F453408

General Info

Members Datasets Scaffolds Average Seq Length
487 263 974 94

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10812365|Ga0070709_108123652
Length 95
Sequence MALARVVTFDGVSKDRMDQMDREMREGDPPEGFPSSTELIVLHDPETEKSLVLILFESEDDYQKGDEILSAMPTGDTPGQRTSVTKYNVATRMSN

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
154 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
178 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
179 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
180 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
181 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
182 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
185 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 14.99
Rhizosphere 83.57
Stem 0
Stem Tuber 0
Unclassified 21.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10812365 3300005434 Bacteria 734
2 Ga0007409J51694_1072764 3300003575 Bacteria 506
3 Ga0058862_12703249 3300004803 Unclassified 1538
4 Ga0070658_10121059 3300005327 Bacteria 2175
5 Ga0070683_100043917 3300005329 Bacteria 4120
6 Ga0070683_100071790 3300005329 Bacteria 3231
7 Ga0070683_100071800 3300005329 Bacteria 3230
8 Ga0070683_100940875 3300005329 Bacteria 829
9 Ga0070690_100040176 3300005330 Bacteria 2958
10 Ga0070670_100099949 3300005331 Bacteria 2496
11 Ga0070670_101467158 3300005331 Bacteria 626
12 Ga0070677_10199902 3300005333 Bacteria 964
13 Ga0070680_100137313 3300005336 Bacteria 2049
14 Ga0070682_100023209 3300005337 Bacteria 3683
15 Ga0070682_100254629 3300005337 Bacteria 1268
16 Ga0068868_102059347 3300005338 Unclassified 542
17 Ga0070660_101843615 3300005339 Unclassified 515
18 Ga0070689_100167903 3300005340 Bacteria 1777
19 Ga0070692_10658081 3300005345 Unclassified 700
20 Ga0070668_101413063 3300005347 Unclassified 635
21 Ga0070671_100214390 3300005355 Bacteria 1633
22 Ga0070671_100835538 3300005355 Unclassified 803
23 Ga0070671_101832331 3300005355 Unclassified 539
24 Ga0070671_101985036 3300005355 Bacteria 518
25 Ga0070674_101087081 3300005356 Unclassified 706
26 Ga0070674_101257683 3300005356 Bacteria 659
27 Ga0070673_100756896 3300005364 Bacteria 895
28 Ga0070659_100219927 3300005366 Bacteria 1567
29 Ga0070709_10089033 3300005434 Bacteria 2032
30 Ga0070709_10534001 3300005434 Unclassified 895
31 Ga0070714_100117573 3300005435 Bacteria 2361
32 Ga0070713_100085580 3300005436 Bacteria 2701
33 Ga0070713_100090855 3300005436 Bacteria 2626
34 Ga0070713_100108349 3300005436 Bacteria 2418
35 Ga0070713_100228392 3300005436 Bacteria 1691
36 Ga0070713_100294827 3300005436 Unclassified 1492
37 Ga0070713_101114031 3300005436 Bacteria 763
38 Ga0070710_10027331 3300005437 Bacteria 3041
39 Ga0070710_10743267 3300005437 Bacteria 696
40 Ga0070701_10106629 3300005438 Bacteria 1560
41 Ga0070711_100108455 3300005439 Bacteria 2034
42 Ga0070711_100429139 3300005439 Unclassified 1078
43 Ga0070711_100881357 3300005439 Unclassified 763
44 Ga0070705_100093996 3300005440 Bacteria 1876
45 Ga0070705_100208320 3300005440 Unclassified 1346
46 Ga0070700_100636864 3300005441 Bacteria 840
47 Ga0070700_100804098 3300005441 Bacteria 757
48 Ga0070708_100178405 3300005445 Bacteria 1985
49 Ga0070708_101354828 3300005445 Unclassified 664
50 Ga0070708_101965135 3300005445 Bacteria 542
51 Ga0070663_100099107 3300005455 Bacteria 2172
52 Ga0070663_101408037 3300005455 Bacteria 618
53 Ga0070678_100269019 3300005456 Bacteria 1436
54 Ga0070681_10556686 3300005458 Bacteria 1061
55 Ga0070681_11133319 3300005458 Unclassified 703
56 Ga0070681_11869675 3300005458 Bacteria 528
57 Ga0068867_100537007 3300005459 Bacteria 1011
58 Ga0070706_100521903 3300005467 Bacteria 1105
59 Ga0070706_101012859 3300005467 Unclassified 766
60 Ga0070707_101331379 3300005468 Bacteria 684
61 Ga0070707_101529197 3300005468 Unclassified 634
62 Ga0070698_100176674 3300005471 Bacteria 2075
63 Ga0070698_100499715 3300005471 Unclassified 1154
64 Ga0070699_100380222 3300005518 Bacteria 1275
65 Ga0070679_100021712 3300005530 Bacteria 6270
66 Ga0070684_100014148 3300005535 Bacteria 6453
67 Ga0070684_100038164 3300005535 Bacteria 4124
68 Ga0070684_100088261 3300005535 Bacteria 2755
69 Ga0070684_101404174 3300005535 Bacteria 657
70 Ga0070684_102170897 3300005535 Unclassified 524
71 Ga0070697_101047118 3300005536 Unclassified 726
72 Ga0068853_100288097 3300005539 Unclassified 1515
73 Ga0070672_100636617 3300005543 Unclassified 931
74 Ga0070672_101868413 3300005543 Unclassified 540
75 Ga0070686_100325880 3300005544 Bacteria 1147
76 Ga0070686_100344594 3300005544 Bacteria 1118
77 Ga0070696_100011666 3300005546 Bacteria 5887
78 Ga0070693_100221533 3300005547 Unclassified 1240
79 Ga0070693_100347713 3300005547 Bacteria 1014
80 Ga0070665_100896257 3300005548 Bacteria 900
81 Ga0070704_100168994 3300005549 Bacteria 1737
82 Ga0070704_100211495 3300005549 Bacteria 1572
83 Ga0070704_100487393 3300005549 Bacteria 1068
84 Ga0070704_101051993 3300005549 Bacteria 738
85 Ga0070704_101301964 3300005549 Bacteria 665
86 Ga0068855_101422700 3300005563 Bacteria 714
87 Ga0068857_100041720 3300005577 Bacteria 4069
88 Ga0068857_100748467 3300005577 Bacteria 931
89 Ga0068857_101149510 3300005577 Bacteria 751
90 Ga0068854_100429469 3300005578 Bacteria 1099
91 Ga0068856_100132493 3300005614 Bacteria 2497
92 Ga0068856_100200585 3300005614 Bacteria 2009
93 Ga0068856_100287366 3300005614 Unclassified 1661
94 Ga0070702_100942697 3300005615 Bacteria 679
95 Ga0070702_101602634 3300005615 Bacteria 539
96 Ga0068864_100027321 3300005618 Bacteria 4819
97 Ga0068864_102608929 3300005618 Unclassified 511
98 Ga0068861_100284649 3300005719 Bacteria 1425
99 Ga0068851_10757090 3300005834 Bacteria 601
100 Ga0068870_10098580 3300005840 Bacteria 1647
101 Ga0068870_10643631 3300005840 Unclassified 725
102 Ga0068863_101592428 3300005841 Archaea 662
103 Ga0068858_101262231 3300005842 Bacteria 727
104 Ga0070717_10017210 3300006028 Bacteria 5619
105 Ga0070717_10112473 3300006028 Bacteria 2324
106 Ga0070717_10473574 3300006028 Bacteria 1130
107 Ga0075365_10131602 3300006038 Bacteria 1731
108 Ga0075365_10891912 3300006038 Unclassified 627
109 Ga0075432_10103944 3300006058 Bacteria 1052
110 Ga0070715_10027347 3300006163 Bacteria 2278
111 Ga0070716_100017680 3300006173 Bacteria 3701
112 Ga0070716_100188527 3300006173 Bacteria 1360
113 Ga0070716_100748791 3300006173 Bacteria 751
114 Ga0070712_100060937 3300006175 Bacteria 2663
115 Ga0070712_100066043 3300006175 Bacteria 2570
116 Ga0097621_100164802 3300006237 Unclassified 1907
117 Ga0068871_100051439 3300006358 Bacteria 3335
118 Ga0075428_100042514 3300006844 Bacteria 4996
119 Ga0075428_100047490 3300006844 Bacteria 4716
120 Ga0075428_101099347 3300006844 Bacteria 840
121 Ga0075428_101166741 3300006844 Bacteria 812
122 Ga0075430_100421894 3300006846 Bacteria 1101
123 Ga0075430_101128735 3300006846 Bacteria 646
124 Ga0075431_100077017 3300006847 Bacteria 3442
125 Ga0075431_100205574 3300006847 Bacteria 2013
126 Ga0075433_10144164 3300006852 Bacteria 2117
127 Ga0075433_11949453 3300006852 Unclassified 503
128 Ga0075434_100038469 3300006871 Bacteria 4738
129 Ga0075429_100295629 3300006880 Bacteria 1418
130 Ga0075429_101287180 3300006880 Unclassified 638
131 Ga0068865_100369919 3300006881 Bacteria 1166
132 Ga0075436_100067131 3300006914 Bacteria 2479
133 Ga0075436_100675933 3300006914 Bacteria 764
134 Ga0075436_101042716 3300006914 Bacteria 614
135 Ga0075436_101121930 3300006914 Bacteria 592
136 Ga0075435_100011297 3300007076 Bacteria 6561
137 Ga0075435_101100891 3300007076 Bacteria 694
138 Ga0111539_10122391 3300009094 Bacteria 3049
139 Ga0111539_11472660 3300009094 Unclassified 790
140 Ga0111539_12287417 3300009094 Bacteria 627
141 Ga0111539_12495307 3300009094 Unclassified 600
142 Ga0105245_10206960 3300009098 Bacteria 1886
143 Ga0105245_10741912 3300009098 Bacteria 1017
144 Ga0105245_12907438 3300009098 Unclassified 531
145 Ga0114129_10021907 3300009147 Bacteria 9070
146 Ga0114129_10111246 3300009147 Bacteria 3779
147 Ga0114129_10487663 3300009147 Bacteria 1612
148 Ga0114129_11130759 3300009147 Bacteria 979
149 Ga0114129_11230874 3300009147 Bacteria 931
150 Ga0114129_13000642 3300009147 Bacteria 555
151 Ga0105243_10167170 3300009148 Bacteria 1902
152 Ga0105243_10917927 3300009148 Bacteria 872
153 Ga0105243_12137789 3300009148 Bacteria 596
154 Ga0105241_10026926 3300009174 Bacteria 4279
155 Ga0105242_10613640 3300009176 Bacteria 1052
156 Ga0105242_12356772 3300009176 Unclassified 579
157 Ga0105248_10389668 3300009177 Bacteria 1569
158 Ga0105248_11843642 3300009177 Bacteria 686
159 Ga0105237_12348666 3300009545 Bacteria 543
160 Ga0105249_10480415 3300009553 Bacteria 1285
161 Ga0105249_10642171 3300009553 Bacteria 1119
162 Ga0105246_10161092 3300011119 Unclassified 1709
163 Ga0105246_10823204 3300011119 Bacteria 826
164 Ga0157373_10318648 3300013100 Bacteria 1106
165 Ga0157371_10773478 3300013102 Bacteria 722
166 Ga0157369_10456445 3300013105 Bacteria 1323
167 Ga0157374_10738575 3300013296 Bacteria 999
168 Ga0157372_12030406 3300013307 Bacteria 661
169 Ga0157375_10014889 3300013308 Bacteria 6952
170 Ga0157375_10366596 3300013308 Bacteria 1607
171 Ga0157375_11281946 3300013308 Bacteria 861
172 Ga0157375_11866768 3300013308 Archaea 713
173 Ga0157375_12137909 3300013308 Unclassified 666
174 Ga0163163_10015985 3300014325 Bacteria 6955
175 Ga0163163_11502285 3300014325 Bacteria 735
176 Ga0182008_10026709 3300014497 Bacteria 2927
177 Ga0157377_10078614 3300014745 Bacteria 1923
178 Ga0157377_10168450 3300014745 Bacteria 1368
179 Ga0157376_10105930 3300014969 Bacteria 2466
180 Ga0157376_10691106 3300014969 Bacteria 1024
181 Ga0163161_11003375 3300017792 Unclassified 713
182 Ga0206356_10330947 3300020070 Unclassified 799
183 Ga0206352_10859059 3300020078 Unclassified 909
184 Ga0207692_10300658 3300025898 Unclassified 976
185 Ga0207688_10068936 3300025901 Bacteria 2004
186 Ga0207688_10437801 3300025901 Unclassified 814
187 Ga0207680_10376484 3300025903 Unclassified 1000
188 Ga0207685_10397512 3300025905 Unclassified 706
189 Ga0207699_10531895 3300025906 Unclassified 851
190 Ga0207699_11423265 3300025906 Bacteria 513
191 Ga0207654_10126209 3300025911 Bacteria 1614
192 Ga0207707_10238226 3300025912 Unclassified 1582
193 Ga0207671_11505073 3300025914 Bacteria 519
194 Ga0207693_10028628 3300025915 Bacteria 4403
195 Ga0207693_10057503 3300025915 Bacteria 3048
196 Ga0207693_10057504 3300025915 Bacteria 3048
197 Ga0207663_10080379 3300025916 Bacteria 2131
198 Ga0207663_10141072 3300025916 Bacteria 1679
199 Ga0207649_11177626 3300025920 Unclassified 605
200 Ga0207652_10372426 3300025921 Unclassified 1289
201 Ga0207646_10103164 3300025922 Bacteria 2558
202 Ga0207650_10234207 3300025925 Archaea 1482
203 Ga0207687_11129812 3300025927 Unclassified 673
204 Ga0207700_10070107 3300025928 Bacteria 2694
205 Ga0207700_10598035 3300025928 Bacteria 981
206 Ga0207700_10943414 3300025928 Bacteria 772
207 Ga0207664_10046135 3300025929 Bacteria 3420
208 Ga0207664_10091943 3300025929 Bacteria 2489
209 Ga0207664_10118465 3300025929 Bacteria 2212
210 Ga0207664_11751655 3300025929 Bacteria 544
211 Ga0207644_10126274 3300025931 Bacteria 1953
212 Ga0207644_10749422 3300025931 Bacteria 816
213 Ga0207690_10175309 3300025932 Bacteria 1610
214 Ga0207706_10716137 3300025933 Bacteria 854
215 Ga0207706_11183016 3300025933 Bacteria 636
216 Ga0207686_10540417 3300025934 Bacteria 910
217 Ga0207686_11801494 3300025934 Unclassified 507
218 Ga0207709_10085529 3300025935 Bacteria 2045
219 Ga0207709_10133151 3300025935 Bacteria 1697
220 Ga0207709_10437664 3300025935 Bacteria 1008
221 Ga0207670_10952191 3300025936 Bacteria 721
222 Ga0207669_10723770 3300025937 Bacteria 820
223 Ga0207704_10302962 3300025938 Bacteria 1225
224 Ga0207665_10001602 3300025939 Bacteria 15249
225 Ga0207665_10103695 3300025939 Bacteria 1990
226 Ga0207665_10732214 3300025939 Bacteria 779
227 Ga0207691_10179197 3300025940 Bacteria 1852
228 Ga0207691_11221761 3300025940 Bacteria 623
229 Ga0207711_11085097 3300025941 Bacteria 741
230 Ga0207661_10026386 3300025944 Bacteria 4427
231 Ga0207661_10148041 3300025944 Bacteria 2027
232 Ga0207661_10319683 3300025944 Bacteria 1395
233 Ga0207679_11139841 3300025945 Bacteria 716
234 Ga0207679_11384858 3300025945 Bacteria 645
235 Ga0207667_10583932 3300025949 Bacteria 1128
236 Ga0207651_11252395 3300025960 Unclassified 666
237 Ga0207712_10497721 3300025961 Bacteria 1041
238 Ga0207668_10874745 3300025972 Unclassified 799
239 Ga0207677_10741519 3300026023 Bacteria 875
240 Ga0207677_12198172 3300026023 Bacteria 513
241 Ga0207703_11227417 3300026035 Bacteria 721
242 Ga0207678_10057926 3300026067 Bacteria 3334
243 Ga0207702_10085530 3300026078 Unclassified 2748
244 Ga0207702_10414245 3300026078 Bacteria 1302
245 Ga0207702_10609783 3300026078 Unclassified 1071
246 Ga0207648_10105884 3300026089 Bacteria 2467
247 Ga0207648_11613367 3300026089 Bacteria 610
248 Ga0207676_11529550 3300026095 Unclassified 664
249 Ga0207674_10039919 3300026116 Bacteria 4864
250 Ga0207674_10172818 3300026116 Bacteria 2114
251 Ga0207675_100234587 3300026118 Bacteria 1771
252 Ga0207683_10000452 3300026121 Bacteria 38068
253 Ga0207683_11462130 3300026121 Unclassified 631
254 Ga0209974_10441638 3300027876 Unclassified 515
255 Ga0207428_10084137 3300027907 Bacteria 2480
256 Ga0207428_11104777 3300027907 Unclassified 554
257 Ga0307405_10020310 3300031731 Bacteria 3709
258 Ga0307413_10014549 3300031824 Bacteria 4001
259 Ga0307413_10373995 3300031824 Bacteria 1108
260 Ga0307410_10030228 3300031852 Bacteria 3459
261 Ga0307406_10016778 3300031901 Bacteria 4261
262 Ga0307406_12026163 3300031901 Unclassified 515
263 Ga0307407_10271912 3300031903 Unclassified 1170
264 Ga0307407_10283502 3300031903 Bacteria 1148
265 Ga0307412_10151635 3300031911 Bacteria 1711
266 Ga0307409_100018215 3300031995 Bacteria 4711
267 Ga0307409_100235512 3300031995 Unclassified 1663
268 Ga0307409_100284273 3300031995 Unclassified 1531
269 Ga0307409_100557127 3300031995 Bacteria 1126
270 Ga0307409_100584219 3300031995 Bacteria 1102
271 Ga0307409_100585062 3300031995 Bacteria 1101
272 Ga0307416_100009087 3300032002 Bacteria 6473
273 Ga0307416_100876946 3300032002 Bacteria 996
274 Ga0307416_100989745 3300032002 Unclassified 944
275 Ga0307414_10075512 3300032004 Bacteria 2446
276 Ga0307414_10909522 3300032004 Bacteria 807
277 Ga0307411_10180039 3300032005 Bacteria 1603
278 Ga0307411_11402613 3300032005 Bacteria 639
279 Ga0307415_100045012 3300032126 Bacteria 2955
280 Ga0307415_101227118 3300032126 Bacteria 707
281 Ga0307415_101862273 3300032126 Unclassified 583
282 Ga0373930_0089693 3300034816 Bacteria 720
283 Ga0373938_0194077 3300034957 Unclassified 560
284 Ga0373928_0029115 3300035084 Bacteria 1213
285 Ga0373949_0213959 3300035090 Bacteria 583
286 Ga0373951_0047997 3300035091 Bacteria 1045
287 Ga0373952_0042512 3300035092 Bacteria 1056
288 Ga0373932_0125544 3300035112 Unclassified 860
289 Ga0373960_0096343 3300035121 Bacteria 953
290 Ga0373961_0138119 3300035241 Unclassified 822
291 Ga0373931_0026692 3300035691 Bacteria 2942
292 Ga0373947_1092808 3300035725 Bacteria 544
293 Ga0395899_0033351 3300037312 Bacteria 3866
294 Ga0395899_0035417 3300037312 Bacteria 3747
295 Ga0395899_0259101 3300037312 Unclassified 1190
296 Ga0395899_0728895 3300037312 Unclassified 619
297 Ga0395900_0014778 3300037418 Bacteria 7955
298 Ga0395900_0064899 3300037418 Bacteria 3750
299 Ga0395900_0139883 3300037418 Unclassified 2479
300 Ga0395900_0420509 3300037418 Bacteria 1297
301 Ga0395898_0013364 3300037466 Bacteria 8457
302 Ga0395898_0014103 3300037466 Bacteria 8213
303 Ga0395898_0042240 3300037466 Bacteria 4499
304 Ga0395898_0457325 3300037466 Bacteria 1215
305 Ga0395898_1065432 3300037466 Unclassified 743
306 Ga0395905_0154324 3300037471 Bacteria 2159
307 Ga0395905_0166076 3300037471 Unclassified 2074
308 Ga0395905_0357946 3300037471 Unclassified 1352
309 Ga0395905_1589824 3300037471 Unclassified 558
310 Ga0395901_0015039 3300038443 Bacteria 7869
311 Ga0395901_0063805 3300038443 Bacteria 3834
312 Ga0395901_0105449 3300038443 Bacteria 2958
313 Ga0395901_0199970 3300038443 Bacteria 2095
314 Ga0395901_0518011 3300038443 Bacteria 1212
315 Ga0436365_0463357 3300039437 Unclassified 631
316 Ga0439461_0037581 3300041410 Bacteria 1035
317 Ga0451802_1896121 3300041460 Bacteria 805
318 Ga0451807_0486696 3300041486 Unclassified 672
319 Ga0451835_0191747 3300041492 Bacteria 589
320 Ga0451853_1600011 3300041512 Bacteria 1225
321 Ga0439445_0033300 3300042004 Bacteria 1346
322 Ga0439448_0072893 3300042005 Bacteria 1145
323 Ga0439455_0230056 3300042012 Unclassified 540
324 Ga0450911_022289 3300042115 Unclassified 825
325 Ga0450914_000928 3300042118 Bacteria 1650
326 Ga0450920_007597 3300042122 Bacteria 1968
327 Ga0450902_035424 3300042137 Unclassified 845
328 Ga0450906_011216 3300042145 Unclassified 1681
329 Ga0439446_0016690 3300042156 Bacteria 2046
330 Ga0439458_0020199 3300042157 Bacteria 1538
331 Ga0450916_005897 3300042530 Unclassified 1430
332 Ga0466965_0028175 3300044683 Unclassified 2728
333 Ga0466966_0117382 3300044684 Unclassified 1637
334 Ga0466961_0052517 3300044693 Unclassified 2601
335 Ga0466963_0062132 3300044694 Unclassified 2498
336 Ga0466964_0053956 3300044706 Bacteria 1656
337 Ga0466971_0001469 3300044719 Bacteria 9951
338 Ga0466968_0045003 3300044735 Bacteria 1872
339 Ga0466970_0387287 3300044765 Bacteria 796
340 Ga0466957_0013132 3300044842 Bacteria 4800
341 Ga0466959_0191224 3300045049 Bacteria 1428
342 Ga0451576_0063724 3300045051 Unclassified 3841
343 Ga0466958_0046211 3300045836 Unclassified 2627
344 Ga0466967_0615680 3300045976 Bacteria 1072
345 Ga0495584_0304332 3300046491 Bacteria 810
346 Ga0495584_0647087 3300046491 Bacteria 539
347 Ga0495596_0129607 3300046500 Bacteria 979
348 Ga0495607_0432643 3300046501 Bacteria 593
349 Ga0495630_0325452 3300046517 Unclassified 1175
350 Ga0495665_0236261 3300046531 Bacteria 943
351 Ga0495609_0126672 3300046538 Bacteria 1096
352 Ga0495656_0587622 3300046615 Bacteria 595
353 Ga0495656_0596446 3300046615 Unclassified 591
354 Ga0495659_0099304 3300046664 Unclassified 1126
355 Ga0495659_0492301 3300046664 Unclassified 537
356 Ga0495588_0448787 3300046674 Bacteria 677
357 Ga0495658_0082605 3300046683 Bacteria 1888
358 Ga0495624_0655933 3300046690 Bacteria 624
359 Ga0495670_0219393 3300046691 Bacteria 1010
360 Ga0495671_0335994 3300046692 Bacteria 725
361 Ga0495581_0547687 3300047315 Bacteria 671
362 Ga0495614_0205636 3300048089 Bacteria 892
363 Ga0496100_0074846 3300048903 Bacteria 2269
364 Ga0496100_0130456 3300048903 Bacteria 1770
365 Ga0496100_0142546 3300048903 Bacteria 1700
366 Ga0496100_0993089 3300048903 Bacteria 660
367 Ga0496101_0037620 3300048904 Bacteria 3433
368 Ga0496101_0156578 3300048904 Bacteria 1745
369 Ga0496101_0332649 3300048904 Bacteria 1192
370 Ga0496101_0869038 3300048904 Bacteria 710
371 Ga0496102_0052827 3300048905 Bacteria 3704
372 Ga0496102_0183821 3300048905 Bacteria 1969
373 Ga0496102_0271649 3300048905 Bacteria 1598
374 Ga0496102_0353353 3300048905 Archaea 1384
375 Ga0496102_0437324 3300048905 Bacteria 1228
376 Ga0496102_0457868 3300048905 Bacteria 1196
377 Ga0496102_0546023 3300048905 Bacteria 1082
378 Ga0496103_0009589 3300048906 Bacteria 5731
379 Ga0496103_0513199 3300048906 Bacteria 766
380 Ga0496103_0598420 3300048906 Bacteria 702
381 Ga0496104_0019882 3300048907 Bacteria 6149
382 Ga0496104_0139197 3300048907 Bacteria 2332
383 Ga0496104_0143517 3300048907 Bacteria 2293
384 Ga0496104_1025904 3300048907 Bacteria 729
385 Ga0496105_0000861 3300048908 Bacteria 20735
386 Ga0496105_0017657 3300048908 Bacteria 5723
387 Ga0496105_0229610 3300048908 Bacteria 1508
388 Ga0496106_0043927 3300048909 Bacteria 3354
389 Ga0496106_0405724 3300048909 Bacteria 1095
390 Ga0496106_1349827 3300048909 Unclassified 552
391 Ga0496107_0053229 3300048910 Bacteria 2920
392 Ga0496107_0254364 3300048910 Bacteria 1307
393 Ga0496107_0358081 3300048910 Bacteria 1086
394 Ga0496108_0000538 3300048911 Bacteria 29583
395 Ga0496108_0048824 3300048911 Bacteria 3539
396 Ga0496108_0126205 3300048911 Unclassified 2197
397 Ga0496108_0250866 3300048911 Bacteria 1539
398 Ga0496108_0380214 3300048911 Bacteria 1233
399 Ga0496108_0448847 3300048911 Bacteria 1127
400 Ga0496108_0665677 3300048911 Bacteria 904
401 Ga0496109_0000792 3300048912 Bacteria 26304
402 Ga0496109_0094416 3300048912 Bacteria 2768
403 Ga0496109_0176645 3300048912 Bacteria 2005
404 Ga0496109_0340110 3300048912 Bacteria 1417
405 Ga0496109_1153399 3300048912 Bacteria 712
406 Ga0496110_0001504 3300048913 Bacteria 16919
407 Ga0496110_0002263 3300048913 Bacteria 14373
408 Ga0496110_0040488 3300048913 Bacteria 4060
409 Ga0496110_0155701 3300048913 Unclassified 2070
410 Ga0496110_0274983 3300048913 Bacteria 1534
411 Ga0496110_1362319 3300048913 Unclassified 619
412 Ga0496110_1750125 3300048913 Bacteria 532
413 Ga0496111_0001871 3300048914 Bacteria 12438
414 Ga0496111_0002372 3300048914 Bacteria 11345
415 Ga0496111_0091271 3300048914 Bacteria 2232
416 Ga0496111_0098630 3300048914 Bacteria 2145
417 Ga0496111_0703217 3300048914 Archaea 735
418 Ga0496111_1193529 3300048914 Bacteria 539
419 Ga0496112_0004348 3300048915 Bacteria 11980
420 Ga0496112_0073088 3300048915 Bacteria 3390
421 Ga0496112_0162596 3300048915 Bacteria 2199
422 Ga0496112_0336311 3300048915 Bacteria 1453
423 Ga0496112_0879675 3300048915 Bacteria 818
424 Ga0496113_0002203 3300048916 Bacteria 11236
425 Ga0496113_0075063 3300048916 Bacteria 2580
426 Ga0496113_0171232 3300048916 Bacteria 1719
427 Ga0496114_0023866 3300048917 Bacteria 4991
428 Ga0496114_0054535 3300048917 Bacteria 3333
429 Ga0496114_0162103 3300048917 Bacteria 1945
430 Ga0496114_0837537 3300048917 Bacteria 800
431 Ga0496115_0016142 3300048918 Bacteria 5680
432 Ga0496115_0127971 3300048918 Bacteria 2092
433 Ga0496115_0648871 3300048918 Bacteria 834
434 Ga0501038_0386376 3300049574 Bacteria 1085
435 Ga0501039_0173543 3300049575 Bacteria 1695
436 Ga0501040_0038233 3300049576 Bacteria 3262
437 Ga0501041_0114936 3300049577 Bacteria 1671
438 Ga0501042_0237416 3300049578 Bacteria 1315
439 Ga0501042_1075867 3300049578 Unclassified 586
440 Ga0501046_0176317 3300049580 Bacteria 1601
441 Ga0501068_0188161 3300049584 Bacteria 1307
442 Ga0501070_0817851 3300049586 Bacteria 731
443 Ga0501071_0156926 3300049587 Bacteria 1699
444 Ga0501071_1327871 3300049587 Unclassified 555
445 Ga0501072_0060024 3300049588 Bacteria 2999
446 Ga0501074_0330843 3300049590 Bacteria 1081
447 Ga0501075_1326006 3300049591 Unclassified 545
448 Ga0501076_0098976 3300049592 Bacteria 2349
449 Ga0501077_1008793 3300049593 Unclassified 536
450 Ga0501249_055877 3300049679 Bacteria 911
451 Ga0501079_0023451 3300049741 Bacteria 4735
452 Ga0501079_0659646 3300049741 Bacteria 824
453 Ga0501080_0274791 3300049742 Bacteria 1533
454 Ga0501081_0040425 3300049743 Bacteria 3193
455 Ga0501275_039771 3300049772 Unclassified 655
456 Ga0501045_0173666 3300049824 Bacteria 1605
457 nmdc:mga00v17_192018_c1 3300050491 Archaea 1319
458 nmdc:mga0yw44_24476_c1 3300050492 Bacteria 3417
459 nmdc:mga05p37_1198022_c1 3300050507 Unclassified 785
460 nmdc:mga05p37_166165_c1 3300050507 Bacteria 2693
461 nmdc:mga05p37_42270_c1 3300050507 Bacteria 5599
462 nmdc:mga05p37_56926_c1 3300050507 Bacteria 4814
463 nmdc:mga05p37_75325_c1 3300050507 Bacteria 4154
464 nmdc:mga05p37_880489_c1 3300050507 Unclassified 968
465 nmdc:mga09592_253531_c1 3300050508 Bacteria 1525
466 nmdc:mga09592_951804_c1 3300050508 Bacteria 720
467 nmdc:mga0qj67_440344_c1 3300050509 Bacteria 1050
468 nmdc:mga0qj67_949974_c1 3300050509 Bacteria 676
469 nmdc:mga06r32_389990_c1 3300050510 Bacteria 1375
470 nmdc:mga06r32_69438_c1 3300050510 Bacteria 3405
471 nmdc:mga08y16_215090_c1 3300050511 Bacteria 1990
472 nmdc:mga08y16_242295_c1 3300050511 Bacteria 1864
473 nmdc:mga0n895_59897_c1 3300050512 Bacteria 3757
474 nmdc:mga0rr50_1480315_c1 3300050513 Bacteria 574
475 nmdc:mga0rr50_23401_c1 3300050513 Bacteria 4260
476 nmdc:mga08x19_1004287_c1 3300050514 Bacteria 593
477 nmdc:mga08x19_31888_c1 3300050514 Bacteria 3319
478 nmdc:mga08x19_624104_c1 3300050514 Bacteria 764
479 nmdc:mga08x19_74102_c1 3300050514 Bacteria 2224
480 nmdc:mga0a205_1160946_c1 3300050515 Bacteria 620
481 nmdc:mga0a205_1222324_c1 3300050515 Unclassified 599
482 nmdc:mga0a205_90836_c1 3300050515 Bacteria 2951
483 Ga0501084_0112370 3300054114 Bacteria 2289
484 Ga0501084_0593546 3300054114 Bacteria 936
485 Ga0501084_0707839 3300054114 Bacteria 849
486 Ga0501082_0109261 3300060353 Bacteria 2394
487 Ga0466962_0001195 3300061719 Bacteria 11922
488 Ga0070709_10812365
489 Ga0007409J51694_1072764
490 Ga0058862_12703249
491 Ga0070658_10121059
492 Ga0070683_100043917
493 Ga0070683_100071790
494 Ga0070683_100071800
495 Ga0070683_100940875
496 Ga0070690_100040176
497 Ga0070670_100099949
498 Ga0070670_101467158
499 Ga0070677_10199902
500 Ga0070680_100137313
501 Ga0070682_100023209
502 Ga0070682_100254629
503 Ga0068868_102059347
504 Ga0070660_101843615
505 Ga0070689_100167903
506 Ga0070692_10658081
507 Ga0070668_101413063
508 Ga0070671_100214390
509 Ga0070671_100835538
510 Ga0070671_101832331
511 Ga0070671_101985036
512 Ga0070674_101087081
513 Ga0070674_101257683
514 Ga0070673_100756896
515 Ga0070659_100219927
516 Ga0070709_10089033
517 Ga0070709_10534001
518 Ga0070714_100117573
519 Ga0070713_100085580
520 Ga0070713_100090855
521 Ga0070713_100108349
522 Ga0070713_100228392
523 Ga0070713_100294827
524 Ga0070713_101114031
525 Ga0070710_10027331
526 Ga0070710_10743267
527 Ga0070701_10106629
528 Ga0070711_100108455
529 Ga0070711_100429139
530 Ga0070711_100881357
531 Ga0070705_100093996
532 Ga0070705_100208320
533 Ga0070700_100636864
534 Ga0070700_100804098
535 Ga0070708_100178405
536 Ga0070708_101354828
537 Ga0070708_101965135
538 Ga0070663_100099107
539 Ga0070663_101408037
540 Ga0070678_100269019
541 Ga0070681_10556686
542 Ga0070681_11133319
543 Ga0070681_11869675
544 Ga0068867_100537007
545 Ga0070706_100521903
546 Ga0070706_101012859
547 Ga0070707_101331379
548 Ga0070707_101529197
549 Ga0070698_100176674
550 Ga0070698_100499715
551 Ga0070699_100380222
552 Ga0070679_100021712
553 Ga0070684_100014148
554 Ga0070684_100038164
555 Ga0070684_100088261
556 Ga0070684_101404174
557 Ga0070684_102170897
558 Ga0070697_101047118
559 Ga0068853_100288097
560 Ga0070672_100636617
561 Ga0070672_101868413
562 Ga0070686_100325880
563 Ga0070686_100344594
564 Ga0070696_100011666
565 Ga0070693_100221533
566 Ga0070693_100347713
567 Ga0070665_100896257
568 Ga0070704_100168994
569 Ga0070704_100211495
570 Ga0070704_100487393
571 Ga0070704_101051993
572 Ga0070704_101301964
573 Ga0068855_101422700
574 Ga0068857_100041720
575 Ga0068857_100748467
576 Ga0068857_101149510
577 Ga0068854_100429469
578 Ga0068856_100132493
579 Ga0068856_100200585
580 Ga0068856_100287366
581 Ga0070702_100942697
582 Ga0070702_101602634
583 Ga0068864_100027321
584 Ga0068864_102608929
585 Ga0068861_100284649
586 Ga0068851_10757090
587 Ga0068870_10098580
588 Ga0068870_10643631
589 Ga0068863_101592428
590 Ga0068858_101262231
591 Ga0070717_10017210
592 Ga0070717_10112473
593 Ga0070717_10473574
594 Ga0075365_10131602
595 Ga0075365_10891912
596 Ga0075432_10103944
597 Ga0070715_10027347
598 Ga0070716_100017680
599 Ga0070716_100188527
600 Ga0070716_100748791
601 Ga0070712_100060937
602 Ga0070712_100066043
603 Ga0097621_100164802
604 Ga0068871_100051439
605 Ga0075428_100042514
606 Ga0075428_100047490
607 Ga0075428_101099347
608 Ga0075428_101166741
609 Ga0075430_100421894
610 Ga0075430_101128735
611 Ga0075431_100077017
612 Ga0075431_100205574
613 Ga0075433_10144164
614 Ga0075433_11949453
615 Ga0075434_100038469
616 Ga0075429_100295629
617 Ga0075429_101287180
618 Ga0068865_100369919
619 Ga0075436_100067131
620 Ga0075436_100675933
621 Ga0075436_101042716
622 Ga0075436_101121930
623 Ga0075435_100011297
624 Ga0075435_101100891
625 Ga0111539_10122391
626 Ga0111539_11472660
627 Ga0111539_12287417
628 Ga0111539_12495307
629 Ga0105245_10206960
630 Ga0105245_10741912
631 Ga0105245_12907438
632 Ga0114129_10021907
633 Ga0114129_10111246
634 Ga0114129_10487663
635 Ga0114129_11130759
636 Ga0114129_11230874
637 Ga0114129_13000642
638 Ga0105243_10167170
639 Ga0105243_10917927
640 Ga0105243_12137789
641 Ga0105241_10026926
642 Ga0105242_10613640
643 Ga0105242_12356772
644 Ga0105248_10389668
645 Ga0105248_11843642
646 Ga0105237_12348666
647 Ga0105249_10480415
648 Ga0105249_10642171
649 Ga0105246_10161092
650 Ga0105246_10823204
651 Ga0157373_10318648
652 Ga0157371_10773478
653 Ga0157369_10456445
654 Ga0157374_10738575
655 Ga0157372_12030406
656 Ga0157375_10014889
657 Ga0157375_10366596
658 Ga0157375_11281946
659 Ga0157375_11866768
660 Ga0157375_12137909
661 Ga0163163_10015985
662 Ga0163163_11502285
663 Ga0182008_10026709
664 Ga0157377_10078614
665 Ga0157377_10168450
666 Ga0157376_10105930
667 Ga0157376_10691106
668 Ga0163161_11003375
669 Ga0206356_10330947
670 Ga0206352_10859059
671 Ga0207692_10300658
672 Ga0207688_10068936
673 Ga0207688_10437801
674 Ga0207680_10376484
675 Ga0207685_10397512
676 Ga0207699_10531895
677 Ga0207699_11423265
678 Ga0207654_10126209
679 Ga0207707_10238226
680 Ga0207671_11505073
681 Ga0207693_10028628
682 Ga0207693_10057503
683 Ga0207693_10057504
684 Ga0207663_10080379
685 Ga0207663_10141072
686 Ga0207649_11177626
687 Ga0207652_10372426
688 Ga0207646_10103164
689 Ga0207650_10234207
690 Ga0207687_11129812
691 Ga0207700_10070107
692 Ga0207700_10598035
693 Ga0207700_10943414
694 Ga0207664_10046135
695 Ga0207664_10091943
696 Ga0207664_10118465
697 Ga0207664_11751655
698 Ga0207644_10126274
699 Ga0207644_10749422
700 Ga0207690_10175309
701 Ga0207706_10716137
702 Ga0207706_11183016
703 Ga0207686_10540417
704 Ga0207686_11801494
705 Ga0207709_10085529
706 Ga0207709_10133151
707 Ga0207709_10437664
708 Ga0207670_10952191
709 Ga0207669_10723770
710 Ga0207704_10302962
711 Ga0207665_10001602
712 Ga0207665_10103695
713 Ga0207665_10732214
714 Ga0207691_10179197
715 Ga0207691_11221761
716 Ga0207711_11085097
717 Ga0207661_10026386
718 Ga0207661_10148041
719 Ga0207661_10319683
720 Ga0207679_11139841
721 Ga0207679_11384858
722 Ga0207667_10583932
723 Ga0207651_11252395
724 Ga0207712_10497721
725 Ga0207668_10874745
726 Ga0207677_10741519
727 Ga0207677_12198172
728 Ga0207703_11227417
729 Ga0207678_10057926
730 Ga0207702_10085530
731 Ga0207702_10414245
732 Ga0207702_10609783
733 Ga0207648_10105884
734 Ga0207648_11613367
735 Ga0207676_11529550
736 Ga0207674_10039919
737 Ga0207674_10172818
738 Ga0207675_100234587
739 Ga0207683_10000452
740 Ga0207683_11462130
741 Ga0209974_10441638
742 Ga0207428_10084137
743 Ga0207428_11104777
744 Ga0307405_10020310
745 Ga0307413_10014549
746 Ga0307413_10373995
747 Ga0307410_10030228
748 Ga0307406_10016778
749 Ga0307406_12026163
750 Ga0307407_10271912
751 Ga0307407_10283502
752 Ga0307412_10151635
753 Ga0307409_100018215
754 Ga0307409_100235512
755 Ga0307409_100284273
756 Ga0307409_100557127
757 Ga0307409_100584219
758 Ga0307409_100585062
759 Ga0307416_100009087
760 Ga0307416_100876946
761 Ga0307416_100989745
762 Ga0307414_10075512
763 Ga0307414_10909522
764 Ga0307411_10180039
765 Ga0307411_11402613
766 Ga0307415_100045012
767 Ga0307415_101227118
768 Ga0307415_101862273
769 Ga0373930_0089693
770 Ga0373938_0194077
771 Ga0373928_0029115
772 Ga0373949_0213959
773 Ga0373951_0047997
774 Ga0373952_0042512
775 Ga0373932_0125544
776 Ga0373960_0096343
777 Ga0373961_0138119
778 Ga0373931_0026692
779 Ga0373947_1092808
780 Ga0395899_0033351
781 Ga0395899_0035417
782 Ga0395899_0259101
783 Ga0395899_0728895
784 Ga0395900_0014778
785 Ga0395900_0064899
786 Ga0395900_0139883
787 Ga0395900_0420509
788 Ga0395898_0013364
789 Ga0395898_0014103
790 Ga0395898_0042240
791 Ga0395898_0457325
792 Ga0395898_1065432
793 Ga0395905_0154324
794 Ga0395905_0166076
795 Ga0395905_0357946
796 Ga0395905_1589824
797 Ga0395901_0015039
798 Ga0395901_0063805
799 Ga0395901_0105449
800 Ga0395901_0199970
801 Ga0395901_0518011
802 Ga0436365_0463357
803 Ga0439461_0037581
804 Ga0451802_1896121
805 Ga0451807_0486696
806 Ga0451835_0191747
807 Ga0451853_1600011
808 Ga0439445_0033300
809 Ga0439448_0072893
810 Ga0439455_0230056
811 Ga0450911_022289
812 Ga0450914_000928
813 Ga0450920_007597
814 Ga0450902_035424
815 Ga0450906_011216
816 Ga0439446_0016690
817 Ga0439458_0020199
818 Ga0450916_005897
819 Ga0466965_0028175
820 Ga0466966_0117382
821 Ga0466961_0052517
822 Ga0466963_0062132
823 Ga0466964_0053956
824 Ga0466971_0001469
825 Ga0466968_0045003
826 Ga0466970_0387287
827 Ga0466957_0013132
828 Ga0466959_0191224
829 Ga0451576_0063724
830 Ga0466958_0046211
831 Ga0466967_0615680
832 Ga0495584_0304332
833 Ga0495584_0647087
834 Ga0495596_0129607
835 Ga0495607_0432643
836 Ga0495630_0325452
837 Ga0495665_0236261
838 Ga0495609_0126672
839 Ga0495656_0587622
840 Ga0495656_0596446
841 Ga0495659_0099304
842 Ga0495659_0492301
843 Ga0495588_0448787
844 Ga0495658_0082605
845 Ga0495624_0655933
846 Ga0495670_0219393
847 Ga0495671_0335994
848 Ga0495581_0547687
849 Ga0495614_0205636
850 Ga0496100_0074846
851 Ga0496100_0130456
852 Ga0496100_0142546
853 Ga0496100_0993089
854 Ga0496101_0037620
855 Ga0496101_0156578
856 Ga0496101_0332649
857 Ga0496101_0869038
858 Ga0496102_0052827
859 Ga0496102_0183821
860 Ga0496102_0271649
861 Ga0496102_0353353
862 Ga0496102_0437324
863 Ga0496102_0457868
864 Ga0496102_0546023
865 Ga0496103_0009589
866 Ga0496103_0513199
867 Ga0496103_0598420
868 Ga0496104_0019882
869 Ga0496104_0139197
870 Ga0496104_0143517
871 Ga0496104_1025904
872 Ga0496105_0000861
873 Ga0496105_0017657
874 Ga0496105_0229610
875 Ga0496106_0043927
876 Ga0496106_0405724
877 Ga0496106_1349827
878 Ga0496107_0053229
879 Ga0496107_0254364
880 Ga0496107_0358081
881 Ga0496108_0000538
882 Ga0496108_0048824
883 Ga0496108_0126205
884 Ga0496108_0250866
885 Ga0496108_0380214
886 Ga0496108_0448847
887 Ga0496108_0665677
888 Ga0496109_0000792
889 Ga0496109_0094416
890 Ga0496109_0176645
891 Ga0496109_0340110
892 Ga0496109_1153399
893 Ga0496110_0001504
894 Ga0496110_0002263
895 Ga0496110_0040488
896 Ga0496110_0155701
897 Ga0496110_0274983
898 Ga0496110_1362319
899 Ga0496110_1750125
900 Ga0496111_0001871
901 Ga0496111_0002372
902 Ga0496111_0091271
903 Ga0496111_0098630
904 Ga0496111_0703217
905 Ga0496111_1193529
906 Ga0496112_0004348
907 Ga0496112_0073088
908 Ga0496112_0162596
909 Ga0496112_0336311
910 Ga0496112_0879675
911 Ga0496113_0002203
912 Ga0496113_0075063
913 Ga0496113_0171232
914 Ga0496114_0023866
915 Ga0496114_0054535
916 Ga0496114_0162103
917 Ga0496114_0837537
918 Ga0496115_0016142
919 Ga0496115_0127971
920 Ga0496115_0648871
921 Ga0501038_0386376
922 Ga0501039_0173543
923 Ga0501040_0038233
924 Ga0501041_0114936
925 Ga0501042_0237416
926 Ga0501042_1075867
927 Ga0501046_0176317
928 Ga0501068_0188161
929 Ga0501070_0817851
930 Ga0501071_0156926
931 Ga0501071_1327871
932 Ga0501072_0060024
933 Ga0501074_0330843
934 Ga0501075_1326006
935 Ga0501076_0098976
936 Ga0501077_1008793
937 Ga0501249_055877
938 Ga0501079_0023451
939 Ga0501079_0659646
940 Ga0501080_0274791
941 Ga0501081_0040425
942 Ga0501275_039771
943 Ga0501045_0173666
944 nmdc:mga00v17_192018_c1
945 nmdc:mga0yw44_24476_c1
946 nmdc:mga05p37_1198022_c1
947 nmdc:mga05p37_166165_c1
948 nmdc:mga05p37_42270_c1
949 nmdc:mga05p37_56926_c1
950 nmdc:mga05p37_75325_c1
951 nmdc:mga05p37_880489_c1
952 nmdc:mga09592_253531_c1
953 nmdc:mga09592_951804_c1
954 nmdc:mga0qj67_440344_c1
955 nmdc:mga0qj67_949974_c1
956 nmdc:mga06r32_389990_c1
957 nmdc:mga06r32_69438_c1
958 nmdc:mga08y16_215090_c1
959 nmdc:mga08y16_242295_c1
960 nmdc:mga0n895_59897_c1
961 nmdc:mga0rr50_1480315_c1
962 nmdc:mga0rr50_23401_c1
963 nmdc:mga08x19_1004287_c1
964 nmdc:mga08x19_31888_c1
965 nmdc:mga08x19_624104_c1
966 nmdc:mga08x19_74102_c1
967 nmdc:mga0a205_1160946_c1
968 nmdc:mga0a205_1222324_c1
969 nmdc:mga0a205_90836_c1
970 Ga0501084_0112370
971 Ga0501084_0593546
972 Ga0501084_0707839
973 Ga0501082_0109261
974 Ga0466962_0001195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wd6-assembly1.cif.gz_B crystal structure of jw1657 from escherichia coli 0.6875 1 89
3fgv-assembly1.cif.gz_B crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution 0.679 1 89
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.6534 2 94
1wd6-assembly1.cif.gz_B crystal structure of jw1657 from escherichia coli 0.6467 1 89
4zos-assembly1.cif.gz_C 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.6436 2 91
ID Description Score Start End Superfamily
af_P9WLA3_32_98_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7261 6 67 3.10.450.240
af_P9WLA3_28_227_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7184 2 90 3.30.70.100
af_Q86HP6_27_112_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.7068 4 69 3.30.310.50
af_M0R3X9_99_187_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.7053 1 69 3.30.310.50
1wd6B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6863 1 89 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A538KYB9-F1-model_v4 ABM domain-containing protein 0.9975 1 94
AF-A0A538JB63-F1-model_v4 ABM domain-containing protein 0.9942 1 94
AF-A0A538MF73-F1-model_v4 ABM domain-containing protein 0.9915 3 94
AF-A0A538KYB9-F1-model_v4 ABM domain-containing protein 0.9871 1 94
AF-A0A538JB63-F1-model_v4 ABM domain-containing protein 0.9837 1 94

Map