
731 Ga0207661_10532862
732 Ga0207661_10705191
733 Ga0207679_10201089
734 Ga0207679_10460115
735 Ga0207667_10338214
736 Ga0207667_11036208
737 Ga0207651_10188033
738 Ga0207712_10024579
739 Ga0207712_10060504
740 Ga0207668_10321483
741 Ga0207668_10792598
742 Ga0207640_10516741
743 Ga0207703_10073013
744 Ga0207703_10143976
745 Ga0207639_10107589
746 Ga0207639_10191292
747 Ga0207639_10511468
748 Ga0207678_10007915
749 Ga0207708_10002212
750 Ga0207708_10154793
751 Ga0207708_10278603
752 Ga0207708_10439950
753 Ga0207641_11017918
754 Ga0207648_10022767
755 Ga0207648_10054411
756 Ga0207648_11188549
757 Ga0207676_10091592
758 Ga0207676_10119848
759 Ga0207676_11108621
760 Ga0207674_10107281
761 Ga0207674_10729374
762 Ga0207675_100008164
763 Ga0207683_10059663
764 Ga0207698_10228417
765 Ga0207698_10980848
766 Ga0210002_1028780
767 Ga0209983_1005750
768 Ga0209998_10001652
769 Ga0209813_10018921
770 Ga0209974_10006617
771 Ga0207428_10083112
772 Ga0207428_10301405
773 Ga0268266_10897952
774 Ga0268266_11086174
775 Ga0268265_10204386
776 Ga0268264_10064798
777 Ga0268264_11602424
778 Ga0307408_100039482
779 Ga0307408_100205507
780 Ga0316575_10234454
781 Ga0316576_10060878
782 Ga0316576_10089686
783 Ga0316578_10017183
784 Ga0307405_10010023
785 Ga0307413_10210390
786 Ga0307413_10636155
787 Ga0307410_10000755
788 Ga0307410_10338640
789 Ga0307407_10126336
790 Ga0307412_10207616
791 Ga0307412_10237707
792 Ga0307409_100328825
793 Ga0307409_100745226
794 Ga0307409_100804111
795 Ga0307416_100007702
796 Ga0307416_100024033
797 Ga0307416_100954058
798 Ga0307414_10233638
799 Ga0307415_100001863
800 Ga0307415_100175963
801 Ga0316583_10078662
802 Ga0373950_0050940
803 Ga0373958_0013369
804 Ga0373959_0079911
805 Ga0373932_0115174
806 Ga0373960_0030599
807 Ga0316574_0046696
808 Ga0316574_0090859
809 Ga0316574_0096778
810 Ga0316574_0111693
811 Ga0316574_0226660
812 Ga0316582_0186224
813 Ga0316584_0034660
814 Ga0395905_0070480
815 Ga0395901_0722740
816 Ga0439431_0107485
817 Ga0439462_0091760
818 Ga0450911_009143
819 Ga0450911_014170
820 Ga0450910_024539
821 Ga0450910_031432
822 Ga0439459_0031491
823 Ga0439464_0106058
824 Ga0451577_0044768
825 Ga0453684_0252005
826 Ga0453684_0631147
827 Ga0451576_0432704
828 Ga0466967_0206774
829 Ga0495617_160178
830 Ga0495641_0039376
831 Ga0495594_0485649
832 Ga0495644_0137554
833 Ga0495598_0191668
834 Ga0496100_0145404
835 Ga0496100_0659507
836 Ga0496101_0058544
837 Ga0496101_0168903
838 Ga0496102_0028734
839 Ga0496102_0062730
840 Ga0496102_0118523
841 Ga0496102_0124928
842 Ga0496102_0383856
843 Ga0496103_0015070
844 Ga0496104_0271867
845 Ga0496105_0227795
846 Ga0496106_0306319
847 Ga0496106_0399642
848 Ga0496107_0126388
849 Ga0496107_0179140
850 Ga0496107_0641163
851 Ga0496108_0260376
852 Ga0496109_0003301
853 Ga0496109_0064022
854 Ga0496109_0157617
855 Ga0496110_0019013
856 Ga0496110_0094174
857 Ga0496111_0217737
858 Ga0496112_0018634
859 Ga0496112_0088687
860 Ga0496113_0623506
861 Ga0496113_1052479
862 Ga0496114_0095620
863 Ga0496114_0106222
864 Ga0496114_0159137
865 Ga0496114_0708466
866 Ga0501031_0189778
867 Ga0501031_0205430
868 Ga0501031_0310095
869 Ga0501031_0384506
870 Ga0501033_0371975
871 Ga0501033_0403503
872 Ga0501034_0027740
873 Ga0501036_0060666
874 Ga0501036_0075468
875 Ga0501036_0319474
876 Ga0501038_0055952
877 Ga0501039_0053464
878 Ga0501039_0079678
879 Ga0501039_0407373
880 Ga0501040_0054141
881 Ga0501040_0182635
882 Ga0501040_0430211
883 Ga0501040_0523902
884 Ga0501041_0041282
885 Ga0501041_0105976
886 Ga0501041_0205893
887 Ga0501041_0555095
888 Ga0501042_0110727
889 Ga0501042_0137265
890 Ga0501042_0342296
891 Ga0501046_0117101
892 Ga0501046_0189772
893 Ga0501048_0105164
894 Ga0501048_0375982
895 Ga0501048_0468965
896 Ga0501048_0513055
897 Ga0501067_0073729
898 Ga0501068_0414300
899 Ga0501069_0260066
900 Ga0501069_0305028
901 Ga0501070_0347747
902 Ga0501071_0506235
903 Ga0501072_0101318
904 Ga0501072_0129159
905 Ga0501072_0845417
906 Ga0501073_0001292
907 Ga0501073_0182684
908 Ga0501074_0011391
909 Ga0501074_0119071
910 Ga0501074_0554309
911 Ga0501075_0051883
912 Ga0501075_0115392
913 Ga0501075_0180707
914 Ga0501075_0295753
915 Ga0501075_0384501
916 Ga0501076_0024878
917 Ga0501076_0064764
918 Ga0501076_0158849
919 Ga0501076_0225444
920 Ga0501076_0248206
921 Ga0501076_0556367
922 Ga0501077_0216622
923 Ga0501079_0364807
924 Ga0501079_0450693
925 Ga0501079_0628070
926 Ga0501080_0052641
927 Ga0501080_0417857
928 Ga0501080_0926845
929 Ga0501081_0104279
930 Ga0501081_0163593
931 Ga0501081_0191793
932 Ga0501081_0204610
933 Ga0501081_0505916
934 Ga0501083_0542086
935 Ga0501044_0233745
936 Ga0501045_0024131
937 Ga0501045_0092996
938 Ga0501045_0118859
939 Ga0501045_0206853
940 nmdc:mga03683_122317_c1
941 nmdc:mga03683_180608_c1
942 nmdc:mga03n38_152985_c1
943 nmdc:mga03n38_17509_c1
944 nmdc:mga03n38_242612_c1
945 nmdc:mga00v17_28188_c1
946 nmdc:mga0yw44_101519_c1
947 nmdc:mga0yw44_16171_c1
948 nmdc:mga06z11_116643_c1
949 nmdc:mga04h51_139764_c1
950 nmdc:mga04h51_22489_c1
951 nmdc:mga05p37_375870_c1
952 nmdc:mga06r32_13074_c1
953 nmdc:mga08y16_1188036_c1
954 nmdc:mga08y16_326595_c1
955 nmdc:mga08y16_707035_c1
956 nmdc:mga08y16_8211_c1
957 nmdc:mga0rr50_44994_c1
958 nmdc:mga0a205_109363_c1
959 nmdc:mga0a205_148461_c1
960 Ga0501084_0075367
961 Ga0501084_0090478
962 Ga0501084_0168799
963 Ga0501084_0229531
964 Ga0501084_0308900
965 Ga0501084_0517870
966 Ga0590071_037206
967 Ga0501082_0010155
968 Ga0501082_0105429
969 Ga0501082_0415239
970 Ga0501082_0881969
971 Ga0530510_0000517
972 Ga0530510_0024742
973 Ga0530510_0085828
974 Ga0530510_0141761

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06185

YecM

YecM protein

42

180

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k4n-assembly1.cif.gz_A structural genomics, protein ec4020 0.737 3 169
1k4n-assembly1.cif.gz_A structural genomics, protein ec4020 0.6766 3 169
3vb0-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6406 33 157
4bmx-assembly1.cif.gz_B native structure of futalosine hydrolase of helicobacter pylori strain 26695 0.6305 36 95
4ftx-assembly1.cif.gz_A crystal structure of ego3 homodimer 0.6258 58 78
ID Description Score Start End Superfamily
af_Q54MZ6_1_183_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8157 5 167 3.10.180.10
af_Q54MZ6_1_183_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7307 5 167 3.10.180.10
1k4nA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7292 3 169 3.10.180.10
af_A0A1D8PRN0_177_599_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6972 59 79 2.130.10.10
af_P9WK53_20_183_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.6933 40 77 3.40.1000.10
ID Description Score Start End GO Terms
AF-A0A0Q9JJR7-F1-model_v4 VOC domain-containing protein 0.962 12 183
AF-A0A536C024-F1-model_v4 VOC family protein 0.9582 5 180
AF-A0A316TGD1-F1-model_v4 VOC family protein 0.953 5 183
AF-A0A535MTD3-F1-model_v4 VOC family protein 0.9503 1 147
AF-A0A7Y1XQH5-F1-model_v4 VOC domain-containing protein 0.9468 2 181

Map