F453448
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 487 | 264 | 472 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300014745|Ga0157377_10013327|Ga0157377_100133274 |
| Length | 350 |
| Sequence | VRYTAPPCFAEIFEVRIDMISVPIFHTAKSAFKILAAAAVMAGWAADASAQPYPARPVTVVVPAPAGGPTDIVGRLVAQMLTETLGQVIVVDNRTGAGLTIGTTYAAKAKPDGYTLTIASPSSHSIAPGLYPNLGYDPIKDFEPITLLVTSPTVLVIHPSLPAKSLKEFIAFARARPGQLNYGSGGNGTTSHLTAELFKTMAKVNIQHIPYKGSAPASTDLLGGQLQKMFHGLHLTLPYITTNRLRALGVTSPQRSAMAPQLPTLDESGLPGFKVNAWYGVMAPAGTPKAIIEQVNAALLRNLNAPGMKQRLANQGMVAVGSTPDELAVVVREELQVWSRVIKESRAKID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 4 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 5 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 6 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 7 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 8 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 9 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 176 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 184 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 189 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 208 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 228 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 229 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 230 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 231 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 232 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 233 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 234 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 244 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 253 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 254 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 255 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 258 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 259 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 260 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 261 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 262 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 263 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 264 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.92 |
| Metatranscriptomes | 0 |
| Isolates | 3.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.85 |
| Nodule | 2.67 |
| Rhizoplane | 2.67 |
| Rhizosphere | 90.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3674561 | 2162886007 | Bacteria | 2283 |
| 2 | JGI25151J46595_10000131 | 3300003187 | Bacteria | 100435 |
| 3 | Ga0065704_10071136 | 3300005289 | Bacteria | 12914 |
| 4 | Ga0065712_10081871 | 3300005290 | Bacteria | 2968 |
| 5 | Ga0065707_10012311 | 3300005295 | Unclassified | 2772 |
| 6 | Ga0070658_10042530 | 3300005327 | Bacteria | 3670 |
| 7 | Ga0070676_10018985 | 3300005328 | Bacteria | 3819 |
| 8 | Ga0070676_10078517 | 3300005328 | Bacteria | 1997 |
| 9 | Ga0070683_100001833 | 3300005329 | Bacteria | 16574 |
| 10 | Ga0070683_100007690 | 3300005329 | Bacteria | 9120 |
| 11 | Ga0070690_100002169 | 3300005330 | Bacteria | 10489 |
| 12 | Ga0070670_100001901 | 3300005331 | Bacteria | 17076 |
| 13 | Ga0070670_100031787 | 3300005331 | Bacteria | 4546 |
| 14 | Ga0070670_100042773 | 3300005331 | Bacteria | 3895 |
| 15 | Ga0070670_100082581 | 3300005331 | Bacteria | 2761 |
| 16 | Ga0070670_100179796 | 3300005331 | Bacteria | 1836 |
| 17 | Ga0070677_10007204 | 3300005333 | Bacteria | 3707 |
| 18 | Ga0070677_10030796 | 3300005333 | Bacteria | 2045 |
| 19 | Ga0070677_10050593 | 3300005333 | Bacteria | 1678 |
| 20 | Ga0068869_100138904 | 3300005334 | Bacteria | 1874 |
| 21 | Ga0068869_100319676 | 3300005334 | Bacteria | 1258 |
| 22 | Ga0070666_10119675 | 3300005335 | Bacteria | 1825 |
| 23 | Ga0070666_10263540 | 3300005335 | Bacteria | 1222 |
| 24 | Ga0070680_100002670 | 3300005336 | Bacteria | 13214 |
| 25 | Ga0070682_100004844 | 3300005337 | Bacteria | 7476 |
| 26 | Ga0068868_100001179 | 3300005338 | Bacteria | 17900 |
| 27 | Ga0068868_100003144 | 3300005338 | Bacteria | 11490 |
| 28 | Ga0068868_100010045 | 3300005338 | Bacteria | 6838 |
| 29 | Ga0068868_100152880 | 3300005338 | Bacteria | 1901 |
| 30 | Ga0068868_100428297 | 3300005338 | Bacteria | 1147 |
| 31 | Ga0070660_100038055 | 3300005339 | Bacteria | 3650 |
| 32 | Ga0070689_100000619 | 3300005340 | Bacteria | 21562 |
| 33 | Ga0070689_100050572 | 3300005340 | Bacteria | 3211 |
| 34 | Ga0070691_10000287 | 3300005341 | Bacteria | 17611 |
| 35 | Ga0070687_100000135 | 3300005343 | Bacteria | 25620 |
| 36 | Ga0070687_100127338 | 3300005343 | Bacteria | 1465 |
| 37 | Ga0070661_100001142 | 3300005344 | Bacteria | 18699 |
| 38 | Ga0070661_100001344 | 3300005344 | Bacteria | 17202 |
| 39 | Ga0070661_100268942 | 3300005344 | Bacteria | 1319 |
| 40 | Ga0070692_10000037 | 3300005345 | Bacteria | 25605 |
| 41 | Ga0070668_100252911 | 3300005347 | Bacteria | 1463 |
| 42 | Ga0070669_100112986 | 3300005353 | Bacteria | 2063 |
| 43 | Ga0070669_100212001 | 3300005353 | Bacteria | 1528 |
| 44 | Ga0070669_100309208 | 3300005353 | Bacteria | 1273 |
| 45 | Ga0070669_100332902 | 3300005353 | Bacteria | 1228 |
| 46 | Ga0070675_100008536 | 3300005354 | Bacteria | 7951 |
| 47 | Ga0070675_100141136 | 3300005354 | Bacteria | 2059 |
| 48 | Ga0070671_100002371 | 3300005355 | Bacteria | 14545 |
| 49 | Ga0070671_100018386 | 3300005355 | Bacteria | 5677 |
| 50 | Ga0070671_100133019 | 3300005355 | Bacteria | 2095 |
| 51 | Ga0070674_100044657 | 3300005356 | Bacteria | 3023 |
| 52 | Ga0070674_100118654 | 3300005356 | Bacteria | 1955 |
| 53 | Ga0070673_100004880 | 3300005364 | Bacteria | 8539 |
| 54 | Ga0070673_100030333 | 3300005364 | Bacteria | 4044 |
| 55 | Ga0070673_100045503 | 3300005364 | Bacteria | 3404 |
| 56 | Ga0070667_100024257 | 3300005367 | Bacteria | 5037 |
| 57 | Ga0070667_100038460 | 3300005367 | Bacteria | 4011 |
| 58 | Ga0070667_100071381 | 3300005367 | Bacteria | 2957 |
| 59 | Ga0070667_100102511 | 3300005367 | Bacteria | 2473 |
| 60 | Ga0070701_10078415 | 3300005438 | Bacteria | 1782 |
| 61 | Ga0070705_100000022 | 3300005440 | Bacteria | 83218 |
| 62 | Ga0070700_100001465 | 3300005441 | Bacteria | 11740 |
| 63 | Ga0070700_100065415 | 3300005441 | Bacteria | 2305 |
| 64 | Ga0070694_100003705 | 3300005444 | Bacteria | 9117 |
| 65 | Ga0070663_100028135 | 3300005455 | Bacteria | 3823 |
| 66 | Ga0070678_100002707 | 3300005456 | Bacteria | 9778 |
| 67 | Ga0070678_100011282 | 3300005456 | Bacteria | 5505 |
| 68 | Ga0070678_100070233 | 3300005456 | Bacteria | 2617 |
| 69 | Ga0070678_100446177 | 3300005456 | Bacteria | 1132 |
| 70 | Ga0070662_100018005 | 3300005457 | Bacteria | 4772 |
| 71 | Ga0070662_100048841 | 3300005457 | Bacteria | 3050 |
| 72 | Ga0070662_100131164 | 3300005457 | Bacteria | 1932 |
| 73 | Ga0070662_100257598 | 3300005457 | Bacteria | 1405 |
| 74 | Ga0070681_10034551 | 3300005458 | Bacteria | 5076 |
| 75 | Ga0070681_10253064 | 3300005458 | Bacteria | 1674 |
| 76 | Ga0068867_100000740 | 3300005459 | Bacteria | 21911 |
| 77 | Ga0068867_100006691 | 3300005459 | Bacteria | 8149 |
| 78 | Ga0068867_100012415 | 3300005459 | Bacteria | 6026 |
| 79 | Ga0068867_100208451 | 3300005459 | Bacteria | 1568 |
| 80 | Ga0070685_10022567 | 3300005466 | Bacteria | 3432 |
| 81 | Ga0070685_10082847 | 3300005466 | Bacteria | 1926 |
| 82 | Ga0070685_10133992 | 3300005466 | Bacteria | 1552 |
| 83 | Ga0070699_100014816 | 3300005518 | Bacteria | 6704 |
| 84 | Ga0070679_100033757 | 3300005530 | Bacteria | 5067 |
| 85 | Ga0070684_100023500 | 3300005535 | Bacteria | 5158 |
| 86 | Ga0070672_100003898 | 3300005543 | Bacteria | 9720 |
| 87 | Ga0070672_100030852 | 3300005543 | Bacteria | 4031 |
| 88 | Ga0070672_100393112 | 3300005543 | Bacteria | 1187 |
| 89 | Ga0070686_100128947 | 3300005544 | Bacteria | 1746 |
| 90 | Ga0070696_100135616 | 3300005546 | Bacteria | 1794 |
| 91 | Ga0070693_100006118 | 3300005547 | Bacteria | 5831 |
| 92 | Ga0070693_100042011 | 3300005547 | Bacteria | 2575 |
| 93 | Ga0070665_100230112 | 3300005548 | Bacteria | 1854 |
| 94 | Ga0070665_100371481 | 3300005548 | Bacteria | 1437 |
| 95 | Ga0070704_100000009 | 3300005549 | Bacteria | 67191 |
| 96 | Ga0068855_100015108 | 3300005563 | Bacteria | 9296 |
| 97 | Ga0070664_100002397 | 3300005564 | Bacteria | 15053 |
| 98 | Ga0070664_100035181 | 3300005564 | Bacteria | 4204 |
| 99 | Ga0068854_100000468 | 3300005578 | Bacteria | 24905 |
| 100 | Ga0068854_100012858 | 3300005578 | Bacteria | 5482 |
| 101 | Ga0068854_100047685 | 3300005578 | Bacteria | 3054 |
| 102 | Ga0068856_100014811 | 3300005614 | Bacteria | 7529 |
| 103 | Ga0070702_100041538 | 3300005615 | Bacteria | 2580 |
| 104 | Ga0068852_100000221 | 3300005616 | Bacteria | 38665 |
| 105 | Ga0068852_100003572 | 3300005616 | Bacteria | 10886 |
| 106 | Ga0068852_100271349 | 3300005616 | Bacteria | 1632 |
| 107 | Ga0068859_100234700 | 3300005617 | Bacteria | 1923 |
| 108 | Ga0068859_100278821 | 3300005617 | Bacteria | 1764 |
| 109 | Ga0068864_100003124 | 3300005618 | Bacteria | 13682 |
| 110 | Ga0068864_100018958 | 3300005618 | Bacteria | 5752 |
| 111 | Ga0068864_100083186 | 3300005618 | Bacteria | 2810 |
| 112 | Ga0068866_10000096 | 3300005718 | Bacteria | 36786 |
| 113 | Ga0068866_10019551 | 3300005718 | Bacteria | 3086 |
| 114 | Ga0068866_10185836 | 3300005718 | Bacteria | 1231 |
| 115 | Ga0068861_100005253 | 3300005719 | Bacteria | 8729 |
| 116 | Ga0068861_100153034 | 3300005719 | Bacteria | 1894 |
| 117 | Ga0068851_10004198 | 3300005834 | Bacteria | 6491 |
| 118 | Ga0068870_10132750 | 3300005840 | Bacteria | 1448 |
| 119 | Ga0068870_10152421 | 3300005840 | Bacteria | 1363 |
| 120 | Ga0068863_100012827 | 3300005841 | Bacteria | 8083 |
| 121 | Ga0068863_100019807 | 3300005841 | Bacteria | 6435 |
| 122 | Ga0068863_100144788 | 3300005841 | Bacteria | 2272 |
| 123 | Ga0068863_100204812 | 3300005841 | Bacteria | 1899 |
| 124 | Ga0068858_100006948 | 3300005842 | Bacteria | 11000 |
| 125 | Ga0068858_100552905 | 3300005842 | Bacteria | 1114 |
| 126 | Ga0068860_100000285 | 3300005843 | Bacteria | 72246 |
| 127 | Ga0068860_100096985 | 3300005843 | Bacteria | 2810 |
| 128 | Ga0068860_100229700 | 3300005843 | Bacteria | 1803 |
| 129 | Ga0068860_100325651 | 3300005843 | Bacteria | 1508 |
| 130 | Ga0068862_100323832 | 3300005844 | Bacteria | 1423 |
| 131 | Ga0068862_100420115 | 3300005844 | Bacteria | 1255 |
| 132 | Ga0068862_100505769 | 3300005844 | Bacteria | 1147 |
| 133 | Ga0081455_10002509 | 3300005937 | Bacteria | 21784 |
| 134 | Ga0081455_10128424 | 3300005937 | Bacteria | 1986 |
| 135 | Ga0081538_10031087 | 3300005981 | Bacteria | 3609 |
| 136 | Ga0081538_10050768 | 3300005981 | Bacteria | 2499 |
| 137 | Ga0075364_10049824 | 3300006051 | Bacteria | 2732 |
| 138 | Ga0097621_100001017 | 3300006237 | Bacteria | 19735 |
| 139 | Ga0097621_100009118 | 3300006237 | Bacteria | 7190 |
| 140 | Ga0097621_100025869 | 3300006237 | Bacteria | 4597 |
| 141 | Ga0097621_100075359 | 3300006237 | Bacteria | 2796 |
| 142 | Ga0097621_100129793 | 3300006237 | Bacteria | 2144 |
| 143 | Ga0097621_100391757 | 3300006237 | Bacteria | 1242 |
| 144 | Ga0068871_100001130 | 3300006358 | Bacteria | 17912 |
| 145 | Ga0068871_100001363 | 3300006358 | Bacteria | 16373 |
| 146 | Ga0068871_100001889 | 3300006358 | Bacteria | 14172 |
| 147 | Ga0068871_100013831 | 3300006358 | Bacteria | 5999 |
| 148 | Ga0075428_100037742 | 3300006844 | Bacteria | 5316 |
| 149 | Ga0075428_100196797 | 3300006844 | Bacteria | 2180 |
| 150 | Ga0075430_100130267 | 3300006846 | Bacteria | 2096 |
| 151 | Ga0075431_100032928 | 3300006847 | Bacteria | 5342 |
| 152 | Ga0075434_100184124 | 3300006871 | Bacteria | 2109 |
| 153 | Ga0075429_100008362 | 3300006880 | Bacteria | 9006 |
| 154 | Ga0075429_100027743 | 3300006880 | Bacteria | 4914 |
| 155 | Ga0068865_100038245 | 3300006881 | Bacteria | 3246 |
| 156 | Ga0075436_100054455 | 3300006914 | Bacteria | 2761 |
| 157 | Ga0097620_100234707 | 3300006931 | Bacteria | 1923 |
| 158 | Ga0097620_100278830 | 3300006931 | Bacteria | 1764 |
| 159 | Ga0075435_100006817 | 3300007076 | Bacteria | 8105 |
| 160 | Ga0075435_100111272 | 3300007076 | Bacteria | 2278 |
| 161 | Ga0111539_10049365 | 3300009094 | Bacteria | 5019 |
| 162 | Ga0111539_10054034 | 3300009094 | Bacteria | 4780 |
| 163 | Ga0111539_10319506 | 3300009094 | Bacteria | 1807 |
| 164 | Ga0111539_10395340 | 3300009094 | Bacteria | 1610 |
| 165 | Ga0105245_10000086 | 3300009098 | Bacteria | 93019 |
| 166 | Ga0105245_10175531 | 3300009098 | Bacteria | 2043 |
| 167 | Ga0114129_10070003 | 3300009147 | Unclassified | 4891 |
| 168 | Ga0114129_10084534 | 3300009147 | Bacteria | 4405 |
| 169 | Ga0114129_10121335 | 3300009147 | Bacteria | 3597 |
| 170 | Ga0105243_10000900 | 3300009148 | Bacteria | 27936 |
| 171 | Ga0105241_10012582 | 3300009174 | Bacteria | 6208 |
| 172 | Ga0105242_10001502 | 3300009176 | Bacteria | 18346 |
| 173 | Ga0105242_10169475 | 3300009176 | Bacteria | 1918 |
| 174 | Ga0105248_10086985 | 3300009177 | Bacteria | 3517 |
| 175 | Ga0105248_10129352 | 3300009177 | Unclassified | 2848 |
| 176 | Ga0105248_10148371 | 3300009177 | Bacteria | 2646 |
| 177 | Ga0105248_10602124 | 3300009177 | Bacteria | 1240 |
| 178 | Ga0105249_10085091 | 3300009553 | Bacteria | 2946 |
| 179 | Ga0105249_10375427 | 3300009553 | Bacteria | 1446 |
| 180 | Ga0105239_10034543 | 3300010375 | Bacteria | 5553 |
| 181 | Ga0157371_10085522 | 3300013102 | Bacteria | 2234 |
| 182 | Ga0157374_10003525 | 3300013296 | Bacteria | 13162 |
| 183 | Ga0157374_10012957 | 3300013296 | Bacteria | 7269 |
| 184 | Ga0157378_10001516 | 3300013297 | Bacteria | 21037 |
| 185 | Ga0157378_10034102 | 3300013297 | Bacteria | 4502 |
| 186 | Ga0157378_10150049 | 3300013297 | Bacteria | 2171 |
| 187 | Ga0157378_10182606 | 3300013297 | Bacteria | 1974 |
| 188 | Ga0163162_10012041 | 3300013306 | Bacteria | 8436 |
| 189 | Ga0163162_10096248 | 3300013306 | Bacteria | 3048 |
| 190 | Ga0163162_10195135 | 3300013306 | Bacteria | 2153 |
| 191 | Ga0163162_10477818 | 3300013306 | Bacteria | 1378 |
| 192 | Ga0157375_10004665 | 3300013308 | Bacteria | 11918 |
| 193 | Ga0157375_10017440 | 3300013308 | Bacteria | 6480 |
| 194 | Ga0157375_10056516 | 3300013308 | Bacteria | 3875 |
| 195 | Ga0157375_10168428 | 3300013308 | Bacteria | 2337 |
| 196 | Ga0163163_10069027 | 3300014325 | Bacteria | 3518 |
| 197 | Ga0163163_10202863 | 3300014325 | Unclassified | 2031 |
| 198 | Ga0157380_10015263 | 3300014326 | Bacteria | 5642 |
| 199 | Ga0157380_10168090 | 3300014326 | Bacteria | 1913 |
| 200 | Ga0157377_10013327 | 3300014745 | Bacteria | 4160 |
| 201 | Ga0157377_10054733 | 3300014745 | Bacteria | 2260 |
| 202 | Ga0157379_10086917 | 3300014968 | Bacteria | 2803 |
| 203 | Ga0157376_10014092 | 3300014969 | Bacteria | 5988 |
| 204 | Ga0157376_10017583 | 3300014969 | Bacteria | 5460 |
| 205 | Ga0157376_10108602 | 3300014969 | Bacteria | 2438 |
| 206 | Ga0163161_10086176 | 3300017792 | Bacteria | 2318 |
| 207 | Ga0163161_10244079 | 3300017792 | Bacteria | 1398 |
| 208 | Ga0209455_1000532 | 3300025272 | Bacteria | 26493 |
| 209 | Ga0209025_1000028 | 3300025294 | Bacteria | 490678 |
| 210 | Ga0207697_10007537 | 3300025315 | Bacteria | 4845 |
| 211 | Ga0207656_10004026 | 3300025321 | Bacteria | 5098 |
| 212 | Ga0207653_10024006 | 3300025885 | Bacteria | 1945 |
| 213 | Ga0207682_10002790 | 3300025893 | Bacteria | 7724 |
| 214 | Ga0207682_10003695 | 3300025893 | Bacteria | 6593 |
| 215 | Ga0207682_10039301 | 3300025893 | Bacteria | 1923 |
| 216 | Ga0207682_10052428 | 3300025893 | Bacteria | 1691 |
| 217 | Ga0207642_10106722 | 3300025899 | Bacteria | 1418 |
| 218 | Ga0207688_10006774 | 3300025901 | Bacteria | 6237 |
| 219 | Ga0207688_10040287 | 3300025901 | Bacteria | 2596 |
| 220 | Ga0207688_10167861 | 3300025901 | Bacteria | 1304 |
| 221 | Ga0207680_10012453 | 3300025903 | Bacteria | 4331 |
| 222 | Ga0207680_10086725 | 3300025903 | Bacteria | 1980 |
| 223 | Ga0207680_10090525 | 3300025903 | Bacteria | 1945 |
| 224 | Ga0207645_10009136 | 3300025907 | Bacteria | 6874 |
| 225 | Ga0207645_10023149 | 3300025907 | Bacteria | 4038 |
| 226 | Ga0207645_10023207 | 3300025907 | Bacteria | 4032 |
| 227 | Ga0207645_10069038 | 3300025907 | Bacteria | 2260 |
| 228 | Ga0207643_10016102 | 3300025908 | Bacteria | 4075 |
| 229 | Ga0207643_10030227 | 3300025908 | Bacteria | 3013 |
| 230 | Ga0207643_10182024 | 3300025908 | Bacteria | 1272 |
| 231 | Ga0207707_10193836 | 3300025912 | Bacteria | 1772 |
| 232 | Ga0207660_10002252 | 3300025917 | Bacteria | 12748 |
| 233 | Ga0207662_10000288 | 3300025918 | Bacteria | 23284 |
| 234 | Ga0207649_10015354 | 3300025920 | Bacteria | 4303 |
| 235 | Ga0207652_10135518 | 3300025921 | Bacteria | 2199 |
| 236 | Ga0207681_10061588 | 3300025923 | Bacteria | 2580 |
| 237 | Ga0207681_10182880 | 3300025923 | Bacteria | 1598 |
| 238 | Ga0207650_10000547 | 3300025925 | Bacteria | 30646 |
| 239 | Ga0207650_10001311 | 3300025925 | Bacteria | 18007 |
| 240 | Ga0207650_10004236 | 3300025925 | Bacteria | 9793 |
| 241 | Ga0207650_10067661 | 3300025925 | Bacteria | 2680 |
| 242 | Ga0207650_10109300 | 3300025925 | Bacteria | 2138 |
| 243 | Ga0207650_10148635 | 3300025925 | Bacteria | 1847 |
| 244 | Ga0207659_10000792 | 3300025926 | Bacteria | 18688 |
| 245 | Ga0207659_10008965 | 3300025926 | Bacteria | 6236 |
| 246 | Ga0207687_10305685 | 3300025927 | Bacteria | 1282 |
| 247 | Ga0207644_10001469 | 3300025931 | Bacteria | 15200 |
| 248 | Ga0207644_10004546 | 3300025931 | Bacteria | 9016 |
| 249 | Ga0207644_10106963 | 3300025931 | Bacteria | 2109 |
| 250 | Ga0207706_10017636 | 3300025933 | Bacteria | 6433 |
| 251 | Ga0207706_10036835 | 3300025933 | Bacteria | 4345 |
| 252 | Ga0207706_10194560 | 3300025933 | Bacteria | 1779 |
| 253 | Ga0207706_10288854 | 3300025933 | Bacteria | 1430 |
| 254 | Ga0207686_10000595 | 3300025934 | Bacteria | 22559 |
| 255 | Ga0207686_10243264 | 3300025934 | Bacteria | 1310 |
| 256 | Ga0207709_10001099 | 3300025935 | Bacteria | 19845 |
| 257 | Ga0207670_10001960 | 3300025936 | Bacteria | 10797 |
| 258 | Ga0207670_10116825 | 3300025936 | Bacteria | 1932 |
| 259 | Ga0207670_10235805 | 3300025936 | Bacteria | 1407 |
| 260 | Ga0207669_10147331 | 3300025937 | Bacteria | 1643 |
| 261 | Ga0207704_10000193 | 3300025938 | Bacteria | 31520 |
| 262 | Ga0207691_10000276 | 3300025940 | Bacteria | 50778 |
| 263 | Ga0207691_10001030 | 3300025940 | Bacteria | 27614 |
| 264 | Ga0207691_10057789 | 3300025940 | Bacteria | 3529 |
| 265 | Ga0207691_10167919 | 3300025940 | Bacteria | 1922 |
| 266 | Ga0207711_10130619 | 3300025941 | Bacteria | 2252 |
| 267 | Ga0207711_10145629 | 3300025941 | Bacteria | 2134 |
| 268 | Ga0207689_10000246 | 3300025942 | Bacteria | 48497 |
| 269 | Ga0207689_10115512 | 3300025942 | Bacteria | 2206 |
| 270 | Ga0207689_10129045 | 3300025942 | Bacteria | 2080 |
| 271 | Ga0207661_10001694 | 3300025944 | Bacteria | 15026 |
| 272 | Ga0207661_10096841 | 3300025944 | Bacteria | 2469 |
| 273 | Ga0207679_10001570 | 3300025945 | Bacteria | 14281 |
| 274 | Ga0207679_10002649 | 3300025945 | Bacteria | 11049 |
| 275 | Ga0207679_10099899 | 3300025945 | Bacteria | 2267 |
| 276 | Ga0207667_10008141 | 3300025949 | Bacteria | 12483 |
| 277 | Ga0207651_10003905 | 3300025960 | Bacteria | 7401 |
| 278 | Ga0207651_10057336 | 3300025960 | Bacteria | 2686 |
| 279 | Ga0207651_10129769 | 3300025960 | Bacteria | 1927 |
| 280 | Ga0207651_10206960 | 3300025960 | Bacteria | 1576 |
| 281 | Ga0207712_10159842 | 3300025961 | Bacteria | 1750 |
| 282 | Ga0207640_10000657 | 3300025981 | Bacteria | 20214 |
| 283 | Ga0207640_10004162 | 3300025981 | Bacteria | 7825 |
| 284 | Ga0207658_10055814 | 3300025986 | Bacteria | 2929 |
| 285 | Ga0207658_10080732 | 3300025986 | Bacteria | 2492 |
| 286 | Ga0207658_10092468 | 3300025986 | Bacteria | 2350 |
| 287 | Ga0207658_10109025 | 3300025986 | Bacteria | 2185 |
| 288 | Ga0207658_10160792 | 3300025986 | Bacteria | 1840 |
| 289 | Ga0207677_10000888 | 3300026023 | Bacteria | 16831 |
| 290 | Ga0207677_10001059 | 3300026023 | Bacteria | 15082 |
| 291 | Ga0207677_10003535 | 3300026023 | Bacteria | 8282 |
| 292 | Ga0207677_10083865 | 3300026023 | Bacteria | 2295 |
| 293 | Ga0207703_10165117 | 3300026035 | Bacteria | 1942 |
| 294 | Ga0207703_10257665 | 3300026035 | Bacteria | 1575 |
| 295 | Ga0207678_10368247 | 3300026067 | Bacteria | 1241 |
| 296 | Ga0207708_10000346 | 3300026075 | Bacteria | 36321 |
| 297 | Ga0207708_10015904 | 3300026075 | Bacteria | 5649 |
| 298 | Ga0207708_10051638 | 3300026075 | Bacteria | 3131 |
| 299 | Ga0207702_10099001 | 3300026078 | Bacteria | 2570 |
| 300 | Ga0207641_10009543 | 3300026088 | Bacteria | 7995 |
| 301 | Ga0207641_10037686 | 3300026088 | Bacteria | 4039 |
| 302 | Ga0207641_10049563 | 3300026088 | Bacteria | 3549 |
| 303 | Ga0207641_10100076 | 3300026088 | Bacteria | 2552 |
| 304 | Ga0207648_10000145 | 3300026089 | Bacteria | 70734 |
| 305 | Ga0207648_10011175 | 3300026089 | Bacteria | 8469 |
| 306 | Ga0207648_10018599 | 3300026089 | Bacteria | 6288 |
| 307 | Ga0207648_10054903 | 3300026089 | Bacteria | 3478 |
| 308 | Ga0207648_10108425 | 3300026089 | Bacteria | 2438 |
| 309 | Ga0207676_10000711 | 3300026095 | Bacteria | 26137 |
| 310 | Ga0207676_10016549 | 3300026095 | Bacteria | 5340 |
| 311 | Ga0207676_10189805 | 3300026095 | Bacteria | 1807 |
| 312 | Ga0207675_100001564 | 3300026118 | Bacteria | 22950 |
| 313 | Ga0207675_100046179 | 3300026118 | Bacteria | 4068 |
| 314 | Ga0207675_100406497 | 3300026118 | Bacteria | 1342 |
| 315 | Ga0207683_10000759 | 3300026121 | Bacteria | 29341 |
| 316 | Ga0207683_10015948 | 3300026121 | Bacteria | 6396 |
| 317 | Ga0207683_10017802 | 3300026121 | Bacteria | 6060 |
| 318 | Ga0207683_10065370 | 3300026121 | Bacteria | 3207 |
| 319 | Ga0207698_10000566 | 3300026142 | Bacteria | 21574 |
| 320 | Ga0207698_10013639 | 3300026142 | Bacteria | 5371 |
| 321 | Ga0207698_10320530 | 3300026142 | Bacteria | 1451 |
| 322 | Ga0207428_10016172 | 3300027907 | Bacteria | 6425 |
| 323 | Ga0207428_10227973 | 3300027907 | Bacteria | 1395 |
| 324 | Ga0268266_10047069 | 3300028379 | Bacteria | 3693 |
| 325 | Ga0268266_10163878 | 3300028379 | Bacteria | 2013 |
| 326 | Ga0268266_10280094 | 3300028379 | Bacteria | 1550 |
| 327 | Ga0268265_10001212 | 3300028380 | Bacteria | 22414 |
| 328 | Ga0268265_10351896 | 3300028380 | Bacteria | 1345 |
| 329 | Ga0268264_10051975 | 3300028381 | Bacteria | 3416 |
| 330 | Ga0268264_10166525 | 3300028381 | Bacteria | 1990 |
| 331 | Ga0265318_10006553 | 3300028577 | Bacteria | 5346 |
| 332 | Ga0265318_10024480 | 3300028577 | Bacteria | 2393 |
| 333 | Ga0265338_10139773 | 3300028800 | Bacteria | 1899 |
| 334 | Ga0265330_10007204 | 3300031235 | Bacteria | 5444 |
| 335 | Ga0265332_10000735 | 3300031238 | Bacteria | 20401 |
| 336 | Ga0265332_10003598 | 3300031238 | Bacteria | 7433 |
| 337 | Ga0265332_10092510 | 3300031238 | Bacteria | 1278 |
| 338 | Ga0265328_10005143 | 3300031239 | Bacteria | 5625 |
| 339 | Ga0265328_10025493 | 3300031239 | Bacteria | 2227 |
| 340 | Ga0265320_10021392 | 3300031240 | Bacteria | 3480 |
| 341 | Ga0265320_10072348 | 3300031240 | Bacteria | 1622 |
| 342 | Ga0265329_10002359 | 3300031242 | Bacteria | 8624 |
| 343 | Ga0265340_10003954 | 3300031247 | Bacteria | 8335 |
| 344 | Ga0265339_10002711 | 3300031249 | Bacteria | 12591 |
| 345 | Ga0265331_10000832 | 3300031250 | Bacteria | 25166 |
| 346 | Ga0265331_10012568 | 3300031250 | Bacteria | 4578 |
| 347 | Ga0265331_10023080 | 3300031250 | Bacteria | 3166 |
| 348 | Ga0265316_10023082 | 3300031344 | Bacteria | 5231 |
| 349 | Ga0307408_100040828 | 3300031548 | Bacteria | 3287 |
| 350 | Ga0265314_10002632 | 3300031711 | Bacteria | 18095 |
| 351 | Ga0265314_10009702 | 3300031711 | Bacteria | 8097 |
| 352 | Ga0265314_10039770 | 3300031711 | Bacteria | 3383 |
| 353 | Ga0265314_10086938 | 3300031711 | Bacteria | 2045 |
| 354 | Ga0265342_10000092 | 3300031712 | Bacteria | 99040 |
| 355 | Ga0265342_10003929 | 3300031712 | Bacteria | 11935 |
| 356 | Ga0307405_10013809 | 3300031731 | Bacteria | 4319 |
| 357 | Ga0307413_10007421 | 3300031824 | Bacteria | 5093 |
| 358 | Ga0307413_10038147 | 3300031824 | Bacteria | 2782 |
| 359 | Ga0307413_10039136 | 3300031824 | Bacteria | 2755 |
| 360 | Ga0307410_10004671 | 3300031852 | Bacteria | 7118 |
| 361 | Ga0307407_10046002 | 3300031903 | Bacteria | 2469 |
| 362 | Ga0307407_10143515 | 3300031903 | Bacteria | 1543 |
| 363 | Ga0307412_10045725 | 3300031911 | Bacteria | 2864 |
| 364 | Ga0307412_10156162 | 3300031911 | Bacteria | 1689 |
| 365 | Ga0307409_100039707 | 3300031995 | Bacteria | 3495 |
| 366 | Ga0307409_100050551 | 3300031995 | Bacteria | 3175 |
| 367 | Ga0307409_100408656 | 3300031995 | Bacteria | 1299 |
| 368 | Ga0307416_100192487 | 3300032002 | Bacteria | 1925 |
| 369 | Ga0307414_10006140 | 3300032004 | Bacteria | 6674 |
| 370 | Ga0307414_10201230 | 3300032004 | Bacteria | 1620 |
| 371 | Ga0307414_10242962 | 3300032004 | Bacteria | 1491 |
| 372 | Ga0307411_10026326 | 3300032005 | Bacteria | 3501 |
| 373 | Ga0307411_10155383 | 3300032005 | Bacteria | 1706 |
| 374 | Ga0307411_10306530 | 3300032005 | Bacteria | 1276 |
| 375 | Ga0373950_0016982 | 3300034818 | Bacteria | 1250 |
| 376 | Ga0373926_0004813 | 3300035083 | Bacteria | 4439 |
| 377 | Ga0373940_0005327 | 3300035088 | Unclassified | 2778 |
| 378 | Ga0373944_0001696 | 3300035089 | Bacteria | 5573 |
| 379 | Ga0373949_0004742 | 3300035090 | Unclassified | 3085 |
| 380 | Ga0373951_0017082 | 3300035091 | Unclassified | 1640 |
| 381 | Ga0373952_0009972 | 3300035092 | Unclassified | 1829 |
| 382 | Ga0373932_0004303 | 3300035112 | Bacteria | 3377 |
| 383 | Ga0373936_0004368 | 3300035113 | Bacteria | 5345 |
| 384 | Ga0373936_0048540 | 3300035113 | Bacteria | 1713 |
| 385 | Ga0373939_0025008 | 3300035114 | Unclassified | 1669 |
| 386 | Ga0373945_0014482 | 3300035116 | Bacteria | 2643 |
| 387 | Ga0373943_0005171 | 3300035170 | Bacteria | 5872 |
| 388 | Ga0373943_0011481 | 3300035170 | Bacteria | 3985 |
| 389 | Ga0373946_0000679 | 3300035171 | Bacteria | 11419 |
| 390 | Ga0373946_0057643 | 3300035171 | Bacteria | 1643 |
| 391 | Ga0373942_0005658 | 3300035207 | Unclassified | 2896 |
| 392 | Ga0373931_0121141 | 3300035691 | Bacteria | 1495 |
| 393 | Ga0373935_0005822 | 3300035692 | Bacteria | 7299 |
| 394 | Ga0373935_0021034 | 3300035692 | Bacteria | 3992 |
| 395 | Ga0373927_0006898 | 3300035695 | Bacteria | 7718 |
| 396 | Ga0373927_0029328 | 3300035695 | Bacteria | 3585 |
| 397 | Ga0373947_0006482 | 3300035725 | Bacteria | 6797 |
| 398 | Ga0373947_0020088 | 3300035725 | Bacteria | 3855 |
| 399 | Ga0373925_0011389 | 3300037068 | Bacteria | 6446 |
| 400 | Ga0373925_0027144 | 3300037068 | Bacteria | 4193 |
| 401 | Ga0395900_0027735 | 3300037418 | Bacteria | 5802 |
| 402 | Ga0395898_0043684 | 3300037466 | Bacteria | 4415 |
| 403 | Ga0395905_0036366 | 3300037471 | Bacteria | 4624 |
| 404 | Ga0451853_4038841 | 3300041512 | Bacteria | 1555 |
| 405 | Ga0451577_0265590 | 3300042876 | Bacteria | 1554 |
| 406 | Ga0451577_0732474 | 3300042876 | Bacteria | 895 |
| 407 | Ga0466961_0067392 | 3300044693 | Bacteria | 2274 |
| 408 | Ga0453684_0558773 | 3300044712 | Bacteria | 1260 |
| 409 | Ga0451576_0031504 | 3300045051 | Bacteria | 5651 |
| 410 | Ga0495603_0013602 | 3300046455 | Bacteria | 4924 |
| 411 | Ga0495580_0002245 | 3300046472 | Bacteria | 16878 |
| 412 | Ga0495582_0037819 | 3300046473 | Bacteria | 2655 |
| 413 | Ga0495605_0074406 | 3300046474 | Bacteria | 1599 |
| 414 | Ga0495665_0032852 | 3300046531 | Bacteria | 2776 |
| 415 | Ga0495586_0003755 | 3300046535 | Bacteria | 8138 |
| 416 | Ga0495633_0000926 | 3300046558 | Bacteria | 24805 |
| 417 | Ga0495656_0012687 | 3300046615 | Bacteria | 3116 |
| 418 | Ga0495656_0071982 | 3300046615 | Bacteria | 1538 |
| 419 | Ga0495658_0001257 | 3300046683 | Bacteria | 13318 |
| 420 | Ga0495658_0023385 | 3300046683 | Bacteria | 3280 |
| 421 | Ga0495676_0030171 | 3300047321 | Bacteria | 4608 |
| 422 | Ga0496102_0085148 | 3300048905 | Bacteria | 2918 |
| 423 | Ga0496106_0040101 | 3300048909 | Bacteria | 3506 |
| 424 | Ga0496106_0415453 | 3300048909 | Bacteria | 1081 |
| 425 | Ga0496108_0008167 | 3300048911 | Bacteria | 8490 |
| 426 | Ga0496108_0132458 | 3300048911 | Bacteria | 2142 |
| 427 | Ga0496109_0024935 | 3300048912 | Bacteria | 5324 |
| 428 | Ga0496109_0131358 | 3300048912 | Bacteria | 2337 |
| 429 | Ga0496109_0364043 | 3300048912 | Bacteria | 1366 |
| 430 | Ga0496110_0014434 | 3300048913 | Bacteria | 6560 |
| 431 | Ga0496110_0054872 | 3300048913 | Bacteria | 3505 |
| 432 | Ga0496111_0272659 | 3300048914 | Bacteria | 1255 |
| 433 | Ga0496112_0573674 | 3300048915 | Bacteria | 1061 |
| 434 | Ga0496114_0159296 | 3300048917 | Bacteria | 1961 |
| 435 | Ga0496116_0010833 | 3300048919 | Bacteria | 7605 |
| 436 | Ga0496118_0019291 | 3300048921 | Bacteria | 6100 |
| 437 | Ga0496119_0095601 | 3300048922 | Bacteria | 1678 |
| 438 | Ga0496121_0005309 | 3300048924 | Bacteria | 16570 |
| 439 | Ga0496122_0004199 | 3300048925 | Bacteria | 18120 |
| 440 | Ga0496122_0023593 | 3300048925 | Bacteria | 5414 |
| 441 | Ga0496123_0098199 | 3300048926 | Bacteria | 1713 |
| 442 | Ga0496126_0116879 | 3300048929 | Bacteria | 2318 |
| 443 | Ga0501039_0051989 | 3300049575 | Bacteria | 3170 |
| 444 | Ga0501040_0100588 | 3300049576 | Bacteria | 2016 |
| 445 | Ga0501042_0197091 | 3300049578 | Bacteria | 1452 |
| 446 | Ga0501048_0170695 | 3300049582 | Bacteria | 1541 |
| 447 | Ga0501072_0000464 | 3300049588 | Bacteria | 29314 |
| 448 | Ga0501075_0028335 | 3300049591 | Bacteria | 4134 |
| 449 | Ga0501076_0097103 | 3300049592 | Bacteria | 2373 |
| 450 | Ga0501079_0254963 | 3300049741 | Bacteria | 1371 |
| 451 | Ga0501081_0062527 | 3300049743 | Bacteria | 2582 |
| 452 | Ga0501081_0237567 | 3300049743 | Bacteria | 1328 |
| 453 | nmdc:mga00v17_161465_c1 | 3300050491 | Unclassified | 1443 |
| 454 | nmdc:mga05p37_185_c1 | 3300050507 | Bacteria | 61269 |
| 455 | nmdc:mga09592_6056_c1 | 3300050508 | Bacteria | 9862 |
| 456 | nmdc:mga0qj67_65216_c1 | 3300050509 | Bacteria | 2899 |
| 457 | nmdc:mga06r32_237410_c1 | 3300050510 | Bacteria | 1811 |
| 458 | nmdc:mga08y16_192897_c1 | 3300050511 | Bacteria | 2113 |
| 459 | nmdc:mga08y16_27924_c1 | 3300050511 | Bacteria | 5950 |
| 460 | nmdc:mga08y16_369507_c1 | 3300050511 | Unclassified | 1471 |
| 461 | nmdc:mga08y16_515986_c1 | 3300050511 | Bacteria | 1213 |
| 462 | nmdc:mga0n895_194730_c1 | 3300050512 | Bacteria | 2058 |
| 463 | nmdc:mga0rr50_215890_c1 | 3300050513 | Bacteria | 1582 |
| 464 | nmdc:mga0rr50_42668_c1 | 3300050513 | Bacteria | 3314 |
| 465 | Ga0500644_0001546 | 3300053088 | Bacteria | 6047 |
| 466 | Ga0500583_0130424 | 3300053092 | Bacteria | 1247 |
| 467 | Ga0500593_000654 | 3300053117 | Bacteria | 13223 |
| 468 | Ga0500590_025986 | 3300053148 | Bacteria | 3039 |
| 469 | Ga0501084_0219748 | 3300054114 | Bacteria | 1603 |
| 470 | Ga0501082_0258304 | 3300060353 | Bacteria | 1515 |
| 471 | Ga0530510_0030871 | 3300061734 | Bacteria | 3851 |
| 472 | Ga0530510_0046651 | 3300061734 | Bacteria | 3130 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0051989 | Ga0501039_0051989_234_1193 | 245 |
| 2 | 3300049578 | Ga0501042_0197091 | Ga0501042_0197091_274_1233 | 245 |
| 3 | 3300049588 | Ga0501072_0000464 | Ga0501072_0000464_9183_10142 | 245 |
| 4 | 3300049591 | Ga0501075_0028335 | Ga0501075_0028335_3037_3996 | 245 |
| 5 | 3300049741 | Ga0501079_0254963 | Ga0501079_0254963_269_1228 | 245 |
| 6 | 3300049743 | Ga0501081_0062527 | Ga0501081_0062527_1465_2424 | 245 |
| 7 | 3300054114 | Ga0501084_0219748 | Ga0501084_0219748_153_1112 | 245 |
| 8 | 3300060353 | Ga0501082_0258304 | Ga0501082_0258304_222_1181 | 245 |
| 9 | 3300061734 | Ga0530510_0030871 | Ga0530510_0030871_330_1289 | 245 |
| 10 | 3300025315 | Ga0207697_10007537 | Ga0207697_100075372 | 251 |
| 11 | 3300049576 | Ga0501040_0100588 | Ga0501040_0100588_901_1860 | 254 |
| 12 | 3300049592 | Ga0501076_0097103 | Ga0501076_0097103_173_1132 | 254 |
| 13 | 3300005458 | Ga0070681_10034551 | Ga0070681_100345511 | 258 |
| 14 | 3300025912 | Ga0207707_10193836 | Ga0207707_101938362 | 258 |
| 15 | 3300031824 | Ga0307413_10038147 | Ga0307413_100381473 | 259 |
| 16 | 3300031903 | Ga0307407_10143515 | Ga0307407_101435152 | 259 |
| 17 | 3300031911 | Ga0307412_10156162 | Ga0307412_101561622 | 259 |
| 18 | 3300032002 | Ga0307416_100192487 | Ga0307416_1001924871 | 259 |
| 19 | 3300032004 | Ga0307414_10242962 | Ga0307414_102429622 | 259 |
| 20 | 3300025272 | Ga0209455_1000532 | Ga0209455_10005323 | 263 |
| 21 | 3300014325 | Ga0163163_10202863 | Ga0163163_102028632 | 264 |
| 22 | 3300028577 | Ga0265318_10024480 | Ga0265318_100244802 | 266 |
| 23 | 3300028800 | Ga0265338_10139773 | Ga0265338_101397732 | 266 |
| 24 | 3300031235 | Ga0265330_10007204 | Ga0265330_100072043 | 266 |
| 25 | 3300031239 | Ga0265328_10025493 | Ga0265328_100254932 | 266 |
| 26 | 3300031240 | Ga0265320_10021392 | Ga0265320_100213922 | 266 |
| 27 | 3300031250 | Ga0265331_10023080 | Ga0265331_100230802 | 266 |
| 28 | 3300031344 | Ga0265316_10023082 | Ga0265316_100230822 | 266 |
| 29 | 3300031711 | Ga0265314_10002632 | Ga0265314_1000263215 | 266 |
| 30 | 3300035691 | Ga0373931_0121141 | Ga0373931_0121141_675_1484 | 266 |
| 31 | 3300031238 | Ga0265332_10000735 | Ga0265332_100007359 | 267 |
| 32 | 3300031247 | Ga0265340_10003954 | Ga0265340_100039549 | 267 |
| 33 | 3300031249 | Ga0265339_10002711 | Ga0265339_1000271117 | 267 |
| 34 | 3300031250 | Ga0265331_10012568 | Ga0265331_100125686 | 267 |
| 35 | 3300031711 | Ga0265314_10039770 | Ga0265314_100397702 | 267 |
| 36 | 3300031712 | Ga0265342_10000092 | Ga0265342_1000009211 | 267 |
| 37 | 3300048921 | Ga0496118_0019291 | Ga0496118_0019291_2943_3929 | 270 |
| 38 | 3300048922 | Ga0496119_0095601 | Ga0496119_0095601_621_1607 | 270 |
| 39 | 3300048925 | Ga0496122_0004199 | Ga0496122_0004199_4030_5016 | 270 |
| 40 | 3300048926 | Ga0496123_0098199 | Ga0496123_0098199_444_1430 | 270 |
| 41 | 3300048929 | Ga0496126_0116879 | Ga0496126_0116879_269_1255 | 270 |
| 42 | 3300006051 | Ga0075364_10049824 | Ga0075364_100498243 | 272 |
| 43 | 3300050491 | nmdc:mga00v17_161465_c1 | nmdc:mga00v17_161465_c1_211_1218 | 272 |
| 44 | 3300003187 | JGI25151J46595_10000131 | JGI25151J46595_1000013162 | 275 |
| 45 | 3300025294 | Ga0209025_1000028 | Ga0209025_1000028374 | 275 |
| 46 | 3300046558 | Ga0495633_0000926 | Ga0495633_0000926_11710_12678 | 275 |
| 47 | iso_pu_bacteria | 2855730933 | 2855731768 | 275 |
| 48 | iso_pu_bacteria | 2855767633 | 2855768474 | 275 |
| 49 | iso_pu_bacteria | 2881412998 | 2881414918 | 275 |
| 50 | iso_pu_bacteria | 2939631187 | 2939633961 | 275 |
| 51 | 3300005331 | Ga0070670_100031787 | Ga0070670_1000317873 | 276 |
| 52 | 3300005338 | Ga0068868_100428297 | Ga0068868_1004282971 | 276 |
| 53 | 3300005353 | Ga0070669_100332902 | Ga0070669_1003329022 | 276 |
| 54 | 3300005367 | Ga0070667_100024257 | Ga0070667_1000242575 | 276 |
| 55 | 3300005456 | Ga0070678_100446177 | Ga0070678_1004461771 | 276 |
| 56 | 3300005457 | Ga0070662_100257598 | Ga0070662_1002575982 | 276 |
| 57 | 3300005466 | Ga0070685_10133992 | Ga0070685_101339921 | 276 |
| 58 | 3300005618 | Ga0068864_100018958 | Ga0068864_1000189585 | 276 |
| 59 | 3300005841 | Ga0068863_100012827 | Ga0068863_1000128275 | 276 |
| 60 | 3300005843 | Ga0068860_100229700 | Ga0068860_1002297002 | 276 |
| 61 | 3300006237 | Ga0097621_100129793 | Ga0097621_1001297932 | 276 |
| 62 | 3300006358 | Ga0068871_100013831 | Ga0068871_1000138316 | 276 |
| 63 | 3300006871 | Ga0075434_100184124 | Ga0075434_1001841242 | 276 |
| 64 | 3300007076 | Ga0075435_100006817 | Ga0075435_1000068177 | 276 |
| 65 | 3300009177 | Ga0105248_10148371 | Ga0105248_101483712 | 276 |
| 66 | 3300013308 | Ga0157375_10056516 | Ga0157375_100565162 | 276 |
| 67 | 3300025923 | Ga0207681_10182880 | Ga0207681_101828802 | 276 |
| 68 | 3300025925 | Ga0207650_10000547 | Ga0207650_100005473 | 276 |
| 69 | 3300025925 | Ga0207650_10067661 | Ga0207650_100676612 | 276 |
| 70 | 3300025926 | Ga0207659_10008965 | Ga0207659_100089653 | 276 |
| 71 | 3300025940 | Ga0207691_10057789 | Ga0207691_100577893 | 276 |
| 72 | 3300025945 | Ga0207679_10099899 | Ga0207679_100998992 | 276 |
| 73 | 3300025960 | Ga0207651_10129769 | Ga0207651_101297691 | 276 |
| 74 | 3300025986 | Ga0207658_10080732 | Ga0207658_100807322 | 276 |
| 75 | 3300026088 | Ga0207641_10009543 | Ga0207641_100095432 | 276 |
| 76 | 3300026095 | Ga0207676_10000711 | Ga0207676_100007113 | 276 |
| 77 | 3300042876 | Ga0451577_0265590 | Ga0451577_0265590_10_960 | 276 |
| 78 | 3300046683 | Ga0495658_0023385 | Ga0495658_0023385_1798_2754 | 276 |
| 79 | 3300048913 | Ga0496110_0054872 | Ga0496110_0054872_1153_2148 | 276 |
| 80 | 3300048915 | Ga0496112_0573674 | Ga0496112_0573674_117_998 | 276 |
| 81 | 3300048924 | Ga0496121_0005309 | Ga0496121_0005309_12325_13320 | 276 |
| 82 | 3300050512 | nmdc:mga0n895_194730_c1 | nmdc:mga0n895_194730_c1_170_1117 | 276 |
| 83 | 3300050513 | nmdc:mga0rr50_42668_c1 | nmdc:mga0rr50_42668_c1_1441_2388 | 276 |
| 84 | 3300053148 | Ga0500590_025986 | Ga0500590_025986_1192_2208 | 276 |
| 85 | iso_pu_bacteria | 2508501042 | 2508693028 | 276 |
| 86 | iso_pu_bacteria | 2515154112 | 2515630093 | 276 |
| 87 | iso_pu_bacteria | 2935694250 | 2935700832 | 276 |
| 88 | iso_pu_bacteria | 2935975950 | 2935981858 | 276 |
| 89 | iso_pu_bacteria | 8016583857 | 8016584535 | 276 |
| 90 | iso_pu_bacteria | 8019619141 | 8019620947 | 276 |
| 91 | iso_pu_bacteria | 8019629233 | 8019629604 | 276 |
| 92 | iso_pu_bacteria | 8019638758 | 8019648294 | 276 |
| 93 | iso_pu_bacteria | 8019659431 | 8019659746 | 276 |
| 94 | iso_pu_bacteria | 8019668869 | 8019669205 | 276 |
| 95 | iso_pu_bacteria | 8019678201 | 8019678275 | 276 |
| 96 | 2162886007 | SwRhRL2b_contig_3674561 | SwRhRL2b_0919.00001540 | 277 |
| 97 | 3300005289 | Ga0065704_10071136 | Ga0065704_1007113613 | 277 |
| 98 | 3300005290 | Ga0065712_10081871 | Ga0065712_100818712 | 277 |
| 99 | 3300005295 | Ga0065707_10012311 | Ga0065707_100123112 | 277 |
| 100 | 3300005327 | Ga0070658_10042530 | Ga0070658_100425302 | 277 |
| 101 | 3300005328 | Ga0070676_10018985 | Ga0070676_100189852 | 277 |
| 102 | 3300005328 | Ga0070676_10078517 | Ga0070676_100785172 | 277 |
| 103 | 3300005329 | Ga0070683_100001833 | Ga0070683_10000183311 | 277 |
| 104 | 3300005329 | Ga0070683_100007690 | Ga0070683_1000076903 | 277 |
| 105 | 3300005330 | Ga0070690_100002169 | Ga0070690_1000021692 | 277 |
| 106 | 3300005331 | Ga0070670_100001901 | Ga0070670_10000190112 | 277 |
| 107 | 3300005331 | Ga0070670_100042773 | Ga0070670_1000427733 | 277 |
| 108 | 3300005331 | Ga0070670_100082581 | Ga0070670_1000825812 | 277 |
| 109 | 3300005331 | Ga0070670_100179796 | Ga0070670_1001797961 | 277 |
| 110 | 3300005333 | Ga0070677_10007204 | Ga0070677_100072045 | 277 |
| 111 | 3300005333 | Ga0070677_10030796 | Ga0070677_100307962 | 277 |
| 112 | 3300005333 | Ga0070677_10050593 | Ga0070677_100505931 | 277 |
| 113 | 3300005334 | Ga0068869_100138904 | Ga0068869_1001389041 | 277 |
| 114 | 3300005334 | Ga0068869_100319676 | Ga0068869_1003196761 | 277 |
| 115 | 3300005335 | Ga0070666_10119675 | Ga0070666_101196751 | 277 |
| 116 | 3300005335 | Ga0070666_10263540 | Ga0070666_102635401 | 277 |
| 117 | 3300005336 | Ga0070680_100002670 | Ga0070680_1000026709 | 277 |
| 118 | 3300005337 | Ga0070682_100004844 | Ga0070682_1000048444 | 277 |
| 119 | 3300005338 | Ga0068868_100001179 | Ga0068868_1000011795 | 277 |
| 120 | 3300005338 | Ga0068868_100003144 | Ga0068868_10000314410 | 277 |
| 121 | 3300005338 | Ga0068868_100010045 | Ga0068868_1000100454 | 277 |
| 122 | 3300005338 | Ga0068868_100152880 | Ga0068868_1001528802 | 277 |
| 123 | 3300005339 | Ga0070660_100038055 | Ga0070660_1000380552 | 277 |
| 124 | 3300005340 | Ga0070689_100000619 | Ga0070689_1000006192 | 277 |
| 125 | 3300005340 | Ga0070689_100050572 | Ga0070689_1000505722 | 277 |
| 126 | 3300005341 | Ga0070691_10000287 | Ga0070691_100002876 | 277 |
| 127 | 3300005343 | Ga0070687_100000135 | Ga0070687_10000013521 | 277 |
| 128 | 3300005343 | Ga0070687_100127338 | Ga0070687_1001273381 | 277 |
| 129 | 3300005344 | Ga0070661_100001142 | Ga0070661_10000114214 | 277 |
| 130 | 3300005344 | Ga0070661_100001344 | Ga0070661_1000013446 | 277 |
| 131 | 3300005344 | Ga0070661_100268942 | Ga0070661_1002689421 | 277 |
| 132 | 3300005345 | Ga0070692_10000037 | Ga0070692_1000003716 | 277 |
| 133 | 3300005347 | Ga0070668_100252911 | Ga0070668_1002529112 | 277 |
| 134 | 3300005353 | Ga0070669_100112986 | Ga0070669_1001129862 | 277 |
| 135 | 3300005353 | Ga0070669_100212001 | Ga0070669_1002120012 | 277 |
| 136 | 3300005353 | Ga0070669_100309208 | Ga0070669_1003092082 | 277 |
| 137 | 3300005354 | Ga0070675_100008536 | Ga0070675_1000085365 | 277 |
| 138 | 3300005354 | Ga0070675_100141136 | Ga0070675_1001411361 | 277 |
| 139 | 3300005355 | Ga0070671_100002371 | Ga0070671_1000023719 | 277 |
| 140 | 3300005355 | Ga0070671_100018386 | Ga0070671_1000183864 | 277 |
| 141 | 3300005355 | Ga0070671_100133019 | Ga0070671_1001330192 | 277 |
| 142 | 3300005356 | Ga0070674_100044657 | Ga0070674_1000446572 | 277 |
| 143 | 3300005356 | Ga0070674_100118654 | Ga0070674_1001186542 | 277 |
| 144 | 3300005364 | Ga0070673_100004880 | Ga0070673_1000048807 | 277 |
| 145 | 3300005364 | Ga0070673_100030333 | Ga0070673_1000303334 | 277 |
| 146 | 3300005364 | Ga0070673_100045503 | Ga0070673_1000455032 | 277 |
| 147 | 3300005367 | Ga0070667_100038460 | Ga0070667_1000384603 | 277 |
| 148 | 3300005367 | Ga0070667_100071381 | Ga0070667_1000713811 | 277 |
| 149 | 3300005367 | Ga0070667_100102511 | Ga0070667_1001025112 | 277 |
| 150 | 3300005438 | Ga0070701_10078415 | Ga0070701_100784151 | 277 |
| 151 | 3300005440 | Ga0070705_100000022 | Ga0070705_10000002268 | 277 |
| 152 | 3300005441 | Ga0070700_100001465 | Ga0070700_1000014652 | 277 |
| 153 | 3300005441 | Ga0070700_100065415 | Ga0070700_1000654151 | 277 |
| 154 | 3300005444 | Ga0070694_100003705 | Ga0070694_1000037058 | 277 |
| 155 | 3300005455 | Ga0070663_100028135 | Ga0070663_1000281352 | 277 |
| 156 | 3300005456 | Ga0070678_100002707 | Ga0070678_1000027075 | 277 |
| 157 | 3300005456 | Ga0070678_100011282 | Ga0070678_1000112824 | 277 |
| 158 | 3300005456 | Ga0070678_100070233 | Ga0070678_1000702332 | 277 |
| 159 | 3300005457 | Ga0070662_100018005 | Ga0070662_1000180054 | 277 |
| 160 | 3300005457 | Ga0070662_100048841 | Ga0070662_1000488413 | 277 |
| 161 | 3300005457 | Ga0070662_100131164 | Ga0070662_1001311642 | 277 |
| 162 | 3300005458 | Ga0070681_10253064 | Ga0070681_102530642 | 277 |
| 163 | 3300005459 | Ga0068867_100000740 | Ga0068867_1000007406 | 277 |
| 164 | 3300005459 | Ga0068867_100006691 | Ga0068867_1000066916 | 277 |
| 165 | 3300005459 | Ga0068867_100012415 | Ga0068867_1000124154 | 277 |
| 166 | 3300005459 | Ga0068867_100208451 | Ga0068867_1002084512 | 277 |
| 167 | 3300005466 | Ga0070685_10022567 | Ga0070685_100225673 | 277 |
| 168 | 3300005466 | Ga0070685_10082847 | Ga0070685_100828472 | 277 |
| 169 | 3300005518 | Ga0070699_100014816 | Ga0070699_1000148165 | 277 |
| 170 | 3300005530 | Ga0070679_100033757 | Ga0070679_1000337575 | 277 |
| 171 | 3300005535 | Ga0070684_100023500 | Ga0070684_1000235003 | 277 |
| 172 | 3300005543 | Ga0070672_100003898 | Ga0070672_1000038989 | 277 |
| 173 | 3300005543 | Ga0070672_100030852 | Ga0070672_1000308524 | 277 |
| 174 | 3300005543 | Ga0070672_100393112 | Ga0070672_1003931122 | 277 |
| 175 | 3300005544 | Ga0070686_100128947 | Ga0070686_1001289471 | 277 |
| 176 | 3300005546 | Ga0070696_100135616 | Ga0070696_1001356162 | 277 |
| 177 | 3300005547 | Ga0070693_100006118 | Ga0070693_1000061185 | 277 |
| 178 | 3300005547 | Ga0070693_100042011 | Ga0070693_1000420113 | 277 |
| 179 | 3300005548 | Ga0070665_100230112 | Ga0070665_1002301122 | 277 |
| 180 | 3300005548 | Ga0070665_100371481 | Ga0070665_1003714812 | 277 |
| 181 | 3300005549 | Ga0070704_100000009 | Ga0070704_1000000092 | 277 |
| 182 | 3300005563 | Ga0068855_100015108 | Ga0068855_1000151089 | 277 |
| 183 | 3300005564 | Ga0070664_100002397 | Ga0070664_10000239710 | 277 |
| 184 | 3300005564 | Ga0070664_100035181 | Ga0070664_1000351812 | 277 |
| 185 | 3300005578 | Ga0068854_100000468 | Ga0068854_1000004685 | 277 |
| 186 | 3300005578 | Ga0068854_100012858 | Ga0068854_1000128585 | 277 |
| 187 | 3300005578 | Ga0068854_100047685 | Ga0068854_1000476852 | 277 |
| 188 | 3300005614 | Ga0068856_100014811 | Ga0068856_1000148116 | 277 |
| 189 | 3300005615 | Ga0070702_100041538 | Ga0070702_1000415382 | 277 |
| 190 | 3300005616 | Ga0068852_100000221 | Ga0068852_1000002214 | 277 |
| 191 | 3300005616 | Ga0068852_100003572 | Ga0068852_1000035722 | 277 |
| 192 | 3300005616 | Ga0068852_100271349 | Ga0068852_1002713492 | 277 |
| 193 | 3300005617 | Ga0068859_100234700 | Ga0068859_1002347002 | 277 |
| 194 | 3300005617 | Ga0068859_100278821 | Ga0068859_1002788212 | 277 |
| 195 | 3300005618 | Ga0068864_100003124 | Ga0068864_1000031245 | 277 |
| 196 | 3300005618 | Ga0068864_100083186 | Ga0068864_1000831862 | 277 |
| 197 | 3300005718 | Ga0068866_10000096 | Ga0068866_100000966 | 277 |
| 198 | 3300005718 | Ga0068866_10019551 | Ga0068866_100195513 | 277 |
| 199 | 3300005718 | Ga0068866_10185836 | Ga0068866_101858362 | 277 |
| 200 | 3300005719 | Ga0068861_100005253 | Ga0068861_1000052532 | 277 |
| 201 | 3300005719 | Ga0068861_100153034 | Ga0068861_1001530342 | 277 |
| 202 | 3300005834 | Ga0068851_10004198 | Ga0068851_100041984 | 277 |
| 203 | 3300005840 | Ga0068870_10132750 | Ga0068870_101327502 | 277 |
| 204 | 3300005840 | Ga0068870_10152421 | Ga0068870_101524212 | 277 |
| 205 | 3300005841 | Ga0068863_100019807 | Ga0068863_1000198072 | 277 |
| 206 | 3300005841 | Ga0068863_100144788 | Ga0068863_1001447882 | 277 |
| 207 | 3300005841 | Ga0068863_100204812 | Ga0068863_1002048121 | 277 |
| 208 | 3300005842 | Ga0068858_100006948 | Ga0068858_10000694810 | 277 |
| 209 | 3300005842 | Ga0068858_100552905 | Ga0068858_1005529052 | 277 |
| 210 | 3300005843 | Ga0068860_100000285 | Ga0068860_10000028521 | 277 |
| 211 | 3300005843 | Ga0068860_100096985 | Ga0068860_1000969852 | 277 |
| 212 | 3300005843 | Ga0068860_100325651 | Ga0068860_1003256511 | 277 |
| 213 | 3300005844 | Ga0068862_100323832 | Ga0068862_1003238322 | 277 |
| 214 | 3300005844 | Ga0068862_100420115 | Ga0068862_1004201151 | 277 |
| 215 | 3300005844 | Ga0068862_100505769 | Ga0068862_1005057692 | 277 |
| 216 | 3300005937 | Ga0081455_10002509 | Ga0081455_1000250920 | 277 |
| 217 | 3300005937 | Ga0081455_10128424 | Ga0081455_101284242 | 277 |
| 218 | 3300005981 | Ga0081538_10031087 | Ga0081538_100310876 | 277 |
| 219 | 3300005981 | Ga0081538_10050768 | Ga0081538_100507682 | 277 |
| 220 | 3300006237 | Ga0097621_100001017 | Ga0097621_10000101710 | 277 |
| 221 | 3300006237 | Ga0097621_100009118 | Ga0097621_1000091186 | 277 |
| 222 | 3300006237 | Ga0097621_100025869 | Ga0097621_1000258693 | 277 |
| 223 | 3300006237 | Ga0097621_100075359 | Ga0097621_1000753592 | 277 |
| 224 | 3300006237 | Ga0097621_100391757 | Ga0097621_1003917572 | 277 |
| 225 | 3300006358 | Ga0068871_100001130 | Ga0068871_1000011304 | 277 |
| 226 | 3300006358 | Ga0068871_100001363 | Ga0068871_10000136315 | 277 |
| 227 | 3300006358 | Ga0068871_100001889 | Ga0068871_10000188910 | 277 |
| 228 | 3300006844 | Ga0075428_100037742 | Ga0075428_1000377427 | 277 |
| 229 | 3300006844 | Ga0075428_100196797 | Ga0075428_1001967972 | 277 |
| 230 | 3300006846 | Ga0075430_100130267 | Ga0075430_1001302673 | 277 |
| 231 | 3300006847 | Ga0075431_100032928 | Ga0075431_1000329284 | 277 |
| 232 | 3300006880 | Ga0075429_100008362 | Ga0075429_10000836210 | 277 |
| 233 | 3300006880 | Ga0075429_100027743 | Ga0075429_1000277432 | 277 |
| 234 | 3300006881 | Ga0068865_100038245 | Ga0068865_1000382453 | 277 |
| 235 | 3300006914 | Ga0075436_100054455 | Ga0075436_1000544552 | 277 |
| 236 | 3300006931 | Ga0097620_100234707 | Ga0097620_1002347072 | 277 |
| 237 | 3300006931 | Ga0097620_100278830 | Ga0097620_1002788302 | 277 |
| 238 | 3300007076 | Ga0075435_100111272 | Ga0075435_1001112722 | 277 |
| 239 | 3300009094 | Ga0111539_10049365 | Ga0111539_100493652 | 277 |
| 240 | 3300009094 | Ga0111539_10054034 | Ga0111539_100540344 | 277 |
| 241 | 3300009094 | Ga0111539_10319506 | Ga0111539_103195061 | 277 |
| 242 | 3300009094 | Ga0111539_10395340 | Ga0111539_103953401 | 277 |
| 243 | 3300009098 | Ga0105245_10000086 | Ga0105245_1000008644 | 277 |
| 244 | 3300009098 | Ga0105245_10175531 | Ga0105245_101755312 | 277 |
| 245 | 3300009147 | Ga0114129_10070003 | Ga0114129_100700032 | 277 |
| 246 | 3300009147 | Ga0114129_10084534 | Ga0114129_100845343 | 277 |
| 247 | 3300009147 | Ga0114129_10121335 | Ga0114129_101213354 | 277 |
| 248 | 3300009148 | Ga0105243_10000900 | Ga0105243_1000090022 | 277 |
| 249 | 3300009174 | Ga0105241_10012582 | Ga0105241_100125824 | 277 |
| 250 | 3300009176 | Ga0105242_10001502 | Ga0105242_1000150214 | 277 |
| 251 | 3300009176 | Ga0105242_10169475 | Ga0105242_101694751 | 277 |
| 252 | 3300009177 | Ga0105248_10086985 | Ga0105248_100869853 | 277 |
| 253 | 3300009177 | Ga0105248_10129352 | Ga0105248_101293523 | 277 |
| 254 | 3300009177 | Ga0105248_10602124 | Ga0105248_106021242 | 277 |
| 255 | 3300009553 | Ga0105249_10085091 | Ga0105249_100850912 | 277 |
| 256 | 3300009553 | Ga0105249_10375427 | Ga0105249_103754272 | 277 |
| 257 | 3300010375 | Ga0105239_10034543 | Ga0105239_100345434 | 277 |
| 258 | 3300013102 | Ga0157371_10085522 | Ga0157371_100855222 | 277 |
| 259 | 3300013296 | Ga0157374_10003525 | Ga0157374_1000352511 | 277 |
| 260 | 3300013296 | Ga0157374_10012957 | Ga0157374_100129574 | 277 |
| 261 | 3300013297 | Ga0157378_10001516 | Ga0157378_100015161 | 277 |
| 262 | 3300013297 | Ga0157378_10034102 | Ga0157378_100341023 | 277 |
| 263 | 3300013297 | Ga0157378_10150049 | Ga0157378_101500492 | 277 |
| 264 | 3300013297 | Ga0157378_10182606 | Ga0157378_101826061 | 277 |
| 265 | 3300013306 | Ga0163162_10012041 | Ga0163162_100120414 | 277 |
| 266 | 3300013306 | Ga0163162_10096248 | Ga0163162_100962483 | 277 |
| 267 | 3300013306 | Ga0163162_10195135 | Ga0163162_101951352 | 277 |
| 268 | 3300013306 | Ga0163162_10477818 | Ga0163162_104778181 | 277 |
| 269 | 3300013308 | Ga0157375_10004665 | Ga0157375_100046653 | 277 |
| 270 | 3300013308 | Ga0157375_10017440 | Ga0157375_100174403 | 277 |
| 271 | 3300013308 | Ga0157375_10168428 | Ga0157375_101684282 | 277 |
| 272 | 3300014325 | Ga0163163_10069027 | Ga0163163_100690272 | 277 |
| 273 | 3300014326 | Ga0157380_10015263 | Ga0157380_100152632 | 277 |
| 274 | 3300014326 | Ga0157380_10168090 | Ga0157380_101680902 | 277 |
| 275 | 3300014745 | Ga0157377_10013327 | Ga0157377_100133274 | 277 |
| 276 | 3300014745 | Ga0157377_10054733 | Ga0157377_100547332 | 277 |
| 277 | 3300014968 | Ga0157379_10086917 | Ga0157379_100869172 | 277 |
| 278 | 3300014969 | Ga0157376_10014092 | Ga0157376_100140924 | 277 |
| 279 | 3300014969 | Ga0157376_10017583 | Ga0157376_100175833 | 277 |
| 280 | 3300014969 | Ga0157376_10108602 | Ga0157376_101086022 | 277 |
| 281 | 3300017792 | Ga0163161_10086176 | Ga0163161_100861763 | 277 |
| 282 | 3300017792 | Ga0163161_10244079 | Ga0163161_102440792 | 277 |
| 283 | 3300025321 | Ga0207656_10004026 | Ga0207656_100040263 | 277 |
| 284 | 3300025885 | Ga0207653_10024006 | Ga0207653_100240062 | 277 |
| 285 | 3300025893 | Ga0207682_10002790 | Ga0207682_100027907 | 277 |
| 286 | 3300025893 | Ga0207682_10003695 | Ga0207682_100036955 | 277 |
| 287 | 3300025893 | Ga0207682_10039301 | Ga0207682_100393011 | 277 |
| 288 | 3300025893 | Ga0207682_10052428 | Ga0207682_100524282 | 277 |
| 289 | 3300025899 | Ga0207642_10106722 | Ga0207642_101067221 | 277 |
| 290 | 3300025901 | Ga0207688_10006774 | Ga0207688_100067746 | 277 |
| 291 | 3300025901 | Ga0207688_10040287 | Ga0207688_100402871 | 277 |
| 292 | 3300025901 | Ga0207688_10167861 | Ga0207688_101678611 | 277 |
| 293 | 3300025903 | Ga0207680_10012453 | Ga0207680_100124533 | 277 |
| 294 | 3300025903 | Ga0207680_10086725 | Ga0207680_100867252 | 277 |
| 295 | 3300025903 | Ga0207680_10090525 | Ga0207680_100905251 | 277 |
| 296 | 3300025907 | Ga0207645_10009136 | Ga0207645_100091362 | 277 |
| 297 | 3300025907 | Ga0207645_10023149 | Ga0207645_100231492 | 277 |
| 298 | 3300025907 | Ga0207645_10023207 | Ga0207645_100232072 | 277 |
| 299 | 3300025907 | Ga0207645_10069038 | Ga0207645_100690382 | 277 |
| 300 | 3300025908 | Ga0207643_10016102 | Ga0207643_100161021 | 277 |
| 301 | 3300025908 | Ga0207643_10030227 | Ga0207643_100302272 | 277 |
| 302 | 3300025908 | Ga0207643_10182024 | Ga0207643_101820241 | 277 |
| 303 | 3300025917 | Ga0207660_10002252 | Ga0207660_100022522 | 277 |
| 304 | 3300025918 | Ga0207662_10000288 | Ga0207662_1000028821 | 277 |
| 305 | 3300025920 | Ga0207649_10015354 | Ga0207649_100153543 | 277 |
| 306 | 3300025921 | Ga0207652_10135518 | Ga0207652_101355183 | 277 |
| 307 | 3300025923 | Ga0207681_10061588 | Ga0207681_100615882 | 277 |
| 308 | 3300025925 | Ga0207650_10001311 | Ga0207650_100013114 | 277 |
| 309 | 3300025925 | Ga0207650_10004236 | Ga0207650_100042369 | 277 |
| 310 | 3300025925 | Ga0207650_10109300 | Ga0207650_101093002 | 277 |
| 311 | 3300025925 | Ga0207650_10148635 | Ga0207650_101486351 | 277 |
| 312 | 3300025926 | Ga0207659_10000792 | Ga0207659_100007924 | 277 |
| 313 | 3300025927 | Ga0207687_10305685 | Ga0207687_103056851 | 277 |
| 314 | 3300025931 | Ga0207644_10001469 | Ga0207644_100014693 | 277 |
| 315 | 3300025931 | Ga0207644_10004546 | Ga0207644_100045466 | 277 |
| 316 | 3300025931 | Ga0207644_10106963 | Ga0207644_101069632 | 277 |
| 317 | 3300025933 | Ga0207706_10017636 | Ga0207706_100176366 | 277 |
| 318 | 3300025933 | Ga0207706_10036835 | Ga0207706_100368355 | 277 |
| 319 | 3300025933 | Ga0207706_10194560 | Ga0207706_101945602 | 277 |
| 320 | 3300025933 | Ga0207706_10288854 | Ga0207706_102888542 | 277 |
| 321 | 3300025934 | Ga0207686_10000595 | Ga0207686_1000059517 | 277 |
| 322 | 3300025934 | Ga0207686_10243264 | Ga0207686_102432642 | 277 |
| 323 | 3300025935 | Ga0207709_10001099 | Ga0207709_1000109910 | 277 |
| 324 | 3300025936 | Ga0207670_10001960 | Ga0207670_100019602 | 277 |
| 325 | 3300025936 | Ga0207670_10116825 | Ga0207670_101168251 | 277 |
| 326 | 3300025936 | Ga0207670_10235805 | Ga0207670_102358052 | 277 |
| 327 | 3300025937 | Ga0207669_10147331 | Ga0207669_101473311 | 277 |
| 328 | 3300025938 | Ga0207704_10000193 | Ga0207704_100001935 | 277 |
| 329 | 3300025940 | Ga0207691_10000276 | Ga0207691_1000027613 | 277 |
| 330 | 3300025940 | Ga0207691_10001030 | Ga0207691_1000103015 | 277 |
| 331 | 3300025940 | Ga0207691_10167919 | Ga0207691_101679191 | 277 |
| 332 | 3300025941 | Ga0207711_10130619 | Ga0207711_101306193 | 277 |
| 333 | 3300025941 | Ga0207711_10145629 | Ga0207711_101456292 | 277 |
| 334 | 3300025942 | Ga0207689_10000246 | Ga0207689_1000024625 | 277 |
| 335 | 3300025942 | Ga0207689_10115512 | Ga0207689_101155122 | 277 |
| 336 | 3300025942 | Ga0207689_10129045 | Ga0207689_101290452 | 277 |
| 337 | 3300025944 | Ga0207661_10001694 | Ga0207661_100016942 | 277 |
| 338 | 3300025944 | Ga0207661_10096841 | Ga0207661_100968412 | 277 |
| 339 | 3300025945 | Ga0207679_10001570 | Ga0207679_100015704 | 277 |
| 340 | 3300025945 | Ga0207679_10002649 | Ga0207679_100026499 | 277 |
| 341 | 3300025949 | Ga0207667_10008141 | Ga0207667_100081415 | 277 |
| 342 | 3300025960 | Ga0207651_10003905 | Ga0207651_100039056 | 277 |
| 343 | 3300025960 | Ga0207651_10057336 | Ga0207651_100573362 | 277 |
| 344 | 3300025960 | Ga0207651_10206960 | Ga0207651_102069602 | 277 |
| 345 | 3300025961 | Ga0207712_10159842 | Ga0207712_101598421 | 277 |
| 346 | 3300025981 | Ga0207640_10000657 | Ga0207640_100006574 | 277 |
| 347 | 3300025981 | Ga0207640_10004162 | Ga0207640_100041622 | 277 |
| 348 | 3300025986 | Ga0207658_10055814 | Ga0207658_100558142 | 277 |
| 349 | 3300025986 | Ga0207658_10092468 | Ga0207658_100924682 | 277 |
| 350 | 3300025986 | Ga0207658_10109025 | Ga0207658_101090252 | 277 |
| 351 | 3300025986 | Ga0207658_10160792 | Ga0207658_101607922 | 277 |
| 352 | 3300026023 | Ga0207677_10000888 | Ga0207677_1000088815 | 277 |
| 353 | 3300026023 | Ga0207677_10001059 | Ga0207677_1000105913 | 277 |
| 354 | 3300026023 | Ga0207677_10003535 | Ga0207677_100035354 | 277 |
| 355 | 3300026023 | Ga0207677_10083865 | Ga0207677_100838652 | 277 |
| 356 | 3300026035 | Ga0207703_10165117 | Ga0207703_101651172 | 277 |
| 357 | 3300026035 | Ga0207703_10257665 | Ga0207703_102576652 | 277 |
| 358 | 3300026067 | Ga0207678_10368247 | Ga0207678_103682472 | 277 |
| 359 | 3300026075 | Ga0207708_10000346 | Ga0207708_1000034628 | 277 |
| 360 | 3300026075 | Ga0207708_10015904 | Ga0207708_100159042 | 277 |
| 361 | 3300026075 | Ga0207708_10051638 | Ga0207708_100516382 | 277 |
| 362 | 3300026078 | Ga0207702_10099001 | Ga0207702_100990013 | 277 |
| 363 | 3300026088 | Ga0207641_10037686 | Ga0207641_100376864 | 277 |
| 364 | 3300026088 | Ga0207641_10049563 | Ga0207641_100495633 | 277 |
| 365 | 3300026088 | Ga0207641_10100076 | Ga0207641_101000763 | 277 |
| 366 | 3300026089 | Ga0207648_10000145 | Ga0207648_1000014545 | 277 |
| 367 | 3300026089 | Ga0207648_10011175 | Ga0207648_100111752 | 277 |
| 368 | 3300026089 | Ga0207648_10018599 | Ga0207648_100185994 | 277 |
| 369 | 3300026089 | Ga0207648_10054903 | Ga0207648_100549032 | 277 |
| 370 | 3300026089 | Ga0207648_10108425 | Ga0207648_101084252 | 277 |
| 371 | 3300026095 | Ga0207676_10016549 | Ga0207676_100165496 | 277 |
| 372 | 3300026095 | Ga0207676_10189805 | Ga0207676_101898052 | 277 |
| 373 | 3300026118 | Ga0207675_100001564 | Ga0207675_1000015646 | 277 |
| 374 | 3300026118 | Ga0207675_100046179 | Ga0207675_1000461793 | 277 |
| 375 | 3300026118 | Ga0207675_100406497 | Ga0207675_1004064971 | 277 |
| 376 | 3300026121 | Ga0207683_10000759 | Ga0207683_1000075913 | 277 |
| 377 | 3300026121 | Ga0207683_10015948 | Ga0207683_100159484 | 277 |
| 378 | 3300026121 | Ga0207683_10017802 | Ga0207683_100178023 | 277 |
| 379 | 3300026121 | Ga0207683_10065370 | Ga0207683_100653702 | 277 |
| 380 | 3300026142 | Ga0207698_10000566 | Ga0207698_1000056615 | 277 |
| 381 | 3300026142 | Ga0207698_10013639 | Ga0207698_100136393 | 277 |
| 382 | 3300026142 | Ga0207698_10320530 | Ga0207698_103205301 | 277 |
| 383 | 3300027907 | Ga0207428_10016172 | Ga0207428_100161726 | 277 |
| 384 | 3300027907 | Ga0207428_10227973 | Ga0207428_102279731 | 277 |
| 385 | 3300028379 | Ga0268266_10047069 | Ga0268266_100470692 | 277 |
| 386 | 3300028379 | Ga0268266_10163878 | Ga0268266_101638782 | 277 |
| 387 | 3300028379 | Ga0268266_10280094 | Ga0268266_102800941 | 277 |
| 388 | 3300028380 | Ga0268265_10001212 | Ga0268265_100012126 | 277 |
| 389 | 3300028380 | Ga0268265_10351896 | Ga0268265_103518961 | 277 |
| 390 | 3300028381 | Ga0268264_10051975 | Ga0268264_100519754 | 277 |
| 391 | 3300028381 | Ga0268264_10166525 | Ga0268264_101665252 | 277 |
| 392 | 3300028577 | Ga0265318_10006553 | Ga0265318_100065534 | 277 |
| 393 | 3300031238 | Ga0265332_10003598 | Ga0265332_100035985 | 277 |
| 394 | 3300031238 | Ga0265332_10092510 | Ga0265332_100925102 | 277 |
| 395 | 3300031239 | Ga0265328_10005143 | Ga0265328_100051432 | 277 |
| 396 | 3300031240 | Ga0265320_10072348 | Ga0265320_100723482 | 277 |
| 397 | 3300031242 | Ga0265329_10002359 | Ga0265329_100023597 | 277 |
| 398 | 3300031250 | Ga0265331_10000832 | Ga0265331_100008328 | 277 |
| 399 | 3300031548 | Ga0307408_100040828 | Ga0307408_1000408282 | 277 |
| 400 | 3300031711 | Ga0265314_10009702 | Ga0265314_100097026 | 277 |
| 401 | 3300031711 | Ga0265314_10086938 | Ga0265314_100869382 | 277 |
| 402 | 3300031712 | Ga0265342_10003929 | Ga0265342_100039299 | 277 |
| 403 | 3300031731 | Ga0307405_10013809 | Ga0307405_100138093 | 277 |
| 404 | 3300031824 | Ga0307413_10007421 | Ga0307413_100074214 | 277 |
| 405 | 3300031824 | Ga0307413_10039136 | Ga0307413_100391362 | 277 |
| 406 | 3300031852 | Ga0307410_10004671 | Ga0307410_100046715 | 277 |
| 407 | 3300031903 | Ga0307407_10046002 | Ga0307407_100460022 | 277 |
| 408 | 3300031911 | Ga0307412_10045725 | Ga0307412_100457252 | 277 |
| 409 | 3300031995 | Ga0307409_100039707 | Ga0307409_1000397072 | 277 |
| 410 | 3300031995 | Ga0307409_100050551 | Ga0307409_1000505513 | 277 |
| 411 | 3300031995 | Ga0307409_100408656 | Ga0307409_1004086562 | 277 |
| 412 | 3300032004 | Ga0307414_10006140 | Ga0307414_100061404 | 277 |
| 413 | 3300032004 | Ga0307414_10201230 | Ga0307414_102012301 | 277 |
| 414 | 3300032005 | Ga0307411_10026326 | Ga0307411_100263262 | 277 |
| 415 | 3300032005 | Ga0307411_10155383 | Ga0307411_101553832 | 277 |
| 416 | 3300032005 | Ga0307411_10306530 | Ga0307411_103065301 | 277 |
| 417 | 3300034818 | Ga0373950_0016982 | Ga0373950_0016982_129_1115 | 277 |
| 418 | 3300035083 | Ga0373926_0004813 | Ga0373926_0004813_2495_3460 | 277 |
| 419 | 3300035088 | Ga0373940_0005327 | Ga0373940_0005327_13_999 | 277 |
| 420 | 3300035089 | Ga0373944_0001696 | Ga0373944_0001696_2703_3656 | 277 |
| 421 | 3300035090 | Ga0373949_0004742 | Ga0373949_0004742_1791_2777 | 277 |
| 422 | 3300035091 | Ga0373951_0017082 | Ga0373951_0017082_343_1329 | 277 |
| 423 | 3300035092 | Ga0373952_0009972 | Ga0373952_0009972_400_1386 | 277 |
| 424 | 3300035112 | Ga0373932_0004303 | Ga0373932_0004303_2073_3059 | 277 |
| 425 | 3300035113 | Ga0373936_0004368 | Ga0373936_0004368_488_1441 | 277 |
| 426 | 3300035113 | Ga0373936_0048540 | Ga0373936_0048540_502_1467 | 277 |
| 427 | 3300035114 | Ga0373939_0025008 | Ga0373939_0025008_292_1278 | 277 |
| 428 | 3300035116 | Ga0373945_0014482 | Ga0373945_0014482_1355_2308 | 277 |
| 429 | 3300035170 | Ga0373943_0005171 | Ga0373943_0005171_2053_3006 | 277 |
| 430 | 3300035170 | Ga0373943_0011481 | Ga0373943_0011481_466_1431 | 277 |
| 431 | 3300035171 | Ga0373946_0000679 | Ga0373946_0000679_7271_8224 | 277 |
| 432 | 3300035171 | Ga0373946_0057643 | Ga0373946_0057643_242_1207 | 277 |
| 433 | 3300035207 | Ga0373942_0005658 | Ga0373942_0005658_99_1085 | 277 |
| 434 | 3300035692 | Ga0373935_0005822 | Ga0373935_0005822_2868_3821 | 277 |
| 435 | 3300035692 | Ga0373935_0021034 | Ga0373935_0021034_975_1940 | 277 |
| 436 | 3300035695 | Ga0373927_0006898 | Ga0373927_0006898_4271_5224 | 277 |
| 437 | 3300035695 | Ga0373927_0029328 | Ga0373927_0029328_393_1358 | 277 |
| 438 | 3300035725 | Ga0373947_0006482 | Ga0373947_0006482_2496_3449 | 277 |
| 439 | 3300035725 | Ga0373947_0020088 | Ga0373947_0020088_2426_3391 | 277 |
| 440 | 3300037068 | Ga0373925_0011389 | Ga0373925_0011389_2998_3951 | 277 |
| 441 | 3300037068 | Ga0373925_0027144 | Ga0373925_0027144_2386_3351 | 277 |
| 442 | 3300037418 | Ga0395900_0027735 | Ga0395900_0027735_4795_5766 | 277 |
| 443 | 3300037466 | Ga0395898_0043684 | Ga0395898_0043684_1913_2884 | 277 |
| 444 | 3300037471 | Ga0395905_0036366 | Ga0395905_0036366_860_1831 | 277 |
| 445 | 3300041512 | Ga0451853_4038841 | Ga0451853_4038841_176_1141 | 277 |
| 446 | 3300042876 | Ga0451577_0732474 | Ga0451577_0732474_13_882 | 277 |
| 447 | 3300044693 | Ga0466961_0067392 | Ga0466961_0067392_87_1091 | 277 |
| 448 | 3300044712 | Ga0453684_0558773 | Ga0453684_0558773_128_1150 | 277 |
| 449 | 3300045051 | Ga0451576_0031504 | Ga0451576_0031504_1560_2525 | 277 |
| 450 | 3300046455 | Ga0495603_0013602 | Ga0495603_0013602_1828_2781 | 277 |
| 451 | 3300046472 | Ga0495580_0002245 | Ga0495580_0002245_3089_4042 | 277 |
| 452 | 3300046473 | Ga0495582_0037819 | Ga0495582_0037819_1144_2097 | 277 |
| 453 | 3300046474 | Ga0495605_0074406 | Ga0495605_0074406_457_1422 | 277 |
| 454 | 3300046531 | Ga0495665_0032852 | Ga0495665_0032852_1577_2530 | 277 |
| 455 | 3300046535 | Ga0495586_0003755 | Ga0495586_0003755_4543_5496 | 277 |
| 456 | 3300046615 | Ga0495656_0012687 | Ga0495656_0012687_2010_3029 | 277 |
| 457 | 3300046615 | Ga0495656_0071982 | Ga0495656_0071982_38_1009 | 277 |
| 458 | 3300046683 | Ga0495658_0001257 | Ga0495658_0001257_10245_11198 | 277 |
| 459 | 3300047321 | Ga0495676_0030171 | Ga0495676_0030171_1708_2661 | 277 |
| 460 | 3300048905 | Ga0496102_0085148 | Ga0496102_0085148_188_1153 | 277 |
| 461 | 3300048909 | Ga0496106_0040101 | Ga0496106_0040101_686_1567 | 277 |
| 462 | 3300048909 | Ga0496106_0415453 | Ga0496106_0415453_16_906 | 277 |
| 463 | 3300048911 | Ga0496108_0008167 | Ga0496108_0008167_1755_2720 | 277 |
| 464 | 3300048911 | Ga0496108_0132458 | Ga0496108_0132458_886_1767 | 277 |
| 465 | 3300048912 | Ga0496109_0024935 | Ga0496109_0024935_2605_3570 | 277 |
| 466 | 3300048912 | Ga0496109_0131358 | Ga0496109_0131358_434_1315 | 277 |
| 467 | 3300048912 | Ga0496109_0364043 | Ga0496109_0364043_57_929 | 277 |
| 468 | 3300048913 | Ga0496110_0014434 | Ga0496110_0014434_3235_4200 | 277 |
| 469 | 3300048914 | Ga0496111_0272659 | Ga0496111_0272659_15_980 | 277 |
| 470 | 3300048917 | Ga0496114_0159296 | Ga0496114_0159296_159_1040 | 277 |
| 471 | 3300048919 | Ga0496116_0010833 | Ga0496116_0010833_4087_5103 | 277 |
| 472 | 3300048925 | Ga0496122_0023593 | Ga0496122_0023593_3056_4072 | 277 |
| 473 | 3300049582 | Ga0501048_0170695 | Ga0501048_0170695_445_1416 | 277 |
| 474 | 3300049743 | Ga0501081_0237567 | Ga0501081_0237567_16_987 | 277 |
| 475 | 3300050507 | nmdc:mga05p37_185_c1 | nmdc:mga05p37_185_c1_929_1894 | 277 |
| 476 | 3300050508 | nmdc:mga09592_6056_c1 | nmdc:mga09592_6056_c1_535_1500 | 277 |
| 477 | 3300050509 | nmdc:mga0qj67_65216_c1 | nmdc:mga0qj67_65216_c1_760_1767 | 277 |
| 478 | 3300050510 | nmdc:mga06r32_237410_c1 | nmdc:mga06r32_237410_c1_322_1329 | 277 |
| 479 | 3300050511 | nmdc:mga08y16_192897_c1 | nmdc:mga08y16_192897_c1_1011_1976 | 277 |
| 480 | 3300050511 | nmdc:mga08y16_27924_c1 | nmdc:mga08y16_27924_c1_4617_5582 | 277 |
| 481 | 3300050511 | nmdc:mga08y16_369507_c1 | nmdc:mga08y16_369507_c1_87_1085 | 277 |
| 482 | 3300050511 | nmdc:mga08y16_515986_c1 | nmdc:mga08y16_515986_c1_63_1034 | 277 |
| 483 | 3300050513 | nmdc:mga0rr50_215890_c1 | nmdc:mga0rr50_215890_c1_45_983 | 277 |
| 484 | 3300053088 | Ga0500644_0001546 | Ga0500644_0001546_4460_5494 | 277 |
| 485 | 3300053092 | Ga0500583_0130424 | Ga0500583_0130424_50_1015 | 277 |
| 486 | 3300053117 | Ga0500593_000654 | Ga0500593_000654_70_1077 | 277 |
| 487 | 3300061734 | Ga0530510_0046651 | Ga0530510_0046651_1416_2387 | 277 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9558 | 2 | 277 |
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9491 | 2 | 277 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.9459 | 2 | 277 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.9393 | 2 | 277 |
| 8hk9-assembly2.cif.gz_A | apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis | 0.9291 | 2 | 274 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9571 | 80 | 197 | 3.40.190.10 |
| 2dvzA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9433 | 79 | 201 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9405 | 80 | 202 | 3.40.190.10 |
| 2f5xC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9266 | 81 | 202 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9262 | 80 | 202 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A3FMR4-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9749 | 2 | 277 |
|
| AF-A0A261UKM0-F1-model_v4 | ABC transporter substrate-binding protein | 0.974 | 2 | 277 |
|
| AF-A0A1F4DK31-F1-model_v4 | LacI family transcriptional regulator | 0.9732 | 2 | 277 |
|
| AF-A0A4R3USR2-F1-model_v4 | Tripartite-type tricarboxylate transporter receptor subunit TctC | 0.9728 | 2 | 277 |
|
| AF-A0A2G4JA32-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9726 | 2 | 277 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar