F453448

General Info

Members Datasets Scaffolds Average Seq Length
487 264 472 320

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10013327|Ga0157377_100133274
Length 350
Sequence VRYTAPPCFAEIFEVRIDMISVPIFHTAKSAFKILAAAAVMAGWAADASAQPYPARPVTVVVPAPAGGPTDIVGRLVAQMLTETLGQVIVVDNRTGAGLTIGTTYAAKAKPDGYTLTIASPSSHSIAPGLYPNLGYDPIKDFEPITLLVTSPTVLVIHPSLPAKSLKEFIAFARARPGQLNYGSGGNGTTSHLTAELFKTMAKVNIQHIPYKGSAPASTDLLGGQLQKMFHGLHLTLPYITTNRLRALGVTSPQRSAMAPQLPTLDESGLPGFKVNAWYGVMAPAGTPKAIIEQVNAALLRNLNAPGMKQRLANQGMVAVGSTPDELAVVVREELQVWSRVIKESRAKID

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
4 2855730933 Achromobacter sp. HZ28 Isolate Nodule
5 2855767633 Achromobacter sp. HZ34 Isolate Nodule
6 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
7 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
8 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
9 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
253 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
254 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
258 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
259 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
260 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
261 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
262 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
263 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
264 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 2.67
Rhizoplane 2.67
Rhizosphere 90.76
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3674561 2162886007 Bacteria 2283
2 JGI25151J46595_10000131 3300003187 Bacteria 100435
3 Ga0065704_10071136 3300005289 Bacteria 12914
4 Ga0065712_10081871 3300005290 Bacteria 2968
5 Ga0065707_10012311 3300005295 Unclassified 2772
6 Ga0070658_10042530 3300005327 Bacteria 3670
7 Ga0070676_10018985 3300005328 Bacteria 3819
8 Ga0070676_10078517 3300005328 Bacteria 1997
9 Ga0070683_100001833 3300005329 Bacteria 16574
10 Ga0070683_100007690 3300005329 Bacteria 9120
11 Ga0070690_100002169 3300005330 Bacteria 10489
12 Ga0070670_100001901 3300005331 Bacteria 17076
13 Ga0070670_100031787 3300005331 Bacteria 4546
14 Ga0070670_100042773 3300005331 Bacteria 3895
15 Ga0070670_100082581 3300005331 Bacteria 2761
16 Ga0070670_100179796 3300005331 Bacteria 1836
17 Ga0070677_10007204 3300005333 Bacteria 3707
18 Ga0070677_10030796 3300005333 Bacteria 2045
19 Ga0070677_10050593 3300005333 Bacteria 1678
20 Ga0068869_100138904 3300005334 Bacteria 1874
21 Ga0068869_100319676 3300005334 Bacteria 1258
22 Ga0070666_10119675 3300005335 Bacteria 1825
23 Ga0070666_10263540 3300005335 Bacteria 1222
24 Ga0070680_100002670 3300005336 Bacteria 13214
25 Ga0070682_100004844 3300005337 Bacteria 7476
26 Ga0068868_100001179 3300005338 Bacteria 17900
27 Ga0068868_100003144 3300005338 Bacteria 11490
28 Ga0068868_100010045 3300005338 Bacteria 6838
29 Ga0068868_100152880 3300005338 Bacteria 1901
30 Ga0068868_100428297 3300005338 Bacteria 1147
31 Ga0070660_100038055 3300005339 Bacteria 3650
32 Ga0070689_100000619 3300005340 Bacteria 21562
33 Ga0070689_100050572 3300005340 Bacteria 3211
34 Ga0070691_10000287 3300005341 Bacteria 17611
35 Ga0070687_100000135 3300005343 Bacteria 25620
36 Ga0070687_100127338 3300005343 Bacteria 1465
37 Ga0070661_100001142 3300005344 Bacteria 18699
38 Ga0070661_100001344 3300005344 Bacteria 17202
39 Ga0070661_100268942 3300005344 Bacteria 1319
40 Ga0070692_10000037 3300005345 Bacteria 25605
41 Ga0070668_100252911 3300005347 Bacteria 1463
42 Ga0070669_100112986 3300005353 Bacteria 2063
43 Ga0070669_100212001 3300005353 Bacteria 1528
44 Ga0070669_100309208 3300005353 Bacteria 1273
45 Ga0070669_100332902 3300005353 Bacteria 1228
46 Ga0070675_100008536 3300005354 Bacteria 7951
47 Ga0070675_100141136 3300005354 Bacteria 2059
48 Ga0070671_100002371 3300005355 Bacteria 14545
49 Ga0070671_100018386 3300005355 Bacteria 5677
50 Ga0070671_100133019 3300005355 Bacteria 2095
51 Ga0070674_100044657 3300005356 Bacteria 3023
52 Ga0070674_100118654 3300005356 Bacteria 1955
53 Ga0070673_100004880 3300005364 Bacteria 8539
54 Ga0070673_100030333 3300005364 Bacteria 4044
55 Ga0070673_100045503 3300005364 Bacteria 3404
56 Ga0070667_100024257 3300005367 Bacteria 5037
57 Ga0070667_100038460 3300005367 Bacteria 4011
58 Ga0070667_100071381 3300005367 Bacteria 2957
59 Ga0070667_100102511 3300005367 Bacteria 2473
60 Ga0070701_10078415 3300005438 Bacteria 1782
61 Ga0070705_100000022 3300005440 Bacteria 83218
62 Ga0070700_100001465 3300005441 Bacteria 11740
63 Ga0070700_100065415 3300005441 Bacteria 2305
64 Ga0070694_100003705 3300005444 Bacteria 9117
65 Ga0070663_100028135 3300005455 Bacteria 3823
66 Ga0070678_100002707 3300005456 Bacteria 9778
67 Ga0070678_100011282 3300005456 Bacteria 5505
68 Ga0070678_100070233 3300005456 Bacteria 2617
69 Ga0070678_100446177 3300005456 Bacteria 1132
70 Ga0070662_100018005 3300005457 Bacteria 4772
71 Ga0070662_100048841 3300005457 Bacteria 3050
72 Ga0070662_100131164 3300005457 Bacteria 1932
73 Ga0070662_100257598 3300005457 Bacteria 1405
74 Ga0070681_10034551 3300005458 Bacteria 5076
75 Ga0070681_10253064 3300005458 Bacteria 1674
76 Ga0068867_100000740 3300005459 Bacteria 21911
77 Ga0068867_100006691 3300005459 Bacteria 8149
78 Ga0068867_100012415 3300005459 Bacteria 6026
79 Ga0068867_100208451 3300005459 Bacteria 1568
80 Ga0070685_10022567 3300005466 Bacteria 3432
81 Ga0070685_10082847 3300005466 Bacteria 1926
82 Ga0070685_10133992 3300005466 Bacteria 1552
83 Ga0070699_100014816 3300005518 Bacteria 6704
84 Ga0070679_100033757 3300005530 Bacteria 5067
85 Ga0070684_100023500 3300005535 Bacteria 5158
86 Ga0070672_100003898 3300005543 Bacteria 9720
87 Ga0070672_100030852 3300005543 Bacteria 4031
88 Ga0070672_100393112 3300005543 Bacteria 1187
89 Ga0070686_100128947 3300005544 Bacteria 1746
90 Ga0070696_100135616 3300005546 Bacteria 1794
91 Ga0070693_100006118 3300005547 Bacteria 5831
92 Ga0070693_100042011 3300005547 Bacteria 2575
93 Ga0070665_100230112 3300005548 Bacteria 1854
94 Ga0070665_100371481 3300005548 Bacteria 1437
95 Ga0070704_100000009 3300005549 Bacteria 67191
96 Ga0068855_100015108 3300005563 Bacteria 9296
97 Ga0070664_100002397 3300005564 Bacteria 15053
98 Ga0070664_100035181 3300005564 Bacteria 4204
99 Ga0068854_100000468 3300005578 Bacteria 24905
100 Ga0068854_100012858 3300005578 Bacteria 5482
101 Ga0068854_100047685 3300005578 Bacteria 3054
102 Ga0068856_100014811 3300005614 Bacteria 7529
103 Ga0070702_100041538 3300005615 Bacteria 2580
104 Ga0068852_100000221 3300005616 Bacteria 38665
105 Ga0068852_100003572 3300005616 Bacteria 10886
106 Ga0068852_100271349 3300005616 Bacteria 1632
107 Ga0068859_100234700 3300005617 Bacteria 1923
108 Ga0068859_100278821 3300005617 Bacteria 1764
109 Ga0068864_100003124 3300005618 Bacteria 13682
110 Ga0068864_100018958 3300005618 Bacteria 5752
111 Ga0068864_100083186 3300005618 Bacteria 2810
112 Ga0068866_10000096 3300005718 Bacteria 36786
113 Ga0068866_10019551 3300005718 Bacteria 3086
114 Ga0068866_10185836 3300005718 Bacteria 1231
115 Ga0068861_100005253 3300005719 Bacteria 8729
116 Ga0068861_100153034 3300005719 Bacteria 1894
117 Ga0068851_10004198 3300005834 Bacteria 6491
118 Ga0068870_10132750 3300005840 Bacteria 1448
119 Ga0068870_10152421 3300005840 Bacteria 1363
120 Ga0068863_100012827 3300005841 Bacteria 8083
121 Ga0068863_100019807 3300005841 Bacteria 6435
122 Ga0068863_100144788 3300005841 Bacteria 2272
123 Ga0068863_100204812 3300005841 Bacteria 1899
124 Ga0068858_100006948 3300005842 Bacteria 11000
125 Ga0068858_100552905 3300005842 Bacteria 1114
126 Ga0068860_100000285 3300005843 Bacteria 72246
127 Ga0068860_100096985 3300005843 Bacteria 2810
128 Ga0068860_100229700 3300005843 Bacteria 1803
129 Ga0068860_100325651 3300005843 Bacteria 1508
130 Ga0068862_100323832 3300005844 Bacteria 1423
131 Ga0068862_100420115 3300005844 Bacteria 1255
132 Ga0068862_100505769 3300005844 Bacteria 1147
133 Ga0081455_10002509 3300005937 Bacteria 21784
134 Ga0081455_10128424 3300005937 Bacteria 1986
135 Ga0081538_10031087 3300005981 Bacteria 3609
136 Ga0081538_10050768 3300005981 Bacteria 2499
137 Ga0075364_10049824 3300006051 Bacteria 2732
138 Ga0097621_100001017 3300006237 Bacteria 19735
139 Ga0097621_100009118 3300006237 Bacteria 7190
140 Ga0097621_100025869 3300006237 Bacteria 4597
141 Ga0097621_100075359 3300006237 Bacteria 2796
142 Ga0097621_100129793 3300006237 Bacteria 2144
143 Ga0097621_100391757 3300006237 Bacteria 1242
144 Ga0068871_100001130 3300006358 Bacteria 17912
145 Ga0068871_100001363 3300006358 Bacteria 16373
146 Ga0068871_100001889 3300006358 Bacteria 14172
147 Ga0068871_100013831 3300006358 Bacteria 5999
148 Ga0075428_100037742 3300006844 Bacteria 5316
149 Ga0075428_100196797 3300006844 Bacteria 2180
150 Ga0075430_100130267 3300006846 Bacteria 2096
151 Ga0075431_100032928 3300006847 Bacteria 5342
152 Ga0075434_100184124 3300006871 Bacteria 2109
153 Ga0075429_100008362 3300006880 Bacteria 9006
154 Ga0075429_100027743 3300006880 Bacteria 4914
155 Ga0068865_100038245 3300006881 Bacteria 3246
156 Ga0075436_100054455 3300006914 Bacteria 2761
157 Ga0097620_100234707 3300006931 Bacteria 1923
158 Ga0097620_100278830 3300006931 Bacteria 1764
159 Ga0075435_100006817 3300007076 Bacteria 8105
160 Ga0075435_100111272 3300007076 Bacteria 2278
161 Ga0111539_10049365 3300009094 Bacteria 5019
162 Ga0111539_10054034 3300009094 Bacteria 4780
163 Ga0111539_10319506 3300009094 Bacteria 1807
164 Ga0111539_10395340 3300009094 Bacteria 1610
165 Ga0105245_10000086 3300009098 Bacteria 93019
166 Ga0105245_10175531 3300009098 Bacteria 2043
167 Ga0114129_10070003 3300009147 Unclassified 4891
168 Ga0114129_10084534 3300009147 Bacteria 4405
169 Ga0114129_10121335 3300009147 Bacteria 3597
170 Ga0105243_10000900 3300009148 Bacteria 27936
171 Ga0105241_10012582 3300009174 Bacteria 6208
172 Ga0105242_10001502 3300009176 Bacteria 18346
173 Ga0105242_10169475 3300009176 Bacteria 1918
174 Ga0105248_10086985 3300009177 Bacteria 3517
175 Ga0105248_10129352 3300009177 Unclassified 2848
176 Ga0105248_10148371 3300009177 Bacteria 2646
177 Ga0105248_10602124 3300009177 Bacteria 1240
178 Ga0105249_10085091 3300009553 Bacteria 2946
179 Ga0105249_10375427 3300009553 Bacteria 1446
180 Ga0105239_10034543 3300010375 Bacteria 5553
181 Ga0157371_10085522 3300013102 Bacteria 2234
182 Ga0157374_10003525 3300013296 Bacteria 13162
183 Ga0157374_10012957 3300013296 Bacteria 7269
184 Ga0157378_10001516 3300013297 Bacteria 21037
185 Ga0157378_10034102 3300013297 Bacteria 4502
186 Ga0157378_10150049 3300013297 Bacteria 2171
187 Ga0157378_10182606 3300013297 Bacteria 1974
188 Ga0163162_10012041 3300013306 Bacteria 8436
189 Ga0163162_10096248 3300013306 Bacteria 3048
190 Ga0163162_10195135 3300013306 Bacteria 2153
191 Ga0163162_10477818 3300013306 Bacteria 1378
192 Ga0157375_10004665 3300013308 Bacteria 11918
193 Ga0157375_10017440 3300013308 Bacteria 6480
194 Ga0157375_10056516 3300013308 Bacteria 3875
195 Ga0157375_10168428 3300013308 Bacteria 2337
196 Ga0163163_10069027 3300014325 Bacteria 3518
197 Ga0163163_10202863 3300014325 Unclassified 2031
198 Ga0157380_10015263 3300014326 Bacteria 5642
199 Ga0157380_10168090 3300014326 Bacteria 1913
200 Ga0157377_10013327 3300014745 Bacteria 4160
201 Ga0157377_10054733 3300014745 Bacteria 2260
202 Ga0157379_10086917 3300014968 Bacteria 2803
203 Ga0157376_10014092 3300014969 Bacteria 5988
204 Ga0157376_10017583 3300014969 Bacteria 5460
205 Ga0157376_10108602 3300014969 Bacteria 2438
206 Ga0163161_10086176 3300017792 Bacteria 2318
207 Ga0163161_10244079 3300017792 Bacteria 1398
208 Ga0209455_1000532 3300025272 Bacteria 26493
209 Ga0209025_1000028 3300025294 Bacteria 490678
210 Ga0207697_10007537 3300025315 Bacteria 4845
211 Ga0207656_10004026 3300025321 Bacteria 5098
212 Ga0207653_10024006 3300025885 Bacteria 1945
213 Ga0207682_10002790 3300025893 Bacteria 7724
214 Ga0207682_10003695 3300025893 Bacteria 6593
215 Ga0207682_10039301 3300025893 Bacteria 1923
216 Ga0207682_10052428 3300025893 Bacteria 1691
217 Ga0207642_10106722 3300025899 Bacteria 1418
218 Ga0207688_10006774 3300025901 Bacteria 6237
219 Ga0207688_10040287 3300025901 Bacteria 2596
220 Ga0207688_10167861 3300025901 Bacteria 1304
221 Ga0207680_10012453 3300025903 Bacteria 4331
222 Ga0207680_10086725 3300025903 Bacteria 1980
223 Ga0207680_10090525 3300025903 Bacteria 1945
224 Ga0207645_10009136 3300025907 Bacteria 6874
225 Ga0207645_10023149 3300025907 Bacteria 4038
226 Ga0207645_10023207 3300025907 Bacteria 4032
227 Ga0207645_10069038 3300025907 Bacteria 2260
228 Ga0207643_10016102 3300025908 Bacteria 4075
229 Ga0207643_10030227 3300025908 Bacteria 3013
230 Ga0207643_10182024 3300025908 Bacteria 1272
231 Ga0207707_10193836 3300025912 Bacteria 1772
232 Ga0207660_10002252 3300025917 Bacteria 12748
233 Ga0207662_10000288 3300025918 Bacteria 23284
234 Ga0207649_10015354 3300025920 Bacteria 4303
235 Ga0207652_10135518 3300025921 Bacteria 2199
236 Ga0207681_10061588 3300025923 Bacteria 2580
237 Ga0207681_10182880 3300025923 Bacteria 1598
238 Ga0207650_10000547 3300025925 Bacteria 30646
239 Ga0207650_10001311 3300025925 Bacteria 18007
240 Ga0207650_10004236 3300025925 Bacteria 9793
241 Ga0207650_10067661 3300025925 Bacteria 2680
242 Ga0207650_10109300 3300025925 Bacteria 2138
243 Ga0207650_10148635 3300025925 Bacteria 1847
244 Ga0207659_10000792 3300025926 Bacteria 18688
245 Ga0207659_10008965 3300025926 Bacteria 6236
246 Ga0207687_10305685 3300025927 Bacteria 1282
247 Ga0207644_10001469 3300025931 Bacteria 15200
248 Ga0207644_10004546 3300025931 Bacteria 9016
249 Ga0207644_10106963 3300025931 Bacteria 2109
250 Ga0207706_10017636 3300025933 Bacteria 6433
251 Ga0207706_10036835 3300025933 Bacteria 4345
252 Ga0207706_10194560 3300025933 Bacteria 1779
253 Ga0207706_10288854 3300025933 Bacteria 1430
254 Ga0207686_10000595 3300025934 Bacteria 22559
255 Ga0207686_10243264 3300025934 Bacteria 1310
256 Ga0207709_10001099 3300025935 Bacteria 19845
257 Ga0207670_10001960 3300025936 Bacteria 10797
258 Ga0207670_10116825 3300025936 Bacteria 1932
259 Ga0207670_10235805 3300025936 Bacteria 1407
260 Ga0207669_10147331 3300025937 Bacteria 1643
261 Ga0207704_10000193 3300025938 Bacteria 31520
262 Ga0207691_10000276 3300025940 Bacteria 50778
263 Ga0207691_10001030 3300025940 Bacteria 27614
264 Ga0207691_10057789 3300025940 Bacteria 3529
265 Ga0207691_10167919 3300025940 Bacteria 1922
266 Ga0207711_10130619 3300025941 Bacteria 2252
267 Ga0207711_10145629 3300025941 Bacteria 2134
268 Ga0207689_10000246 3300025942 Bacteria 48497
269 Ga0207689_10115512 3300025942 Bacteria 2206
270 Ga0207689_10129045 3300025942 Bacteria 2080
271 Ga0207661_10001694 3300025944 Bacteria 15026
272 Ga0207661_10096841 3300025944 Bacteria 2469
273 Ga0207679_10001570 3300025945 Bacteria 14281
274 Ga0207679_10002649 3300025945 Bacteria 11049
275 Ga0207679_10099899 3300025945 Bacteria 2267
276 Ga0207667_10008141 3300025949 Bacteria 12483
277 Ga0207651_10003905 3300025960 Bacteria 7401
278 Ga0207651_10057336 3300025960 Bacteria 2686
279 Ga0207651_10129769 3300025960 Bacteria 1927
280 Ga0207651_10206960 3300025960 Bacteria 1576
281 Ga0207712_10159842 3300025961 Bacteria 1750
282 Ga0207640_10000657 3300025981 Bacteria 20214
283 Ga0207640_10004162 3300025981 Bacteria 7825
284 Ga0207658_10055814 3300025986 Bacteria 2929
285 Ga0207658_10080732 3300025986 Bacteria 2492
286 Ga0207658_10092468 3300025986 Bacteria 2350
287 Ga0207658_10109025 3300025986 Bacteria 2185
288 Ga0207658_10160792 3300025986 Bacteria 1840
289 Ga0207677_10000888 3300026023 Bacteria 16831
290 Ga0207677_10001059 3300026023 Bacteria 15082
291 Ga0207677_10003535 3300026023 Bacteria 8282
292 Ga0207677_10083865 3300026023 Bacteria 2295
293 Ga0207703_10165117 3300026035 Bacteria 1942
294 Ga0207703_10257665 3300026035 Bacteria 1575
295 Ga0207678_10368247 3300026067 Bacteria 1241
296 Ga0207708_10000346 3300026075 Bacteria 36321
297 Ga0207708_10015904 3300026075 Bacteria 5649
298 Ga0207708_10051638 3300026075 Bacteria 3131
299 Ga0207702_10099001 3300026078 Bacteria 2570
300 Ga0207641_10009543 3300026088 Bacteria 7995
301 Ga0207641_10037686 3300026088 Bacteria 4039
302 Ga0207641_10049563 3300026088 Bacteria 3549
303 Ga0207641_10100076 3300026088 Bacteria 2552
304 Ga0207648_10000145 3300026089 Bacteria 70734
305 Ga0207648_10011175 3300026089 Bacteria 8469
306 Ga0207648_10018599 3300026089 Bacteria 6288
307 Ga0207648_10054903 3300026089 Bacteria 3478
308 Ga0207648_10108425 3300026089 Bacteria 2438
309 Ga0207676_10000711 3300026095 Bacteria 26137
310 Ga0207676_10016549 3300026095 Bacteria 5340
311 Ga0207676_10189805 3300026095 Bacteria 1807
312 Ga0207675_100001564 3300026118 Bacteria 22950
313 Ga0207675_100046179 3300026118 Bacteria 4068
314 Ga0207675_100406497 3300026118 Bacteria 1342
315 Ga0207683_10000759 3300026121 Bacteria 29341
316 Ga0207683_10015948 3300026121 Bacteria 6396
317 Ga0207683_10017802 3300026121 Bacteria 6060
318 Ga0207683_10065370 3300026121 Bacteria 3207
319 Ga0207698_10000566 3300026142 Bacteria 21574
320 Ga0207698_10013639 3300026142 Bacteria 5371
321 Ga0207698_10320530 3300026142 Bacteria 1451
322 Ga0207428_10016172 3300027907 Bacteria 6425
323 Ga0207428_10227973 3300027907 Bacteria 1395
324 Ga0268266_10047069 3300028379 Bacteria 3693
325 Ga0268266_10163878 3300028379 Bacteria 2013
326 Ga0268266_10280094 3300028379 Bacteria 1550
327 Ga0268265_10001212 3300028380 Bacteria 22414
328 Ga0268265_10351896 3300028380 Bacteria 1345
329 Ga0268264_10051975 3300028381 Bacteria 3416
330 Ga0268264_10166525 3300028381 Bacteria 1990
331 Ga0265318_10006553 3300028577 Bacteria 5346
332 Ga0265318_10024480 3300028577 Bacteria 2393
333 Ga0265338_10139773 3300028800 Bacteria 1899
334 Ga0265330_10007204 3300031235 Bacteria 5444
335 Ga0265332_10000735 3300031238 Bacteria 20401
336 Ga0265332_10003598 3300031238 Bacteria 7433
337 Ga0265332_10092510 3300031238 Bacteria 1278
338 Ga0265328_10005143 3300031239 Bacteria 5625
339 Ga0265328_10025493 3300031239 Bacteria 2227
340 Ga0265320_10021392 3300031240 Bacteria 3480
341 Ga0265320_10072348 3300031240 Bacteria 1622
342 Ga0265329_10002359 3300031242 Bacteria 8624
343 Ga0265340_10003954 3300031247 Bacteria 8335
344 Ga0265339_10002711 3300031249 Bacteria 12591
345 Ga0265331_10000832 3300031250 Bacteria 25166
346 Ga0265331_10012568 3300031250 Bacteria 4578
347 Ga0265331_10023080 3300031250 Bacteria 3166
348 Ga0265316_10023082 3300031344 Bacteria 5231
349 Ga0307408_100040828 3300031548 Bacteria 3287
350 Ga0265314_10002632 3300031711 Bacteria 18095
351 Ga0265314_10009702 3300031711 Bacteria 8097
352 Ga0265314_10039770 3300031711 Bacteria 3383
353 Ga0265314_10086938 3300031711 Bacteria 2045
354 Ga0265342_10000092 3300031712 Bacteria 99040
355 Ga0265342_10003929 3300031712 Bacteria 11935
356 Ga0307405_10013809 3300031731 Bacteria 4319
357 Ga0307413_10007421 3300031824 Bacteria 5093
358 Ga0307413_10038147 3300031824 Bacteria 2782
359 Ga0307413_10039136 3300031824 Bacteria 2755
360 Ga0307410_10004671 3300031852 Bacteria 7118
361 Ga0307407_10046002 3300031903 Bacteria 2469
362 Ga0307407_10143515 3300031903 Bacteria 1543
363 Ga0307412_10045725 3300031911 Bacteria 2864
364 Ga0307412_10156162 3300031911 Bacteria 1689
365 Ga0307409_100039707 3300031995 Bacteria 3495
366 Ga0307409_100050551 3300031995 Bacteria 3175
367 Ga0307409_100408656 3300031995 Bacteria 1299
368 Ga0307416_100192487 3300032002 Bacteria 1925
369 Ga0307414_10006140 3300032004 Bacteria 6674
370 Ga0307414_10201230 3300032004 Bacteria 1620
371 Ga0307414_10242962 3300032004 Bacteria 1491
372 Ga0307411_10026326 3300032005 Bacteria 3501
373 Ga0307411_10155383 3300032005 Bacteria 1706
374 Ga0307411_10306530 3300032005 Bacteria 1276
375 Ga0373950_0016982 3300034818 Bacteria 1250
376 Ga0373926_0004813 3300035083 Bacteria 4439
377 Ga0373940_0005327 3300035088 Unclassified 2778
378 Ga0373944_0001696 3300035089 Bacteria 5573
379 Ga0373949_0004742 3300035090 Unclassified 3085
380 Ga0373951_0017082 3300035091 Unclassified 1640
381 Ga0373952_0009972 3300035092 Unclassified 1829
382 Ga0373932_0004303 3300035112 Bacteria 3377
383 Ga0373936_0004368 3300035113 Bacteria 5345
384 Ga0373936_0048540 3300035113 Bacteria 1713
385 Ga0373939_0025008 3300035114 Unclassified 1669
386 Ga0373945_0014482 3300035116 Bacteria 2643
387 Ga0373943_0005171 3300035170 Bacteria 5872
388 Ga0373943_0011481 3300035170 Bacteria 3985
389 Ga0373946_0000679 3300035171 Bacteria 11419
390 Ga0373946_0057643 3300035171 Bacteria 1643
391 Ga0373942_0005658 3300035207 Unclassified 2896
392 Ga0373931_0121141 3300035691 Bacteria 1495
393 Ga0373935_0005822 3300035692 Bacteria 7299
394 Ga0373935_0021034 3300035692 Bacteria 3992
395 Ga0373927_0006898 3300035695 Bacteria 7718
396 Ga0373927_0029328 3300035695 Bacteria 3585
397 Ga0373947_0006482 3300035725 Bacteria 6797
398 Ga0373947_0020088 3300035725 Bacteria 3855
399 Ga0373925_0011389 3300037068 Bacteria 6446
400 Ga0373925_0027144 3300037068 Bacteria 4193
401 Ga0395900_0027735 3300037418 Bacteria 5802
402 Ga0395898_0043684 3300037466 Bacteria 4415
403 Ga0395905_0036366 3300037471 Bacteria 4624
404 Ga0451853_4038841 3300041512 Bacteria 1555
405 Ga0451577_0265590 3300042876 Bacteria 1554
406 Ga0451577_0732474 3300042876 Bacteria 895
407 Ga0466961_0067392 3300044693 Bacteria 2274
408 Ga0453684_0558773 3300044712 Bacteria 1260
409 Ga0451576_0031504 3300045051 Bacteria 5651
410 Ga0495603_0013602 3300046455 Bacteria 4924
411 Ga0495580_0002245 3300046472 Bacteria 16878
412 Ga0495582_0037819 3300046473 Bacteria 2655
413 Ga0495605_0074406 3300046474 Bacteria 1599
414 Ga0495665_0032852 3300046531 Bacteria 2776
415 Ga0495586_0003755 3300046535 Bacteria 8138
416 Ga0495633_0000926 3300046558 Bacteria 24805
417 Ga0495656_0012687 3300046615 Bacteria 3116
418 Ga0495656_0071982 3300046615 Bacteria 1538
419 Ga0495658_0001257 3300046683 Bacteria 13318
420 Ga0495658_0023385 3300046683 Bacteria 3280
421 Ga0495676_0030171 3300047321 Bacteria 4608
422 Ga0496102_0085148 3300048905 Bacteria 2918
423 Ga0496106_0040101 3300048909 Bacteria 3506
424 Ga0496106_0415453 3300048909 Bacteria 1081
425 Ga0496108_0008167 3300048911 Bacteria 8490
426 Ga0496108_0132458 3300048911 Bacteria 2142
427 Ga0496109_0024935 3300048912 Bacteria 5324
428 Ga0496109_0131358 3300048912 Bacteria 2337
429 Ga0496109_0364043 3300048912 Bacteria 1366
430 Ga0496110_0014434 3300048913 Bacteria 6560
431 Ga0496110_0054872 3300048913 Bacteria 3505
432 Ga0496111_0272659 3300048914 Bacteria 1255
433 Ga0496112_0573674 3300048915 Bacteria 1061
434 Ga0496114_0159296 3300048917 Bacteria 1961
435 Ga0496116_0010833 3300048919 Bacteria 7605
436 Ga0496118_0019291 3300048921 Bacteria 6100
437 Ga0496119_0095601 3300048922 Bacteria 1678
438 Ga0496121_0005309 3300048924 Bacteria 16570
439 Ga0496122_0004199 3300048925 Bacteria 18120
440 Ga0496122_0023593 3300048925 Bacteria 5414
441 Ga0496123_0098199 3300048926 Bacteria 1713
442 Ga0496126_0116879 3300048929 Bacteria 2318
443 Ga0501039_0051989 3300049575 Bacteria 3170
444 Ga0501040_0100588 3300049576 Bacteria 2016
445 Ga0501042_0197091 3300049578 Bacteria 1452
446 Ga0501048_0170695 3300049582 Bacteria 1541
447 Ga0501072_0000464 3300049588 Bacteria 29314
448 Ga0501075_0028335 3300049591 Bacteria 4134
449 Ga0501076_0097103 3300049592 Bacteria 2373
450 Ga0501079_0254963 3300049741 Bacteria 1371
451 Ga0501081_0062527 3300049743 Bacteria 2582
452 Ga0501081_0237567 3300049743 Bacteria 1328
453 nmdc:mga00v17_161465_c1 3300050491 Unclassified 1443
454 nmdc:mga05p37_185_c1 3300050507 Bacteria 61269
455 nmdc:mga09592_6056_c1 3300050508 Bacteria 9862
456 nmdc:mga0qj67_65216_c1 3300050509 Bacteria 2899
457 nmdc:mga06r32_237410_c1 3300050510 Bacteria 1811
458 nmdc:mga08y16_192897_c1 3300050511 Bacteria 2113
459 nmdc:mga08y16_27924_c1 3300050511 Bacteria 5950
460 nmdc:mga08y16_369507_c1 3300050511 Unclassified 1471
461 nmdc:mga08y16_515986_c1 3300050511 Bacteria 1213
462 nmdc:mga0n895_194730_c1 3300050512 Bacteria 2058
463 nmdc:mga0rr50_215890_c1 3300050513 Bacteria 1582
464 nmdc:mga0rr50_42668_c1 3300050513 Bacteria 3314
465 Ga0500644_0001546 3300053088 Bacteria 6047
466 Ga0500583_0130424 3300053092 Bacteria 1247
467 Ga0500593_000654 3300053117 Bacteria 13223
468 Ga0500590_025986 3300053148 Bacteria 3039
469 Ga0501084_0219748 3300054114 Bacteria 1603
470 Ga0501082_0258304 3300060353 Bacteria 1515
471 Ga0530510_0030871 3300061734 Bacteria 3851
472 Ga0530510_0046651 3300061734 Bacteria 3130

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0051989 Ga0501039_0051989_234_1193 245
2 3300049578 Ga0501042_0197091 Ga0501042_0197091_274_1233 245
3 3300049588 Ga0501072_0000464 Ga0501072_0000464_9183_10142 245
4 3300049591 Ga0501075_0028335 Ga0501075_0028335_3037_3996 245
5 3300049741 Ga0501079_0254963 Ga0501079_0254963_269_1228 245
6 3300049743 Ga0501081_0062527 Ga0501081_0062527_1465_2424 245
7 3300054114 Ga0501084_0219748 Ga0501084_0219748_153_1112 245
8 3300060353 Ga0501082_0258304 Ga0501082_0258304_222_1181 245
9 3300061734 Ga0530510_0030871 Ga0530510_0030871_330_1289 245
10 3300025315 Ga0207697_10007537 Ga0207697_100075372 251
11 3300049576 Ga0501040_0100588 Ga0501040_0100588_901_1860 254
12 3300049592 Ga0501076_0097103 Ga0501076_0097103_173_1132 254
13 3300005458 Ga0070681_10034551 Ga0070681_100345511 258
14 3300025912 Ga0207707_10193836 Ga0207707_101938362 258
15 3300031824 Ga0307413_10038147 Ga0307413_100381473 259
16 3300031903 Ga0307407_10143515 Ga0307407_101435152 259
17 3300031911 Ga0307412_10156162 Ga0307412_101561622 259
18 3300032002 Ga0307416_100192487 Ga0307416_1001924871 259
19 3300032004 Ga0307414_10242962 Ga0307414_102429622 259
20 3300025272 Ga0209455_1000532 Ga0209455_10005323 263
21 3300014325 Ga0163163_10202863 Ga0163163_102028632 264
22 3300028577 Ga0265318_10024480 Ga0265318_100244802 266
23 3300028800 Ga0265338_10139773 Ga0265338_101397732 266
24 3300031235 Ga0265330_10007204 Ga0265330_100072043 266
25 3300031239 Ga0265328_10025493 Ga0265328_100254932 266
26 3300031240 Ga0265320_10021392 Ga0265320_100213922 266
27 3300031250 Ga0265331_10023080 Ga0265331_100230802 266
28 3300031344 Ga0265316_10023082 Ga0265316_100230822 266
29 3300031711 Ga0265314_10002632 Ga0265314_1000263215 266
30 3300035691 Ga0373931_0121141 Ga0373931_0121141_675_1484 266
31 3300031238 Ga0265332_10000735 Ga0265332_100007359 267
32 3300031247 Ga0265340_10003954 Ga0265340_100039549 267
33 3300031249 Ga0265339_10002711 Ga0265339_1000271117 267
34 3300031250 Ga0265331_10012568 Ga0265331_100125686 267
35 3300031711 Ga0265314_10039770 Ga0265314_100397702 267
36 3300031712 Ga0265342_10000092 Ga0265342_1000009211 267
37 3300048921 Ga0496118_0019291 Ga0496118_0019291_2943_3929 270
38 3300048922 Ga0496119_0095601 Ga0496119_0095601_621_1607 270
39 3300048925 Ga0496122_0004199 Ga0496122_0004199_4030_5016 270
40 3300048926 Ga0496123_0098199 Ga0496123_0098199_444_1430 270
41 3300048929 Ga0496126_0116879 Ga0496126_0116879_269_1255 270
42 3300006051 Ga0075364_10049824 Ga0075364_100498243 272
43 3300050491 nmdc:mga00v17_161465_c1 nmdc:mga00v17_161465_c1_211_1218 272
44 3300003187 JGI25151J46595_10000131 JGI25151J46595_1000013162 275
45 3300025294 Ga0209025_1000028 Ga0209025_1000028374 275
46 3300046558 Ga0495633_0000926 Ga0495633_0000926_11710_12678 275
47 iso_pu_bacteria 2855730933 2855731768 275
48 iso_pu_bacteria 2855767633 2855768474 275
49 iso_pu_bacteria 2881412998 2881414918 275
50 iso_pu_bacteria 2939631187 2939633961 275
51 3300005331 Ga0070670_100031787 Ga0070670_1000317873 276
52 3300005338 Ga0068868_100428297 Ga0068868_1004282971 276
53 3300005353 Ga0070669_100332902 Ga0070669_1003329022 276
54 3300005367 Ga0070667_100024257 Ga0070667_1000242575 276
55 3300005456 Ga0070678_100446177 Ga0070678_1004461771 276
56 3300005457 Ga0070662_100257598 Ga0070662_1002575982 276
57 3300005466 Ga0070685_10133992 Ga0070685_101339921 276
58 3300005618 Ga0068864_100018958 Ga0068864_1000189585 276
59 3300005841 Ga0068863_100012827 Ga0068863_1000128275 276
60 3300005843 Ga0068860_100229700 Ga0068860_1002297002 276
61 3300006237 Ga0097621_100129793 Ga0097621_1001297932 276
62 3300006358 Ga0068871_100013831 Ga0068871_1000138316 276
63 3300006871 Ga0075434_100184124 Ga0075434_1001841242 276
64 3300007076 Ga0075435_100006817 Ga0075435_1000068177 276
65 3300009177 Ga0105248_10148371 Ga0105248_101483712 276
66 3300013308 Ga0157375_10056516 Ga0157375_100565162 276
67 3300025923 Ga0207681_10182880 Ga0207681_101828802 276
68 3300025925 Ga0207650_10000547 Ga0207650_100005473 276
69 3300025925 Ga0207650_10067661 Ga0207650_100676612 276
70 3300025926 Ga0207659_10008965 Ga0207659_100089653 276
71 3300025940 Ga0207691_10057789 Ga0207691_100577893 276
72 3300025945 Ga0207679_10099899 Ga0207679_100998992 276
73 3300025960 Ga0207651_10129769 Ga0207651_101297691 276
74 3300025986 Ga0207658_10080732 Ga0207658_100807322 276
75 3300026088 Ga0207641_10009543 Ga0207641_100095432 276
76 3300026095 Ga0207676_10000711 Ga0207676_100007113 276
77 3300042876 Ga0451577_0265590 Ga0451577_0265590_10_960 276
78 3300046683 Ga0495658_0023385 Ga0495658_0023385_1798_2754 276
79 3300048913 Ga0496110_0054872 Ga0496110_0054872_1153_2148 276
80 3300048915 Ga0496112_0573674 Ga0496112_0573674_117_998 276
81 3300048924 Ga0496121_0005309 Ga0496121_0005309_12325_13320 276
82 3300050512 nmdc:mga0n895_194730_c1 nmdc:mga0n895_194730_c1_170_1117 276
83 3300050513 nmdc:mga0rr50_42668_c1 nmdc:mga0rr50_42668_c1_1441_2388 276
84 3300053148 Ga0500590_025986 Ga0500590_025986_1192_2208 276
85 iso_pu_bacteria 2508501042 2508693028 276
86 iso_pu_bacteria 2515154112 2515630093 276
87 iso_pu_bacteria 2935694250 2935700832 276
88 iso_pu_bacteria 2935975950 2935981858 276
89 iso_pu_bacteria 8016583857 8016584535 276
90 iso_pu_bacteria 8019619141 8019620947 276
91 iso_pu_bacteria 8019629233 8019629604 276
92 iso_pu_bacteria 8019638758 8019648294 276
93 iso_pu_bacteria 8019659431 8019659746 276
94 iso_pu_bacteria 8019668869 8019669205 276
95 iso_pu_bacteria 8019678201 8019678275 276
96 2162886007 SwRhRL2b_contig_3674561 SwRhRL2b_0919.00001540 277
97 3300005289 Ga0065704_10071136 Ga0065704_1007113613 277
98 3300005290 Ga0065712_10081871 Ga0065712_100818712 277
99 3300005295 Ga0065707_10012311 Ga0065707_100123112 277
100 3300005327 Ga0070658_10042530 Ga0070658_100425302 277
101 3300005328 Ga0070676_10018985 Ga0070676_100189852 277
102 3300005328 Ga0070676_10078517 Ga0070676_100785172 277
103 3300005329 Ga0070683_100001833 Ga0070683_10000183311 277
104 3300005329 Ga0070683_100007690 Ga0070683_1000076903 277
105 3300005330 Ga0070690_100002169 Ga0070690_1000021692 277
106 3300005331 Ga0070670_100001901 Ga0070670_10000190112 277
107 3300005331 Ga0070670_100042773 Ga0070670_1000427733 277
108 3300005331 Ga0070670_100082581 Ga0070670_1000825812 277
109 3300005331 Ga0070670_100179796 Ga0070670_1001797961 277
110 3300005333 Ga0070677_10007204 Ga0070677_100072045 277
111 3300005333 Ga0070677_10030796 Ga0070677_100307962 277
112 3300005333 Ga0070677_10050593 Ga0070677_100505931 277
113 3300005334 Ga0068869_100138904 Ga0068869_1001389041 277
114 3300005334 Ga0068869_100319676 Ga0068869_1003196761 277
115 3300005335 Ga0070666_10119675 Ga0070666_101196751 277
116 3300005335 Ga0070666_10263540 Ga0070666_102635401 277
117 3300005336 Ga0070680_100002670 Ga0070680_1000026709 277
118 3300005337 Ga0070682_100004844 Ga0070682_1000048444 277
119 3300005338 Ga0068868_100001179 Ga0068868_1000011795 277
120 3300005338 Ga0068868_100003144 Ga0068868_10000314410 277
121 3300005338 Ga0068868_100010045 Ga0068868_1000100454 277
122 3300005338 Ga0068868_100152880 Ga0068868_1001528802 277
123 3300005339 Ga0070660_100038055 Ga0070660_1000380552 277
124 3300005340 Ga0070689_100000619 Ga0070689_1000006192 277
125 3300005340 Ga0070689_100050572 Ga0070689_1000505722 277
126 3300005341 Ga0070691_10000287 Ga0070691_100002876 277
127 3300005343 Ga0070687_100000135 Ga0070687_10000013521 277
128 3300005343 Ga0070687_100127338 Ga0070687_1001273381 277
129 3300005344 Ga0070661_100001142 Ga0070661_10000114214 277
130 3300005344 Ga0070661_100001344 Ga0070661_1000013446 277
131 3300005344 Ga0070661_100268942 Ga0070661_1002689421 277
132 3300005345 Ga0070692_10000037 Ga0070692_1000003716 277
133 3300005347 Ga0070668_100252911 Ga0070668_1002529112 277
134 3300005353 Ga0070669_100112986 Ga0070669_1001129862 277
135 3300005353 Ga0070669_100212001 Ga0070669_1002120012 277
136 3300005353 Ga0070669_100309208 Ga0070669_1003092082 277
137 3300005354 Ga0070675_100008536 Ga0070675_1000085365 277
138 3300005354 Ga0070675_100141136 Ga0070675_1001411361 277
139 3300005355 Ga0070671_100002371 Ga0070671_1000023719 277
140 3300005355 Ga0070671_100018386 Ga0070671_1000183864 277
141 3300005355 Ga0070671_100133019 Ga0070671_1001330192 277
142 3300005356 Ga0070674_100044657 Ga0070674_1000446572 277
143 3300005356 Ga0070674_100118654 Ga0070674_1001186542 277
144 3300005364 Ga0070673_100004880 Ga0070673_1000048807 277
145 3300005364 Ga0070673_100030333 Ga0070673_1000303334 277
146 3300005364 Ga0070673_100045503 Ga0070673_1000455032 277
147 3300005367 Ga0070667_100038460 Ga0070667_1000384603 277
148 3300005367 Ga0070667_100071381 Ga0070667_1000713811 277
149 3300005367 Ga0070667_100102511 Ga0070667_1001025112 277
150 3300005438 Ga0070701_10078415 Ga0070701_100784151 277
151 3300005440 Ga0070705_100000022 Ga0070705_10000002268 277
152 3300005441 Ga0070700_100001465 Ga0070700_1000014652 277
153 3300005441 Ga0070700_100065415 Ga0070700_1000654151 277
154 3300005444 Ga0070694_100003705 Ga0070694_1000037058 277
155 3300005455 Ga0070663_100028135 Ga0070663_1000281352 277
156 3300005456 Ga0070678_100002707 Ga0070678_1000027075 277
157 3300005456 Ga0070678_100011282 Ga0070678_1000112824 277
158 3300005456 Ga0070678_100070233 Ga0070678_1000702332 277
159 3300005457 Ga0070662_100018005 Ga0070662_1000180054 277
160 3300005457 Ga0070662_100048841 Ga0070662_1000488413 277
161 3300005457 Ga0070662_100131164 Ga0070662_1001311642 277
162 3300005458 Ga0070681_10253064 Ga0070681_102530642 277
163 3300005459 Ga0068867_100000740 Ga0068867_1000007406 277
164 3300005459 Ga0068867_100006691 Ga0068867_1000066916 277
165 3300005459 Ga0068867_100012415 Ga0068867_1000124154 277
166 3300005459 Ga0068867_100208451 Ga0068867_1002084512 277
167 3300005466 Ga0070685_10022567 Ga0070685_100225673 277
168 3300005466 Ga0070685_10082847 Ga0070685_100828472 277
169 3300005518 Ga0070699_100014816 Ga0070699_1000148165 277
170 3300005530 Ga0070679_100033757 Ga0070679_1000337575 277
171 3300005535 Ga0070684_100023500 Ga0070684_1000235003 277
172 3300005543 Ga0070672_100003898 Ga0070672_1000038989 277
173 3300005543 Ga0070672_100030852 Ga0070672_1000308524 277
174 3300005543 Ga0070672_100393112 Ga0070672_1003931122 277
175 3300005544 Ga0070686_100128947 Ga0070686_1001289471 277
176 3300005546 Ga0070696_100135616 Ga0070696_1001356162 277
177 3300005547 Ga0070693_100006118 Ga0070693_1000061185 277
178 3300005547 Ga0070693_100042011 Ga0070693_1000420113 277
179 3300005548 Ga0070665_100230112 Ga0070665_1002301122 277
180 3300005548 Ga0070665_100371481 Ga0070665_1003714812 277
181 3300005549 Ga0070704_100000009 Ga0070704_1000000092 277
182 3300005563 Ga0068855_100015108 Ga0068855_1000151089 277
183 3300005564 Ga0070664_100002397 Ga0070664_10000239710 277
184 3300005564 Ga0070664_100035181 Ga0070664_1000351812 277
185 3300005578 Ga0068854_100000468 Ga0068854_1000004685 277
186 3300005578 Ga0068854_100012858 Ga0068854_1000128585 277
187 3300005578 Ga0068854_100047685 Ga0068854_1000476852 277
188 3300005614 Ga0068856_100014811 Ga0068856_1000148116 277
189 3300005615 Ga0070702_100041538 Ga0070702_1000415382 277
190 3300005616 Ga0068852_100000221 Ga0068852_1000002214 277
191 3300005616 Ga0068852_100003572 Ga0068852_1000035722 277
192 3300005616 Ga0068852_100271349 Ga0068852_1002713492 277
193 3300005617 Ga0068859_100234700 Ga0068859_1002347002 277
194 3300005617 Ga0068859_100278821 Ga0068859_1002788212 277
195 3300005618 Ga0068864_100003124 Ga0068864_1000031245 277
196 3300005618 Ga0068864_100083186 Ga0068864_1000831862 277
197 3300005718 Ga0068866_10000096 Ga0068866_100000966 277
198 3300005718 Ga0068866_10019551 Ga0068866_100195513 277
199 3300005718 Ga0068866_10185836 Ga0068866_101858362 277
200 3300005719 Ga0068861_100005253 Ga0068861_1000052532 277
201 3300005719 Ga0068861_100153034 Ga0068861_1001530342 277
202 3300005834 Ga0068851_10004198 Ga0068851_100041984 277
203 3300005840 Ga0068870_10132750 Ga0068870_101327502 277
204 3300005840 Ga0068870_10152421 Ga0068870_101524212 277
205 3300005841 Ga0068863_100019807 Ga0068863_1000198072 277
206 3300005841 Ga0068863_100144788 Ga0068863_1001447882 277
207 3300005841 Ga0068863_100204812 Ga0068863_1002048121 277
208 3300005842 Ga0068858_100006948 Ga0068858_10000694810 277
209 3300005842 Ga0068858_100552905 Ga0068858_1005529052 277
210 3300005843 Ga0068860_100000285 Ga0068860_10000028521 277
211 3300005843 Ga0068860_100096985 Ga0068860_1000969852 277
212 3300005843 Ga0068860_100325651 Ga0068860_1003256511 277
213 3300005844 Ga0068862_100323832 Ga0068862_1003238322 277
214 3300005844 Ga0068862_100420115 Ga0068862_1004201151 277
215 3300005844 Ga0068862_100505769 Ga0068862_1005057692 277
216 3300005937 Ga0081455_10002509 Ga0081455_1000250920 277
217 3300005937 Ga0081455_10128424 Ga0081455_101284242 277
218 3300005981 Ga0081538_10031087 Ga0081538_100310876 277
219 3300005981 Ga0081538_10050768 Ga0081538_100507682 277
220 3300006237 Ga0097621_100001017 Ga0097621_10000101710 277
221 3300006237 Ga0097621_100009118 Ga0097621_1000091186 277
222 3300006237 Ga0097621_100025869 Ga0097621_1000258693 277
223 3300006237 Ga0097621_100075359 Ga0097621_1000753592 277
224 3300006237 Ga0097621_100391757 Ga0097621_1003917572 277
225 3300006358 Ga0068871_100001130 Ga0068871_1000011304 277
226 3300006358 Ga0068871_100001363 Ga0068871_10000136315 277
227 3300006358 Ga0068871_100001889 Ga0068871_10000188910 277
228 3300006844 Ga0075428_100037742 Ga0075428_1000377427 277
229 3300006844 Ga0075428_100196797 Ga0075428_1001967972 277
230 3300006846 Ga0075430_100130267 Ga0075430_1001302673 277
231 3300006847 Ga0075431_100032928 Ga0075431_1000329284 277
232 3300006880 Ga0075429_100008362 Ga0075429_10000836210 277
233 3300006880 Ga0075429_100027743 Ga0075429_1000277432 277
234 3300006881 Ga0068865_100038245 Ga0068865_1000382453 277
235 3300006914 Ga0075436_100054455 Ga0075436_1000544552 277
236 3300006931 Ga0097620_100234707 Ga0097620_1002347072 277
237 3300006931 Ga0097620_100278830 Ga0097620_1002788302 277
238 3300007076 Ga0075435_100111272 Ga0075435_1001112722 277
239 3300009094 Ga0111539_10049365 Ga0111539_100493652 277
240 3300009094 Ga0111539_10054034 Ga0111539_100540344 277
241 3300009094 Ga0111539_10319506 Ga0111539_103195061 277
242 3300009094 Ga0111539_10395340 Ga0111539_103953401 277
243 3300009098 Ga0105245_10000086 Ga0105245_1000008644 277
244 3300009098 Ga0105245_10175531 Ga0105245_101755312 277
245 3300009147 Ga0114129_10070003 Ga0114129_100700032 277
246 3300009147 Ga0114129_10084534 Ga0114129_100845343 277
247 3300009147 Ga0114129_10121335 Ga0114129_101213354 277
248 3300009148 Ga0105243_10000900 Ga0105243_1000090022 277
249 3300009174 Ga0105241_10012582 Ga0105241_100125824 277
250 3300009176 Ga0105242_10001502 Ga0105242_1000150214 277
251 3300009176 Ga0105242_10169475 Ga0105242_101694751 277
252 3300009177 Ga0105248_10086985 Ga0105248_100869853 277
253 3300009177 Ga0105248_10129352 Ga0105248_101293523 277
254 3300009177 Ga0105248_10602124 Ga0105248_106021242 277
255 3300009553 Ga0105249_10085091 Ga0105249_100850912 277
256 3300009553 Ga0105249_10375427 Ga0105249_103754272 277
257 3300010375 Ga0105239_10034543 Ga0105239_100345434 277
258 3300013102 Ga0157371_10085522 Ga0157371_100855222 277
259 3300013296 Ga0157374_10003525 Ga0157374_1000352511 277
260 3300013296 Ga0157374_10012957 Ga0157374_100129574 277
261 3300013297 Ga0157378_10001516 Ga0157378_100015161 277
262 3300013297 Ga0157378_10034102 Ga0157378_100341023 277
263 3300013297 Ga0157378_10150049 Ga0157378_101500492 277
264 3300013297 Ga0157378_10182606 Ga0157378_101826061 277
265 3300013306 Ga0163162_10012041 Ga0163162_100120414 277
266 3300013306 Ga0163162_10096248 Ga0163162_100962483 277
267 3300013306 Ga0163162_10195135 Ga0163162_101951352 277
268 3300013306 Ga0163162_10477818 Ga0163162_104778181 277
269 3300013308 Ga0157375_10004665 Ga0157375_100046653 277
270 3300013308 Ga0157375_10017440 Ga0157375_100174403 277
271 3300013308 Ga0157375_10168428 Ga0157375_101684282 277
272 3300014325 Ga0163163_10069027 Ga0163163_100690272 277
273 3300014326 Ga0157380_10015263 Ga0157380_100152632 277
274 3300014326 Ga0157380_10168090 Ga0157380_101680902 277
275 3300014745 Ga0157377_10013327 Ga0157377_100133274 277
276 3300014745 Ga0157377_10054733 Ga0157377_100547332 277
277 3300014968 Ga0157379_10086917 Ga0157379_100869172 277
278 3300014969 Ga0157376_10014092 Ga0157376_100140924 277
279 3300014969 Ga0157376_10017583 Ga0157376_100175833 277
280 3300014969 Ga0157376_10108602 Ga0157376_101086022 277
281 3300017792 Ga0163161_10086176 Ga0163161_100861763 277
282 3300017792 Ga0163161_10244079 Ga0163161_102440792 277
283 3300025321 Ga0207656_10004026 Ga0207656_100040263 277
284 3300025885 Ga0207653_10024006 Ga0207653_100240062 277
285 3300025893 Ga0207682_10002790 Ga0207682_100027907 277
286 3300025893 Ga0207682_10003695 Ga0207682_100036955 277
287 3300025893 Ga0207682_10039301 Ga0207682_100393011 277
288 3300025893 Ga0207682_10052428 Ga0207682_100524282 277
289 3300025899 Ga0207642_10106722 Ga0207642_101067221 277
290 3300025901 Ga0207688_10006774 Ga0207688_100067746 277
291 3300025901 Ga0207688_10040287 Ga0207688_100402871 277
292 3300025901 Ga0207688_10167861 Ga0207688_101678611 277
293 3300025903 Ga0207680_10012453 Ga0207680_100124533 277
294 3300025903 Ga0207680_10086725 Ga0207680_100867252 277
295 3300025903 Ga0207680_10090525 Ga0207680_100905251 277
296 3300025907 Ga0207645_10009136 Ga0207645_100091362 277
297 3300025907 Ga0207645_10023149 Ga0207645_100231492 277
298 3300025907 Ga0207645_10023207 Ga0207645_100232072 277
299 3300025907 Ga0207645_10069038 Ga0207645_100690382 277
300 3300025908 Ga0207643_10016102 Ga0207643_100161021 277
301 3300025908 Ga0207643_10030227 Ga0207643_100302272 277
302 3300025908 Ga0207643_10182024 Ga0207643_101820241 277
303 3300025917 Ga0207660_10002252 Ga0207660_100022522 277
304 3300025918 Ga0207662_10000288 Ga0207662_1000028821 277
305 3300025920 Ga0207649_10015354 Ga0207649_100153543 277
306 3300025921 Ga0207652_10135518 Ga0207652_101355183 277
307 3300025923 Ga0207681_10061588 Ga0207681_100615882 277
308 3300025925 Ga0207650_10001311 Ga0207650_100013114 277
309 3300025925 Ga0207650_10004236 Ga0207650_100042369 277
310 3300025925 Ga0207650_10109300 Ga0207650_101093002 277
311 3300025925 Ga0207650_10148635 Ga0207650_101486351 277
312 3300025926 Ga0207659_10000792 Ga0207659_100007924 277
313 3300025927 Ga0207687_10305685 Ga0207687_103056851 277
314 3300025931 Ga0207644_10001469 Ga0207644_100014693 277
315 3300025931 Ga0207644_10004546 Ga0207644_100045466 277
316 3300025931 Ga0207644_10106963 Ga0207644_101069632 277
317 3300025933 Ga0207706_10017636 Ga0207706_100176366 277
318 3300025933 Ga0207706_10036835 Ga0207706_100368355 277
319 3300025933 Ga0207706_10194560 Ga0207706_101945602 277
320 3300025933 Ga0207706_10288854 Ga0207706_102888542 277
321 3300025934 Ga0207686_10000595 Ga0207686_1000059517 277
322 3300025934 Ga0207686_10243264 Ga0207686_102432642 277
323 3300025935 Ga0207709_10001099 Ga0207709_1000109910 277
324 3300025936 Ga0207670_10001960 Ga0207670_100019602 277
325 3300025936 Ga0207670_10116825 Ga0207670_101168251 277
326 3300025936 Ga0207670_10235805 Ga0207670_102358052 277
327 3300025937 Ga0207669_10147331 Ga0207669_101473311 277
328 3300025938 Ga0207704_10000193 Ga0207704_100001935 277
329 3300025940 Ga0207691_10000276 Ga0207691_1000027613 277
330 3300025940 Ga0207691_10001030 Ga0207691_1000103015 277
331 3300025940 Ga0207691_10167919 Ga0207691_101679191 277
332 3300025941 Ga0207711_10130619 Ga0207711_101306193 277
333 3300025941 Ga0207711_10145629 Ga0207711_101456292 277
334 3300025942 Ga0207689_10000246 Ga0207689_1000024625 277
335 3300025942 Ga0207689_10115512 Ga0207689_101155122 277
336 3300025942 Ga0207689_10129045 Ga0207689_101290452 277
337 3300025944 Ga0207661_10001694 Ga0207661_100016942 277
338 3300025944 Ga0207661_10096841 Ga0207661_100968412 277
339 3300025945 Ga0207679_10001570 Ga0207679_100015704 277
340 3300025945 Ga0207679_10002649 Ga0207679_100026499 277
341 3300025949 Ga0207667_10008141 Ga0207667_100081415 277
342 3300025960 Ga0207651_10003905 Ga0207651_100039056 277
343 3300025960 Ga0207651_10057336 Ga0207651_100573362 277
344 3300025960 Ga0207651_10206960 Ga0207651_102069602 277
345 3300025961 Ga0207712_10159842 Ga0207712_101598421 277
346 3300025981 Ga0207640_10000657 Ga0207640_100006574 277
347 3300025981 Ga0207640_10004162 Ga0207640_100041622 277
348 3300025986 Ga0207658_10055814 Ga0207658_100558142 277
349 3300025986 Ga0207658_10092468 Ga0207658_100924682 277
350 3300025986 Ga0207658_10109025 Ga0207658_101090252 277
351 3300025986 Ga0207658_10160792 Ga0207658_101607922 277
352 3300026023 Ga0207677_10000888 Ga0207677_1000088815 277
353 3300026023 Ga0207677_10001059 Ga0207677_1000105913 277
354 3300026023 Ga0207677_10003535 Ga0207677_100035354 277
355 3300026023 Ga0207677_10083865 Ga0207677_100838652 277
356 3300026035 Ga0207703_10165117 Ga0207703_101651172 277
357 3300026035 Ga0207703_10257665 Ga0207703_102576652 277
358 3300026067 Ga0207678_10368247 Ga0207678_103682472 277
359 3300026075 Ga0207708_10000346 Ga0207708_1000034628 277
360 3300026075 Ga0207708_10015904 Ga0207708_100159042 277
361 3300026075 Ga0207708_10051638 Ga0207708_100516382 277
362 3300026078 Ga0207702_10099001 Ga0207702_100990013 277
363 3300026088 Ga0207641_10037686 Ga0207641_100376864 277
364 3300026088 Ga0207641_10049563 Ga0207641_100495633 277
365 3300026088 Ga0207641_10100076 Ga0207641_101000763 277
366 3300026089 Ga0207648_10000145 Ga0207648_1000014545 277
367 3300026089 Ga0207648_10011175 Ga0207648_100111752 277
368 3300026089 Ga0207648_10018599 Ga0207648_100185994 277
369 3300026089 Ga0207648_10054903 Ga0207648_100549032 277
370 3300026089 Ga0207648_10108425 Ga0207648_101084252 277
371 3300026095 Ga0207676_10016549 Ga0207676_100165496 277
372 3300026095 Ga0207676_10189805 Ga0207676_101898052 277
373 3300026118 Ga0207675_100001564 Ga0207675_1000015646 277
374 3300026118 Ga0207675_100046179 Ga0207675_1000461793 277
375 3300026118 Ga0207675_100406497 Ga0207675_1004064971 277
376 3300026121 Ga0207683_10000759 Ga0207683_1000075913 277
377 3300026121 Ga0207683_10015948 Ga0207683_100159484 277
378 3300026121 Ga0207683_10017802 Ga0207683_100178023 277
379 3300026121 Ga0207683_10065370 Ga0207683_100653702 277
380 3300026142 Ga0207698_10000566 Ga0207698_1000056615 277
381 3300026142 Ga0207698_10013639 Ga0207698_100136393 277
382 3300026142 Ga0207698_10320530 Ga0207698_103205301 277
383 3300027907 Ga0207428_10016172 Ga0207428_100161726 277
384 3300027907 Ga0207428_10227973 Ga0207428_102279731 277
385 3300028379 Ga0268266_10047069 Ga0268266_100470692 277
386 3300028379 Ga0268266_10163878 Ga0268266_101638782 277
387 3300028379 Ga0268266_10280094 Ga0268266_102800941 277
388 3300028380 Ga0268265_10001212 Ga0268265_100012126 277
389 3300028380 Ga0268265_10351896 Ga0268265_103518961 277
390 3300028381 Ga0268264_10051975 Ga0268264_100519754 277
391 3300028381 Ga0268264_10166525 Ga0268264_101665252 277
392 3300028577 Ga0265318_10006553 Ga0265318_100065534 277
393 3300031238 Ga0265332_10003598 Ga0265332_100035985 277
394 3300031238 Ga0265332_10092510 Ga0265332_100925102 277
395 3300031239 Ga0265328_10005143 Ga0265328_100051432 277
396 3300031240 Ga0265320_10072348 Ga0265320_100723482 277
397 3300031242 Ga0265329_10002359 Ga0265329_100023597 277
398 3300031250 Ga0265331_10000832 Ga0265331_100008328 277
399 3300031548 Ga0307408_100040828 Ga0307408_1000408282 277
400 3300031711 Ga0265314_10009702 Ga0265314_100097026 277
401 3300031711 Ga0265314_10086938 Ga0265314_100869382 277
402 3300031712 Ga0265342_10003929 Ga0265342_100039299 277
403 3300031731 Ga0307405_10013809 Ga0307405_100138093 277
404 3300031824 Ga0307413_10007421 Ga0307413_100074214 277
405 3300031824 Ga0307413_10039136 Ga0307413_100391362 277
406 3300031852 Ga0307410_10004671 Ga0307410_100046715 277
407 3300031903 Ga0307407_10046002 Ga0307407_100460022 277
408 3300031911 Ga0307412_10045725 Ga0307412_100457252 277
409 3300031995 Ga0307409_100039707 Ga0307409_1000397072 277
410 3300031995 Ga0307409_100050551 Ga0307409_1000505513 277
411 3300031995 Ga0307409_100408656 Ga0307409_1004086562 277
412 3300032004 Ga0307414_10006140 Ga0307414_100061404 277
413 3300032004 Ga0307414_10201230 Ga0307414_102012301 277
414 3300032005 Ga0307411_10026326 Ga0307411_100263262 277
415 3300032005 Ga0307411_10155383 Ga0307411_101553832 277
416 3300032005 Ga0307411_10306530 Ga0307411_103065301 277
417 3300034818 Ga0373950_0016982 Ga0373950_0016982_129_1115 277
418 3300035083 Ga0373926_0004813 Ga0373926_0004813_2495_3460 277
419 3300035088 Ga0373940_0005327 Ga0373940_0005327_13_999 277
420 3300035089 Ga0373944_0001696 Ga0373944_0001696_2703_3656 277
421 3300035090 Ga0373949_0004742 Ga0373949_0004742_1791_2777 277
422 3300035091 Ga0373951_0017082 Ga0373951_0017082_343_1329 277
423 3300035092 Ga0373952_0009972 Ga0373952_0009972_400_1386 277
424 3300035112 Ga0373932_0004303 Ga0373932_0004303_2073_3059 277
425 3300035113 Ga0373936_0004368 Ga0373936_0004368_488_1441 277
426 3300035113 Ga0373936_0048540 Ga0373936_0048540_502_1467 277
427 3300035114 Ga0373939_0025008 Ga0373939_0025008_292_1278 277
428 3300035116 Ga0373945_0014482 Ga0373945_0014482_1355_2308 277
429 3300035170 Ga0373943_0005171 Ga0373943_0005171_2053_3006 277
430 3300035170 Ga0373943_0011481 Ga0373943_0011481_466_1431 277
431 3300035171 Ga0373946_0000679 Ga0373946_0000679_7271_8224 277
432 3300035171 Ga0373946_0057643 Ga0373946_0057643_242_1207 277
433 3300035207 Ga0373942_0005658 Ga0373942_0005658_99_1085 277
434 3300035692 Ga0373935_0005822 Ga0373935_0005822_2868_3821 277
435 3300035692 Ga0373935_0021034 Ga0373935_0021034_975_1940 277
436 3300035695 Ga0373927_0006898 Ga0373927_0006898_4271_5224 277
437 3300035695 Ga0373927_0029328 Ga0373927_0029328_393_1358 277
438 3300035725 Ga0373947_0006482 Ga0373947_0006482_2496_3449 277
439 3300035725 Ga0373947_0020088 Ga0373947_0020088_2426_3391 277
440 3300037068 Ga0373925_0011389 Ga0373925_0011389_2998_3951 277
441 3300037068 Ga0373925_0027144 Ga0373925_0027144_2386_3351 277
442 3300037418 Ga0395900_0027735 Ga0395900_0027735_4795_5766 277
443 3300037466 Ga0395898_0043684 Ga0395898_0043684_1913_2884 277
444 3300037471 Ga0395905_0036366 Ga0395905_0036366_860_1831 277
445 3300041512 Ga0451853_4038841 Ga0451853_4038841_176_1141 277
446 3300042876 Ga0451577_0732474 Ga0451577_0732474_13_882 277
447 3300044693 Ga0466961_0067392 Ga0466961_0067392_87_1091 277
448 3300044712 Ga0453684_0558773 Ga0453684_0558773_128_1150 277
449 3300045051 Ga0451576_0031504 Ga0451576_0031504_1560_2525 277
450 3300046455 Ga0495603_0013602 Ga0495603_0013602_1828_2781 277
451 3300046472 Ga0495580_0002245 Ga0495580_0002245_3089_4042 277
452 3300046473 Ga0495582_0037819 Ga0495582_0037819_1144_2097 277
453 3300046474 Ga0495605_0074406 Ga0495605_0074406_457_1422 277
454 3300046531 Ga0495665_0032852 Ga0495665_0032852_1577_2530 277
455 3300046535 Ga0495586_0003755 Ga0495586_0003755_4543_5496 277
456 3300046615 Ga0495656_0012687 Ga0495656_0012687_2010_3029 277
457 3300046615 Ga0495656_0071982 Ga0495656_0071982_38_1009 277
458 3300046683 Ga0495658_0001257 Ga0495658_0001257_10245_11198 277
459 3300047321 Ga0495676_0030171 Ga0495676_0030171_1708_2661 277
460 3300048905 Ga0496102_0085148 Ga0496102_0085148_188_1153 277
461 3300048909 Ga0496106_0040101 Ga0496106_0040101_686_1567 277
462 3300048909 Ga0496106_0415453 Ga0496106_0415453_16_906 277
463 3300048911 Ga0496108_0008167 Ga0496108_0008167_1755_2720 277
464 3300048911 Ga0496108_0132458 Ga0496108_0132458_886_1767 277
465 3300048912 Ga0496109_0024935 Ga0496109_0024935_2605_3570 277
466 3300048912 Ga0496109_0131358 Ga0496109_0131358_434_1315 277
467 3300048912 Ga0496109_0364043 Ga0496109_0364043_57_929 277
468 3300048913 Ga0496110_0014434 Ga0496110_0014434_3235_4200 277
469 3300048914 Ga0496111_0272659 Ga0496111_0272659_15_980 277
470 3300048917 Ga0496114_0159296 Ga0496114_0159296_159_1040 277
471 3300048919 Ga0496116_0010833 Ga0496116_0010833_4087_5103 277
472 3300048925 Ga0496122_0023593 Ga0496122_0023593_3056_4072 277
473 3300049582 Ga0501048_0170695 Ga0501048_0170695_445_1416 277
474 3300049743 Ga0501081_0237567 Ga0501081_0237567_16_987 277
475 3300050507 nmdc:mga05p37_185_c1 nmdc:mga05p37_185_c1_929_1894 277
476 3300050508 nmdc:mga09592_6056_c1 nmdc:mga09592_6056_c1_535_1500 277
477 3300050509 nmdc:mga0qj67_65216_c1 nmdc:mga0qj67_65216_c1_760_1767 277
478 3300050510 nmdc:mga06r32_237410_c1 nmdc:mga06r32_237410_c1_322_1329 277
479 3300050511 nmdc:mga08y16_192897_c1 nmdc:mga08y16_192897_c1_1011_1976 277
480 3300050511 nmdc:mga08y16_27924_c1 nmdc:mga08y16_27924_c1_4617_5582 277
481 3300050511 nmdc:mga08y16_369507_c1 nmdc:mga08y16_369507_c1_87_1085 277
482 3300050511 nmdc:mga08y16_515986_c1 nmdc:mga08y16_515986_c1_63_1034 277
483 3300050513 nmdc:mga0rr50_215890_c1 nmdc:mga0rr50_215890_c1_45_983 277
484 3300053088 Ga0500644_0001546 Ga0500644_0001546_4460_5494 277
485 3300053092 Ga0500583_0130424 Ga0500583_0130424_50_1015 277
486 3300053117 Ga0500593_000654 Ga0500593_000654_70_1077 277
487 3300061734 Ga0530510_0046651 Ga0530510_0046651_1416_2387 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

73

346

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9558 2 277
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9491 2 277
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9459 2 277
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9393 2 277
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9291 2 274
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9571 80 197 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9433 79 201 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9405 80 202 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9266 81 202 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9262 80 202 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A3A3FMR4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9749 2 277
AF-A0A261UKM0-F1-model_v4 ABC transporter substrate-binding protein 0.974 2 277
AF-A0A1F4DK31-F1-model_v4 LacI family transcriptional regulator 0.9732 2 277
AF-A0A4R3USR2-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9728 2 277
AF-A0A2G4JA32-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9726 2 277

Feature Viewer

pLDDT pTM Quality
94.01 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map