metagRoot

F453407

General Info

Members	Datasets	Scaffolds	Average Seq Length
487	260	485	304

Family's Representative Sequence

Representative Sequence	3300005364\|Ga0070673_100239467\|Ga0070673_1002394672
Length	362
Sequence	MGDGEGARLPHHRLTARRPRLGIATLPPAARLCLNRGMADRRLRVFHAVAKHLSFTKAAEALFMTQPAVTVQVRQLEEHFGTCLFDRTHGGRIALTPAGAVALDYAERILALSDELDTRLREAGNPVAGPLLIGASMTIGEYVLPQLIGEFKRRFPAVAPTLFVGNSEAVQERVAERTLDLGFIEGDSHLPSLAGEVCCEDELQVVCAPDHPLAREVFVLPSALARHAYVGREPGSGTRAVIDRYLQDAAVAPDSLDTVVELGSPEALKGLVATGLAFAIMSRAVVAKELQLGRLVRVPLRPPLLRNFSVVQPKERFRSKLVVGFVAFAKERLATMQAAGGGTGIGTSSPTPPALRAVAGAR

Samples

	Sample ID	Description	Type	Environment
1	2526164512	Azovibrio restrictus DSM 23866	Isolate	Unclassified
2	2547132512	Azospira oryzae 6a3	Isolate	Unclassified
3	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
4	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
5	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
6	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
7	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
8	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
9	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
10	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
11	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
12	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
13	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
14	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
15	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
16	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
17	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
18	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
19	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
20	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
21	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
22	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
23	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
24	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
25	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
26	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
27	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
28	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
29	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
30	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
31	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
32	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
33	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
34	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
35	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
36	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
37	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
38	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
39	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
40	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
41	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
42	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
43	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
44	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
45	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
46	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
47	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
48	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
49	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
50	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
53	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
54	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
55	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
56	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
57	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
58	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
59	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
60	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
61	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
62	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
63	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
64	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
65	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
66	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
67	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
68	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
69	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
70	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
72	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
73	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
74	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
75	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
76	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
77	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
78	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
79	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
81	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
82	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
84	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
86	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
87	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
88	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
89	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
90	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
91	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
92	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
93	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
94	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
95	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
96	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
97	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
98	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
99	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
100	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
158	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
162	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
163	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
164	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
165	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
166	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
167	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
168	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
169	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
170	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
171	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
172	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
173	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
174	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
175	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
176	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
177	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
178	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
179	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
180	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
181	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
182	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
183	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
184	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
185	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
186	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
187	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
188	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
189	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
190	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
191	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
192	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
193	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
194	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
195	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
196	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
197	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
198	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
199	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
200	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
201	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
202	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
203	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
204	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
205	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
206	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
207	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
208	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
209	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
210	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
211	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
212	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
213	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
214	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
215	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
216	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
217	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
218	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
219	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
220	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
221	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
222	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
224	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
226	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
227	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
228	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
229	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
230	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
231	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
232	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
233	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
235	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
236	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
237	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
238	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
239	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
240	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
241	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
242	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
243	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
244	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
245	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
246	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
248	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
249	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
250	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
251	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
252	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
253	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
254	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
255	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
256	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
257	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
258	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
259	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
260	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.59
Metatranscriptomes	0
Isolates	0.41

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.41
Nodule	0
Rhizoplane	0.21
Rhizosphere	98.97
Stem	0
Stem Tuber	0
Unclassified	0.41

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10017692	3300003203	Bacteria	2941
2	Ga0065707_10008289	3300005295	Bacteria	2613
3	Ga0070676_10194992	3300005328	Unclassified	1324
4	Ga0070690_100000203	3300005330	Bacteria	31114
5	Ga0070690_100212703	3300005330	Bacteria	1351
6	Ga0070670_100007866	3300005331	Bacteria	9069
7	Ga0070670_100063900	3300005331	Bacteria	3158
8	Ga0068869_100001312	3300005334	Bacteria	14728
9	Ga0068869_100043755	3300005334	Bacteria	3218
10	Ga0070666_10028686	3300005335	Bacteria	3654
11	Ga0070666_10236354	3300005335	Bacteria	1291
12	Ga0070680_100003010	3300005336	Bacteria	12517
13	Ga0070680_100141795	3300005336	Bacteria	2016
14	Ga0070680_100143382	3300005336	Bacteria	2003
15	Ga0070682_100013141	3300005337	Bacteria	4756
16	Ga0068868_100003713	3300005338	Bacteria	10662
17	Ga0068868_100274829	3300005338	Unclassified	1424
18	Ga0070689_100005620	3300005340	Bacteria	8583
19	Ga0070689_100226943	3300005340	Bacteria	1534
20	Ga0070691_10000424	3300005341	Bacteria	15512
21	Ga0070691_10033159	3300005341	Bacteria	2429
22	Ga0070687_100000070	3300005343	Bacteria	33041
23	Ga0070661_100026803	3300005344	Bacteria	4147
24	Ga0070661_100116547	3300005344	Bacteria	1998
25	Ga0070661_100179521	3300005344	Bacteria	1610
26	Ga0070692_10001698	3300005345	Bacteria	8171
27	Ga0070692_10003622	3300005345	Bacteria	6306
28	Ga0070668_100278125	3300005347	Bacteria	1397
29	Ga0070669_100068469	3300005353	Bacteria	2620
30	Ga0070675_100033256	3300005354	Bacteria	4180
31	Ga0070675_100126187	3300005354	Bacteria	2177
32	Ga0070671_100043583	3300005355	Bacteria	3728
33	Ga0070671_100078365	3300005355	Bacteria	2762
34	Ga0070671_100403641	3300005355	Unclassified	1169
35	Ga0070674_100087180	3300005356	Bacteria	2244
36	Ga0070673_100052377	3300005364	Bacteria	3202
37	Ga0070673_100239467	3300005364	Bacteria	1577
38	Ga0070688_100025480	3300005365	Bacteria	3502
39	Ga0070688_100076932	3300005365	Bacteria	2149
40	Ga0070659_100096916	3300005366	Bacteria	2370
41	Ga0070667_100563395	3300005367	Bacteria	1048
42	Ga0070703_10002578	3300005406	Bacteria	5225
43	Ga0070709_10007448	3300005434	Bacteria	5999
44	Ga0070714_100065960	3300005435	Bacteria	3119
45	Ga0070714_100320941	3300005435	Bacteria	1448
46	Ga0070713_100072201	3300005436	Bacteria	2919
47	Ga0070701_10000661	3300005438	Bacteria	12109
48	Ga0070711_100030060	3300005439	Bacteria	3592
49	Ga0070705_100001132	3300005440	Bacteria	14728
50	Ga0070705_100030223	3300005440	Bacteria	2988
51	Ga0070705_100143495	3300005440	Bacteria	1575
52	Ga0070700_100000651	3300005441	Bacteria	17154
53	Ga0070694_100000669	3300005444	Bacteria	18977
54	Ga0070694_100003420	3300005444	Bacteria	9515
55	Ga0070694_100420336	3300005444	Bacteria	1050
56	Ga0070678_100031143	3300005456	Bacteria	3675
57	Ga0070681_10156921	3300005458	Bacteria	2200
58	Ga0070681_10288604	3300005458	Bacteria	1551
59	Ga0068867_100002241	3300005459	Bacteria	13590
60	Ga0068867_100092369	3300005459	Unclassified	2298
61	Ga0068867_100098804	3300005459	Bacteria	2226
62	Ga0068867_100242195	3300005459	Bacteria	1463
63	Ga0070707_100127410	3300005468	Bacteria	2474
64	Ga0070698_100003383	3300005471	Bacteria	17547
65	Ga0070698_100091784	3300005471	Bacteria	3019
66	Ga0070699_100034673	3300005518	Bacteria	4362
67	Ga0070699_100144970	3300005518	Bacteria	2098
68	Ga0070679_100006007	3300005530	Bacteria	11299
69	Ga0068853_100130628	3300005539	Unclassified	2248
70	Ga0070672_100039185	3300005543	Bacteria	3628
71	Ga0070686_100002595	3300005544	Bacteria	9973
72	Ga0070695_100000808	3300005545	Bacteria	16831
73	Ga0070695_100026900	3300005545	Bacteria	3561
74	Ga0070696_100000441	3300005546	Bacteria	25931
75	Ga0070696_100008651	3300005546	Bacteria	6809
76	Ga0070696_100085603	3300005546	Bacteria	2237
77	Ga0070696_100101461	3300005546	Bacteria	2062
78	Ga0070693_100000574	3300005547	Bacteria	16325
79	Ga0070665_100052961	3300005548	Bacteria	4070
80	Ga0070704_100000617	3300005549	Bacteria	17151
81	Ga0070704_100029861	3300005549	Bacteria	3645
82	Ga0070704_100044499	3300005549	Bacteria	3085
83	Ga0070704_100231645	3300005549	Bacteria	1507
84	Ga0068855_100010150	3300005563	Bacteria	11350
85	Ga0068855_100343635	3300005563	Bacteria	1645
86	Ga0068855_100365270	3300005563	Unclassified	1588
87	Ga0070664_100176117	3300005564	Bacteria	1899
88	Ga0068857_100472591	3300005577	Unclassified	1174
89	Ga0068854_100002203	3300005578	Bacteria	11988
90	Ga0068854_100082968	3300005578	Bacteria	2369
91	Ga0068854_100382541	3300005578	Bacteria	1160
92	Ga0068856_100031347	3300005614	Bacteria	5201
93	Ga0070702_100000349	3300005615	Bacteria	16123
94	Ga0068852_100094405	3300005616	Bacteria	2683
95	Ga0068852_100125630	3300005616	Bacteria	2355
96	Ga0068859_100003478	3300005617	Bacteria	16024
97	Ga0068859_100042890	3300005617	Bacteria	4545
98	Ga0068859_100068130	3300005617	Bacteria	3594
99	Ga0068859_100232341	3300005617	Bacteria	1932
100	Ga0068864_100006249	3300005618	Bacteria	9771
101	Ga0068864_100045551	3300005618	Bacteria	3762
102	Ga0068864_100190952	3300005618	Unclassified	1878
103	Ga0068864_100223158	3300005618	Unclassified	1739
104	Ga0068864_100283105	3300005618	Bacteria	1548
105	Ga0068864_100380456	3300005618	Unclassified	1337
106	Ga0068866_10000640	3300005718	Bacteria	15843
107	Ga0068861_100000246	3300005719	Bacteria	29867
108	Ga0068851_10022908	3300005834	Bacteria	3048
109	Ga0068870_10063856	3300005840	Unclassified	1987
110	Ga0068863_100014294	3300005841	Bacteria	7645
111	Ga0068863_100301902	3300005841	Unclassified	1553
112	Ga0068858_100005536	3300005842	Bacteria	12365
113	Ga0068858_100031795	3300005842	Bacteria	4905
114	Ga0068858_100055826	3300005842	Bacteria	3651
115	Ga0068860_100004427	3300005843	Bacteria	14341
116	Ga0068860_100014566	3300005843	Bacteria	7694
117	Ga0068860_100088152	3300005843	Bacteria	2954
118	Ga0068860_100182729	3300005843	Bacteria	2027
119	Ga0068860_100197309	3300005843	Bacteria	1950
120	Ga0068860_100212556	3300005843	Unclassified	1876
121	Ga0068862_100000668	3300005844	Bacteria	35204
122	Ga0068862_100097090	3300005844	Bacteria	2572
123	Ga0081539_10000668	3300005985	Bacteria	68754
124	Ga0081539_10021097	3300005985	Bacteria	4368
125	Ga0075366_10000351	3300006195	Bacteria	21079
126	Ga0097621_100001417	3300006237	Bacteria	16484
127	Ga0097621_100010313	3300006237	Bacteria	6829
128	Ga0097621_100168044	3300006237	Bacteria	1889
129	Ga0068871_100001297	3300006358	Bacteria	16703
130	Ga0068871_100157755	3300006358	Bacteria	1939
131	Ga0068871_100179331	3300006358	Bacteria	1820
132	Ga0075428_100000591	3300006844	Bacteria	37069
133	Ga0075428_100037697	3300006844	Bacteria	5320
134	Ga0075428_100138906	3300006844	Bacteria	2642
135	Ga0075428_100259433	3300006844	Bacteria	1872
136	Ga0075430_100002128	3300006846	Bacteria	16396
137	Ga0075430_100006493	3300006846	Bacteria	9860
138	Ga0075430_100025942	3300006846	Bacteria	4987
139	Ga0075430_100143196	3300006846	Bacteria	1991
140	Ga0075430_100259278	3300006846	Bacteria	1440
141	Ga0075431_100032745	3300006847	Bacteria	5357
142	Ga0075431_100034965	3300006847	Bacteria	5176
143	Ga0075431_100045415	3300006847	Bacteria	4529
144	Ga0075431_100104338	3300006847	Bacteria	2925
145	Ga0075434_100000078	3300006871	Bacteria	52232
146	Ga0075434_100005507	3300006871	Bacteria	11531
147	Ga0075429_100000758	3300006880	Bacteria	25393
148	Ga0075429_100006944	3300006880	Bacteria	9838
149	Ga0075429_100443522	3300006880	Bacteria	1137
150	Ga0068865_100001575	3300006881	Bacteria	13328
151	Ga0068865_100038662	3300006881	Bacteria	3231
152	Ga0075436_100000956	3300006914	Bacteria	19354
153	Ga0075436_100012897	3300006914	Bacteria	5731
154	Ga0075436_100015316	3300006914	Bacteria	5253
155	Ga0075436_100017350	3300006914	Bacteria	4928
156	Ga0075436_100019559	3300006914	Bacteria	4640
157	Ga0075436_100195709	3300006914	Bacteria	1431
158	Ga0075436_100220232	3300006914	Bacteria	1347
159	Ga0097620_100003478	3300006931	Bacteria	16024
160	Ga0097620_100042886	3300006931	Bacteria	4545
161	Ga0097620_100068131	3300006931	Bacteria	3594
162	Ga0097620_100232336	3300006931	Bacteria	1932
163	Ga0075435_100001714	3300007076	Bacteria	14245
164	Ga0075435_100005065	3300007076	Bacteria	9160
165	Ga0105240_10027909	3300009093	Bacteria	7384
166	Ga0111539_10009997	3300009094	Bacteria	11957
167	Ga0111539_10013658	3300009094	Bacteria	10144
168	Ga0111539_10058589	3300009094	Bacteria	4569
169	Ga0111539_10125896	3300009094	Bacteria	3002
170	Ga0105245_10003710	3300009098	Bacteria	13618
171	Ga0105245_10200257	3300009098	Bacteria	1917
172	Ga0114129_10036857	3300009147	Bacteria	6905
173	Ga0114129_10273786	3300009147	Bacteria	2258
174	Ga0114129_10544490	3300009147	Bacteria	1510
175	Ga0105243_10001954	3300009148	Bacteria	17554
176	Ga0105243_10137696	3300009148	Bacteria	2079
177	Ga0105242_10002505	3300009176	Bacteria	14406
178	Ga0105242_10076182	3300009176	Bacteria	2796
179	Ga0105248_10037229	3300009177	Bacteria	5443
180	Ga0105248_10103561	3300009177	Bacteria	3208
181	Ga0105249_10014390	3300009553	Bacteria	6996
182	Ga0105249_10042114	3300009553	Bacteria	4152
183	Ga0105249_10393117	3300009553	Bacteria	1415
184	Ga0105249_10427158	3300009553	Bacteria	1360
185	Ga0105239_10013511	3300010375	Bacteria	9065
186	Ga0157373_10189127	3300013100	Bacteria	1451
187	Ga0157370_10017912	3300013104	Bacteria	7134
188	Ga0157374_10163767	3300013296	Bacteria	2167
189	Ga0157378_10001142	3300013297	Bacteria	24153
190	Ga0157378_10046671	3300013297	Bacteria	3850
191	Ga0163162_10048851	3300013306	Bacteria	4240
192	Ga0163162_10120133	3300013306	Bacteria	2731
193	Ga0163162_10126417	3300013306	Bacteria	2663
194	Ga0163162_10759799	3300013306	Unclassified	1088
195	Ga0157372_10010149	3300013307	Bacteria	10001
196	Ga0157375_10009737	3300013308	Bacteria	8448
197	Ga0157380_10024772	3300014326	Bacteria	4545
198	Ga0157380_10050716	3300014326	Bacteria	3279
199	Ga0157379_10045197	3300014968	Bacteria	3932
200	Ga0157379_10069942	3300014968	Bacteria	3140
201	Ga0157376_10003476	3300014969	Bacteria	10858
202	Ga0157376_10323920	3300014969	Bacteria	1466
203	Ga0207692_10032540	3300025898	Bacteria	2507
204	Ga0207642_10004895	3300025899	Bacteria	4339
205	Ga0207680_10052801	3300025903	Bacteria	2437
206	Ga0207647_10118085	3300025904	Unclassified	1565
207	Ga0207699_10099461	3300025906	Bacteria	1842
208	Ga0207645_10032433	3300025907	Bacteria	3357
209	Ga0207645_10049171	3300025907	Bacteria	2693
210	Ga0207643_10054464	3300025908	Bacteria	2274
211	Ga0207654_10135412	3300025911	Bacteria	1564
212	Ga0207707_10020579	3300025912	Bacteria	5763
213	Ga0207707_10291676	3300025912	Bacteria	1411
214	Ga0207663_10064957	3300025916	Bacteria	2331
215	Ga0207660_10003216	3300025917	Bacteria	10688
216	Ga0207660_10059585	3300025917	Bacteria	2741
217	Ga0207660_10203988	3300025917	Bacteria	1545
218	Ga0207660_10228371	3300025917	Bacteria	1463
219	Ga0207662_10000088	3300025918	Bacteria	43438
220	Ga0207652_10007461	3300025921	Bacteria	8817
221	Ga0207652_10383388	3300025921	Bacteria	1268
222	Ga0207646_10460192	3300025922	Bacteria	1147
223	Ga0207681_10080139	3300025923	Bacteria	2302
224	Ga0207650_10009964	3300025925	Bacteria	6504
225	Ga0207650_10055001	3300025925	Bacteria	2953
226	Ga0207650_10114086	3300025925	Bacteria	2095
227	Ga0207659_10031894	3300025926	Bacteria	3611
228	Ga0207659_10059492	3300025926	Bacteria	2747
229	Ga0207659_10100622	3300025926	Unclassified	2178
230	Ga0207687_10014600	3300025927	Bacteria	5142
231	Ga0207700_10076773	3300025928	Unclassified	2593
232	Ga0207664_10058149	3300025929	Bacteria	3075
233	Ga0207664_10216367	3300025929	Unclassified	1660
234	Ga0207644_10068398	3300025931	Bacteria	2591
235	Ga0207686_10000543	3300025934	Bacteria	24408
236	Ga0207709_10003149	3300025935	Bacteria	9916
237	Ga0207670_10014768	3300025936	Bacteria	4647
238	Ga0207670_10166137	3300025936	Bacteria	1651
239	Ga0207670_10478237	3300025936	Bacteria	1008
240	Ga0207669_10112702	3300025937	Unclassified	1827
241	Ga0207704_10003526	3300025938	Bacteria	7121
242	Ga0207704_10052399	3300025938	Bacteria	2474
243	Ga0207665_10097020	3300025939	Bacteria	2051
244	Ga0207691_10000717	3300025940	Bacteria	32709
245	Ga0207691_10006790	3300025940	Bacteria	11034
246	Ga0207691_10114510	3300025940	Bacteria	2396
247	Ga0207691_10198116	3300025940	Bacteria	1749
248	Ga0207711_10161610	3300025941	Unclassified	2028
249	Ga0207689_10002986	3300025942	Bacteria	15609
250	Ga0207689_10057678	3300025942	Bacteria	3194
251	Ga0207661_10206662	3300025944	Bacteria	1729
252	Ga0207679_10041893	3300025945	Bacteria	3287
253	Ga0207679_10363498	3300025945	Unclassified	1264
254	Ga0207667_10011779	3300025949	Bacteria	10133
255	Ga0207667_10337840	3300025949	Unclassified	1537
256	Ga0207651_10090961	3300025960	Bacteria	2233
257	Ga0207651_10093728	3300025960	Bacteria	2206
258	Ga0207651_10236057	3300025960	Bacteria	1488
259	Ga0207712_10055403	3300025961	Bacteria	2789
260	Ga0207712_10257949	3300025961	Bacteria	1412
261	Ga0207668_10022385	3300025972	Bacteria	4045
262	Ga0207668_10403057	3300025972	Unclassified	1157
263	Ga0207640_10004993	3300025981	Bacteria	7212
264	Ga0207658_10014857	3300025986	Bacteria	5335
265	Ga0207658_10058926	3300025986	Bacteria	2860
266	Ga0207677_10003201	3300026023	Bacteria	8633
267	Ga0207677_10264569	3300026023	Unclassified	1403
268	Ga0207703_10003517	3300026035	Bacteria	13105
269	Ga0207703_10297497	3300026035	Bacteria	1471
270	Ga0207639_10064392	3300026041	Bacteria	2842
271	Ga0207708_10000326	3300026075	Bacteria	37674
272	Ga0207708_10309139	3300026075	Bacteria	1287
273	Ga0207702_10027494	3300026078	Bacteria	4724
274	Ga0207641_10028127	3300026088	Bacteria	4643
275	Ga0207641_10038614	3300026088	Bacteria	3992
276	Ga0207641_10125157	3300026088	Bacteria	2300
277	Ga0207648_10000071	3300026089	Bacteria	95176
278	Ga0207676_10001540	3300026095	Bacteria	17017
279	Ga0207676_10408939	3300026095	Unclassified	1270
280	Ga0207675_100000040	3300026118	Bacteria	91299
281	Ga0207675_100027980	3300026118	Bacteria	5249
282	Ga0207683_10026818	3300026121	Bacteria	4977
283	Ga0207683_10235338	3300026121	Bacteria	1670
284	Ga0207698_10088153	3300026142	Bacteria	2530
285	Ga0209969_1007026	3300027360	Bacteria	1589
286	Ga0209967_1002295	3300027364	Bacteria	2479
287	Ga0210000_1000649	3300027462	Bacteria	4801
288	Ga0210000_1005345	3300027462	Bacteria	1863
289	Ga0209970_1004597	3300027614	Bacteria	2288
290	Ga0209983_1009734	3300027665	Bacteria	1965
291	Ga0209971_1003083	3300027682	Bacteria	3978
292	Ga0209971_1008196	3300027682	Bacteria	2479
293	Ga0209966_1002847	3300027695	Bacteria	2902
294	Ga0209966_1004189	3300027695	Unclassified	2440
295	Ga0209974_10006065	3300027876	Bacteria	4230
296	Ga0207428_10003555	3300027907	Bacteria	15064
297	Ga0207428_10007867	3300027907	Bacteria	9695
298	Ga0207428_10116642	3300027907	Bacteria	2050
299	Ga0268266_10137590	3300028379	Bacteria	2189
300	Ga0268265_10007368	3300028380	Bacteria	7429
301	Ga0268265_10022745	3300028380	Bacteria	4409
302	Ga0268265_10152953	3300028380	Unclassified	1948
303	Ga0268264_10000527	3300028381	Bacteria	48430
304	Ga0268264_10184220	3300028381	Bacteria	1899
305	Ga0268264_10303844	3300028381	Bacteria	1503
306	Ga0265332_10000100	3300031238	Bacteria	74633
307	Ga0265325_10001009	3300031241	Bacteria	20268
308	Ga0307408_100044132	3300031548	Bacteria	3176
309	Ga0307408_100123123	3300031548	Bacteria	2012
310	Ga0307408_100246470	3300031548	Bacteria	1471
311	Ga0307408_100270172	3300031548	Bacteria	1411
312	Ga0316575_10010597	3300031665	Bacteria	3393
313	Ga0307405_10042185	3300031731	Bacteria	2776
314	Ga0307410_10027952	3300031852	Bacteria	3571
315	Ga0307409_100290608	3300031995	Bacteria	1516
316	Ga0307416_100162184	3300032002	Bacteria	2068
317	Ga0307414_10102981	3300032004	Bacteria	2153
318	Ga0307411_10173205	3300032005	Bacteria	1630
319	Ga0373926_0000873	3300035083	Bacteria	8629
320	Ga0373929_0022357	3300035085	Bacteria	1290
321	Ga0373944_0002284	3300035089	Bacteria	4875
322	Ga0373951_0029675	3300035091	Unclassified	1285
323	Ga0373932_0001399	3300035112	Bacteria	6767
324	Ga0373936_0003827	3300035113	Bacteria	5666
325	Ga0373939_0048557	3300035114	Bacteria	1308
326	Ga0373945_0007903	3300035116	Bacteria	3452
327	Ga0373956_0000003	3300035119	Bacteria	81669
328	Ga0373943_0000584	3300035170	Bacteria	15774
329	Ga0373943_0001182	3300035170	Bacteria	11660
330	Ga0373946_0004732	3300035171	Bacteria	4891
331	Ga0373946_0053775	3300035171	Bacteria	1692
332	Ga0373955_0006439	3300035172	Bacteria	5348
333	Ga0373942_0051598	3300035207	Bacteria	1155
334	Ga0373961_0049761	3300035241	Bacteria	1240
335	Ga0316574_0004964	3300035398	Bacteria	7050
336	Ga0373924_0046301	3300035410	Bacteria	1791
337	Ga0373931_0001098	3300035691	Bacteria	11487
338	Ga0373931_0003090	3300035691	Bacteria	7446
339	Ga0373931_0177201	3300035691	Bacteria	1260
340	Ga0373935_0001505	3300035692	Bacteria	12946
341	Ga0373935_0005854	3300035692	Bacteria	7281
342	Ga0373927_0009907	3300035695	Bacteria	6388
343	Ga0373927_0106632	3300035695	Bacteria	1824
344	Ga0373933_0005782	3300035724	Bacteria	6726
345	Ga0373947_0002482	3300035725	Bacteria	11092
346	Ga0373947_0010627	3300035725	Bacteria	5281
347	Ga0373947_0195854	3300035725	Unclassified	1320
348	Ga0373937_0000196	3300036401	Bacteria	59256
349	Ga0373937_0088510	3300036401	Bacteria	2867
350	Ga0373937_0093153	3300036401	Bacteria	2793
351	Ga0373937_0217716	3300036401	Bacteria	1797
352	Ga0316582_0095090	3300036647	Unclassified	1966
353	Ga0373925_0006465	3300037068	Bacteria	8620
354	Ga0373925_0018613	3300037068	Bacteria	5050
355	Ga0439441_011263	3300042001	Bacteria	1514
356	Ga0439446_0000856	3300042156	Bacteria	6520
357	Ga0439434_0018722	3300042435	Bacteria	2074
358	Ga0439435_0000004	3300042436	Bacteria	26852
359	Ga0439435_0000023	3300042436	Bacteria	16449
360	Ga0439435_0003387	3300042436	Bacteria	3313
361	Ga0439435_0042862	3300042436	Bacteria	1271
362	Ga0439444_0002891	3300042437	Bacteria	2388
363	Ga0439444_0003422	3300042437	Bacteria	2242
364	Ga0439460_0000235	3300042461	Bacteria	11229
365	Ga0439460_0052751	3300042461	Bacteria	1223
366	Ga0451577_0090389	3300042876	Bacteria	2733
367	Ga0451576_0000812	3300045051	Bacteria	61182
368	Ga0451576_0003049	3300045051	Bacteria	23602
369	Ga0451576_0017751	3300045051	Bacteria	7819
370	Ga0451576_0033061	3300045051	Bacteria	5499
371	Ga0466958_0063351	3300045836	Bacteria	2255
372	Ga0466967_0134064	3300045976	Bacteria	2302
373	Ga0495603_0006975	3300046455	Bacteria	6777
374	Ga0495651_0004749	3300046462	Bacteria	10399
375	Ga0495580_0016385	3300046472	Bacteria	5562
376	Ga0495639_0004241	3300046475	Bacteria	6152
377	Ga0495594_0213938	3300046499	Bacteria	1099
378	Ga0495666_0020290	3300046526	Bacteria	3294
379	Ga0495586_0154656	3300046535	Bacteria	1291
380	Ga0495621_0019434	3300046539	Bacteria	2219
381	Ga0495621_0106489	3300046539	Bacteria	1072
382	Ga0495656_0089234	3300046615	Bacteria	1407
383	Ga0495588_0091551	3300046674	Bacteria	1593
384	Ga0495647_0001142	3300046681	Bacteria	8146
385	Ga0495658_0229228	3300046683	Bacteria	1164
386	Ga0495669_0016197	3300046684	Bacteria	3192
387	Ga0495636_0064728	3300047318	Bacteria	1552
388	Ga0495676_0046054	3300047321	Bacteria	3545
389	Ga0495680_0233925	3300047322	Bacteria	1307
390	Ga0496112_0043654	3300048915	Bacteria	4390
391	Ga0501031_0075593	3300049568	Bacteria	2193
392	Ga0501033_0280586	3300049570	Bacteria	1176
393	Ga0501036_0025737	3300049572	Bacteria	4966
394	Ga0501036_0124197	3300049572	Bacteria	2180
395	Ga0501036_0345821	3300049572	Bacteria	1242
396	Ga0501037_0239812	3300049573	Bacteria	1271
397	Ga0501038_0100785	3300049574	Bacteria	2405
398	Ga0501039_0009254	3300049575	Bacteria	7505
399	Ga0501039_0160276	3300049575	Bacteria	1768
400	Ga0501039_0296172	3300049575	Bacteria	1272
401	Ga0501040_0167054	3300049576	Bacteria	1557
402	Ga0501040_0266408	3300049576	Bacteria	1223
403	Ga0501041_0003184	3300049577	Bacteria	9437
404	Ga0501041_0005794	3300049577	Bacteria	7220
405	Ga0501041_0058572	3300049577	Bacteria	2357
406	Ga0501042_0075126	3300049578	Bacteria	2418
407	Ga0501042_0196760	3300049578	Bacteria	1454
408	Ga0501042_0379585	3300049578	Bacteria	1023
409	Ga0501046_0088647	3300049580	Bacteria	2382
410	Ga0501046_0367717	3300049580	Bacteria	1042
411	Ga0501048_0007566	3300049582	Bacteria	8235
412	Ga0501048_0097087	3300049582	Bacteria	2079
413	Ga0501068_0018113	3300049584	Bacteria	4077
414	Ga0501071_0042155	3300049587	Bacteria	3269
415	Ga0501071_0066887	3300049587	Bacteria	2613
416	Ga0501071_0154141	3300049587	Bacteria	1715
417	Ga0501071_0175442	3300049587	Bacteria	1605
418	Ga0501072_0006904	3300049588	Bacteria	8620
419	Ga0501072_0031443	3300049588	Bacteria	4156
420	Ga0501072_0092486	3300049588	Bacteria	2402
421	Ga0501072_0219290	3300049588	Bacteria	1516
422	Ga0501073_0087455	3300049589	Bacteria	2167
423	Ga0501074_0047071	3300049590	Bacteria	3118
424	Ga0501075_0012964	3300049591	Bacteria	5939
425	Ga0501075_0081496	3300049591	Bacteria	2450
426	Ga0501075_0116113	3300049591	Bacteria	2035
427	Ga0501076_0015151	3300049592	Bacteria	5821
428	Ga0501076_0093854	3300049592	Bacteria	2415
429	Ga0501077_0011299	3300049593	Bacteria	5576
430	Ga0501079_0095441	3300049741	Bacteria	2304
431	Ga0501079_0260356	3300049741	Bacteria	1356
432	Ga0501080_0006525	3300049742	Bacteria	10481
433	Ga0501080_0102203	3300049742	Bacteria	2659
434	Ga0501081_0005928	3300049743	Bacteria	7909
435	Ga0501081_0144568	3300049743	Bacteria	1706
436	Ga0501081_0162736	3300049743	Bacteria	1608
437	Ga0501083_0150642	3300049744	Bacteria	1523
438	Ga0501035_0213794	3300049822	Bacteria	1649
439	Ga0501045_0015834	3300049824	Bacteria	5348
440	Ga0501045_0056064	3300049824	Bacteria	2882
441	Ga0501045_0163267	3300049824	Bacteria	1658
442	Ga0501045_0312667	3300049824	Bacteria	1169
443	nmdc:mga0k408_43_c1	3300050493	Bacteria	51763
444	nmdc:mga05p37_106851_c1	3300050507	Bacteria	3444
445	nmdc:mga05p37_3265_c1	3300050507	Bacteria	18893
446	nmdc:mga09592_114167_c1	3300050508	Bacteria	2318
447	nmdc:mga09592_19136_c1	3300050508	Bacteria	5619
448	nmdc:mga09592_298_c1	3300050508	Bacteria	36073
449	nmdc:mga09592_5555_c1	3300050508	Bacteria	10263
450	nmdc:mga09592_55815_c1	3300050508	Bacteria	3338
451	nmdc:mga0qj67_126810_c1	3300050509	Bacteria	2065
452	nmdc:mga0qj67_264489_c1	3300050509	Bacteria	1395
453	nmdc:mga0qj67_2983_c1	3300050509	Bacteria	12145
454	nmdc:mga0qj67_7066_c1	3300050509	Bacteria	8284
455	nmdc:mga0qj67_87830_c1	3300050509	Bacteria	2496
456	nmdc:mga06r32_28795_c1	3300050510	Bacteria	5200
457	nmdc:mga06r32_3461_c1	3300050510	Bacteria	14094
458	nmdc:mga06r32_37440_c1	3300050510	Bacteria	4588
459	nmdc:mga06r32_413629_c1	3300050510	Bacteria	1330
460	nmdc:mga06r32_98883_c1	3300050510	Bacteria	2861
461	nmdc:mga08y16_21638_c1	3300050511	Bacteria	6790
462	nmdc:mga08y16_45641_c1	3300050511	Bacteria	4590
463	nmdc:mga08y16_65413_c1	3300050511	Bacteria	3796
464	nmdc:mga08y16_672017_c1	3300050511	Bacteria	1038
465	nmdc:mga08y16_8048_c1	3300050511	Bacteria	11032
466	nmdc:mga0n895_14651_c1	3300050512	Bacteria	7131
467	nmdc:mga0n895_307652_c1	3300050512	Bacteria	1606
468	nmdc:mga0n895_5640_c1	3300050512	Bacteria	10489
469	nmdc:mga0rr50_22077_c1	3300050513	Bacteria	4360
470	nmdc:mga0rr50_231154_c1	3300050513	Bacteria	1530
471	nmdc:mga0rr50_3125_c1	3300050513	Bacteria	9461
472	nmdc:mga0rr50_55453_c1	3300050513	Bacteria	2957
473	nmdc:mga08x19_10028_c1	3300050514	Bacteria	5680
474	nmdc:mga08x19_109731_c1	3300050514	Bacteria	1839
475	nmdc:mga08x19_11530_c1	3300050514	Bacteria	5320
476	nmdc:mga08x19_13820_c1	3300050514	Bacteria	4890
477	nmdc:mga08x19_17549_c1	3300050514	Bacteria	4381
478	nmdc:mga08x19_2402_c1	3300050514	Bacteria	11359
479	nmdc:mga0a205_8945_c1	3300050515	Bacteria	9129
480	Ga0495619_0284816	3300053085	Bacteria	1145
481	Ga0501084_0050139	3300054114	Bacteria	3494
482	Ga0501084_0361780	3300054114	Bacteria	1226
483	Ga0501082_0091248	3300060353	Bacteria	2630
484	Ga0501082_0262269	3300060353	Bacteria	1503
485	Ga0530510_0000208	3300061734	Bacteria	36276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048915	Ga0496112_0043654	Ga0496112_0043654_1437_2207	241
2	3300005366	Ga0070659_100096916	Ga0070659_1000969162	271
3	3300005435	Ga0070714_100320941	Ga0070714_1003209411	274
4	3300025931	Ga0207644_10068398	Ga0207644_100683982	274
5	3300025949	Ga0207667_10337840	Ga0207667_103378402	274
6	3300025907	Ga0207645_10049171	Ga0207645_100491713	276
7	3300005335	Ga0070666_10236354	Ga0070666_102363541	277
8	3300005336	Ga0070680_100143382	Ga0070680_1001433821	277
9	3300005344	Ga0070661_100026803	Ga0070661_1000268032	277
10	3300005345	Ga0070692_10003622	Ga0070692_100036224	277
11	3300005440	Ga0070705_100143495	Ga0070705_1001434952	277
12	3300005444	Ga0070694_100003420	Ga0070694_1000034206	277
13	3300005545	Ga0070695_100026900	Ga0070695_1000269003	277
14	3300005546	Ga0070696_100085603	Ga0070696_1000856032	277
15	3300005578	Ga0068854_100082968	Ga0068854_1000829682	277
16	3300005616	Ga0068852_100094405	Ga0068852_1000944053	277
17	3300005834	Ga0068851_10022908	Ga0068851_100229082	277
18	3300006844	Ga0075428_100037697	Ga0075428_1000376975	277
19	3300006844	Ga0075428_100259433	Ga0075428_1002594333	277
20	3300006846	Ga0075430_100006493	Ga0075430_10000649310	277
21	3300006846	Ga0075430_100025942	Ga0075430_1000259424	277
22	3300006847	Ga0075431_100045415	Ga0075431_1000454152	277
23	3300006847	Ga0075431_100104338	Ga0075431_1001043384	277
24	3300006871	Ga0075434_100000078	Ga0075434_10000007838	277
25	3300006880	Ga0075429_100006944	Ga0075429_1000069445	277
26	3300025917	Ga0207660_10059585	Ga0207660_100595852	277
27	3300025917	Ga0207660_10203988	Ga0207660_102039882	277
28	3300025944	Ga0207661_10206662	Ga0207661_102066622	277
29	3300025945	Ga0207679_10363498	Ga0207679_103634981	277
30	3300027682	Ga0209971_1008196	Ga0209971_10081963	277
31	3300027695	Ga0209966_1004189	Ga0209966_10041891	277
32	3300027876	Ga0209974_10006065	Ga0209974_100060654	277
33	3300005618	Ga0068864_100190952	Ga0068864_1001909522	278
34	3300035691	Ga0373931_0177201	Ga0373931_0177201_60_974	280
35	3300006846	Ga0075430_100143196	Ga0075430_1001431962	288
36	3300006914	Ga0075436_100000956	Ga0075436_1000009564	288
37	3300049743	Ga0501081_0144568	Ga0501081_0144568_175_1056	288
38	3300050509	nmdc:mga0qj67_126810_c1	nmdc:mga0qj67_126810_c1_179_1090	288
39	3300050513	nmdc:mga0rr50_22077_c1	nmdc:mga0rr50_22077_c1_886_1815	288
40	3300050514	nmdc:mga08x19_10028_c1	nmdc:mga08x19_10028_c1_1961_2890	288
41	3300005459	Ga0068867_100242195	Ga0068867_1002421952	292
42	3300005617	Ga0068859_100068130	Ga0068859_1000681305	292
43	3300005843	Ga0068860_100182729	Ga0068860_1001827292	292
44	3300006931	Ga0097620_100068131	Ga0097620_1000681312	292
45	3300028381	Ga0268264_10184220	Ga0268264_101842201	292
46	3300046684	Ga0495669_0016197	Ga0495669_0016197_2286_3164	292
47	3300049591	Ga0501075_0081496	Ga0501075_0081496_24_902	292
48	3300005539	Ga0068853_100130628	Ga0068853_1001306281	296
49	3300026041	Ga0207639_10064392	Ga0207639_100643921	296
50	iso_pu_bacteria	2526164512	2526210674	296
51	iso_pu_bacteria	2547132512	2548848989	296
52	3300036647	Ga0316582_0095090	Ga0316582_0095090_770_1663	297
53	3300045051	Ga0451576_0000812	Ga0451576_0000812_7919_8821	299
54	3300045976	Ga0466967_0134064	Ga0466967_0134064_61_972	299
55	3300005328	Ga0070676_10194992	Ga0070676_101949921	300
56	3300005330	Ga0070690_100212703	Ga0070690_1002127032	300
57	3300005338	Ga0068868_100274829	Ga0068868_1002748292	300
58	3300005340	Ga0070689_100226943	Ga0070689_1002269432	300
59	3300005344	Ga0070661_100179521	Ga0070661_1001795211	300
60	3300005354	Ga0070675_100126187	Ga0070675_1001261872	300
61	3300005355	Ga0070671_100043583	Ga0070671_1000435833	300
62	3300005355	Ga0070671_100078365	Ga0070671_1000783653	300
63	3300005356	Ga0070674_100087180	Ga0070674_1000871802	300
64	3300005365	Ga0070688_100076932	Ga0070688_1000769322	300
65	3300005367	Ga0070667_100563395	Ga0070667_1005633951	300
66	3300005434	Ga0070709_10007448	Ga0070709_100074486	300
67	3300005435	Ga0070714_100065960	Ga0070714_1000659602	300
68	3300005436	Ga0070713_100072201	Ga0070713_1000722012	300
69	3300005439	Ga0070711_100030060	Ga0070711_1000300602	300
70	3300005440	Ga0070705_100030223	Ga0070705_1000302232	300
71	3300005456	Ga0070678_100031143	Ga0070678_1000311433	300
72	3300005458	Ga0070681_10288604	Ga0070681_102886042	300
73	3300005459	Ga0068867_100092369	Ga0068867_1000923692	300
74	3300005468	Ga0070707_100127410	Ga0070707_1001274101	300
75	3300005471	Ga0070698_100003383	Ga0070698_10000338314	300
76	3300005471	Ga0070698_100091784	Ga0070698_1000917843	300
77	3300005546	Ga0070696_100008651	Ga0070696_1000086514	300
78	3300005548	Ga0070665_100052961	Ga0070665_1000529611	300
79	3300005549	Ga0070704_100044499	Ga0070704_1000444993	300
80	3300005563	Ga0068855_100365270	Ga0068855_1003652701	300
81	3300005617	Ga0068859_100042890	Ga0068859_1000428904	300
82	3300005617	Ga0068859_100232341	Ga0068859_1002323411	300
83	3300005618	Ga0068864_100045551	Ga0068864_1000455513	300
84	3300005618	Ga0068864_100223158	Ga0068864_1002231582	300
85	3300005618	Ga0068864_100283105	Ga0068864_1002831052	300
86	3300005842	Ga0068858_100055826	Ga0068858_1000558262	300
87	3300005843	Ga0068860_100004427	Ga0068860_10000442712	300
88	3300005843	Ga0068860_100212556	Ga0068860_1002125562	300
89	3300005844	Ga0068862_100097090	Ga0068862_1000970902	300
90	3300006237	Ga0097621_100010313	Ga0097621_1000103132	300
91	3300006237	Ga0097621_100168044	Ga0097621_1001680442	300
92	3300006358	Ga0068871_100157755	Ga0068871_1001577552	300
93	3300006358	Ga0068871_100179331	Ga0068871_1001793312	300
94	3300006844	Ga0075428_100138906	Ga0075428_1001389062	300
95	3300006847	Ga0075431_100032745	Ga0075431_1000327454	300
96	3300006847	Ga0075431_100034965	Ga0075431_1000349653	300
97	3300006880	Ga0075429_100000758	Ga0075429_10000075814	300
98	3300006881	Ga0068865_100038662	Ga0068865_1000386621	300
99	3300006914	Ga0075436_100195709	Ga0075436_1001957092	300
100	3300006931	Ga0097620_100042886	Ga0097620_1000428862	300
101	3300006931	Ga0097620_100232336	Ga0097620_1002323361	300
102	3300009093	Ga0105240_10027909	Ga0105240_100279093	300
103	3300009094	Ga0111539_10125896	Ga0111539_101258962	300
104	3300009098	Ga0105245_10200257	Ga0105245_102002572	300
105	3300009147	Ga0114129_10273786	Ga0114129_102737862	300
106	3300009176	Ga0105242_10076182	Ga0105242_100761823	300
107	3300009177	Ga0105248_10037229	Ga0105248_100372292	300
108	3300009177	Ga0105248_10103561	Ga0105248_101035612	300
109	3300009553	Ga0105249_10042114	Ga0105249_100421142	300
110	3300009553	Ga0105249_10427158	Ga0105249_104271582	300
111	3300013100	Ga0157373_10189127	Ga0157373_101891272	300
112	3300013104	Ga0157370_10017912	Ga0157370_100179123	300
113	3300013306	Ga0163162_10048851	Ga0163162_100488513	300
114	3300013307	Ga0157372_10010149	Ga0157372_100101498	300
115	3300014968	Ga0157379_10045197	Ga0157379_100451972	300
116	3300014969	Ga0157376_10003476	Ga0157376_100034767	300
117	3300025898	Ga0207692_10032540	Ga0207692_100325402	300
118	3300025906	Ga0207699_10099461	Ga0207699_100994611	300
119	3300025912	Ga0207707_10020579	Ga0207707_100205793	300
120	3300025912	Ga0207707_10291676	Ga0207707_102916762	300
121	3300025916	Ga0207663_10064957	Ga0207663_100649572	300
122	3300025917	Ga0207660_10228371	Ga0207660_102283712	300
123	3300025921	Ga0207652_10383388	Ga0207652_103833881	300
124	3300025922	Ga0207646_10460192	Ga0207646_104601921	300
125	3300025926	Ga0207659_10100622	Ga0207659_101006222	300
126	3300025928	Ga0207700_10076773	Ga0207700_100767732	300
127	3300025929	Ga0207664_10058149	Ga0207664_100581492	300
128	3300025929	Ga0207664_10216367	Ga0207664_102163671	300
129	3300025936	Ga0207670_10166137	Ga0207670_101661372	300
130	3300025936	Ga0207670_10478237	Ga0207670_104782371	300
131	3300025937	Ga0207669_10112702	Ga0207669_101127022	300
132	3300025938	Ga0207704_10052399	Ga0207704_100523991	300
133	3300025940	Ga0207691_10006790	Ga0207691_100067908	300
134	3300025941	Ga0207711_10161610	Ga0207711_101616102	300
135	3300025960	Ga0207651_10236057	Ga0207651_102360571	300
136	3300025961	Ga0207712_10257949	Ga0207712_102579491	300
137	3300025972	Ga0207668_10403057	Ga0207668_104030571	300
138	3300025986	Ga0207658_10058926	Ga0207658_100589263	300
139	3300026023	Ga0207677_10264569	Ga0207677_102645692	300
140	3300026075	Ga0207708_10309139	Ga0207708_103091392	300
141	3300026088	Ga0207641_10038614	Ga0207641_100386141	300
142	3300026121	Ga0207683_10026818	Ga0207683_100268183	300
143	3300026121	Ga0207683_10235338	Ga0207683_102353382	300
144	3300027360	Ga0209969_1007026	Ga0209969_10070261	300
145	3300027364	Ga0209967_1002295	Ga0209967_10022952	300
146	3300027462	Ga0210000_1000649	Ga0210000_10006497	300
147	3300027462	Ga0210000_1005345	Ga0210000_10053452	300
148	3300027665	Ga0209983_1009734	Ga0209983_10097342	300
149	3300027695	Ga0209966_1002847	Ga0209966_10028473	300
150	3300027907	Ga0207428_10116642	Ga0207428_101166422	300
151	3300028380	Ga0268265_10152953	Ga0268265_101529532	300
152	3300031238	Ga0265332_10000100	Ga0265332_1000010040	300
153	3300031241	Ga0265325_10001009	Ga0265325_100010098	300
154	3300031548	Ga0307408_100246470	Ga0307408_1002464702	300
155	3300031665	Ga0316575_10010597	Ga0316575_100105972	300
156	3300035241	Ga0373961_0049761	Ga0373961_0049761_116_1018	300
157	3300035398	Ga0316574_0004964	Ga0316574_0004964_692_1597	300
158	3300036401	Ga0373937_0088510	Ga0373937_0088510_1769_2674	300
159	3300036401	Ga0373937_0217716	Ga0373937_0217716_472_1380	300
160	3300042156	Ga0439446_0000856	Ga0439446_0000856_4578_5486	300
161	3300042435	Ga0439434_0018722	Ga0439434_0018722_1010_1918	300
162	3300042436	Ga0439435_0000023	Ga0439435_0000023_5700_6608	300
163	3300045051	Ga0451576_0033061	Ga0451576_0033061_3000_3905	300
164	3300046539	Ga0495621_0106489	Ga0495621_0106489_17_925	300
165	3300049568	Ga0501031_0075593	Ga0501031_0075593_582_1490	300
166	3300049572	Ga0501036_0124197	Ga0501036_0124197_799_1707	300
167	3300049575	Ga0501039_0296172	Ga0501039_0296172_315_1223	300
168	3300049578	Ga0501042_0196760	Ga0501042_0196760_118_1026	300
169	3300049587	Ga0501071_0175442	Ga0501071_0175442_275_1183	300
170	3300049588	Ga0501072_0031443	Ga0501072_0031443_1068_1976	300
171	3300049591	Ga0501075_0116113	Ga0501075_0116113_744_1652	300
172	3300049824	Ga0501045_0163267	Ga0501045_0163267_622_1530	300
173	3300050507	nmdc:mga05p37_3265_c1	nmdc:mga05p37_3265_c1_15875_16780	300
174	3300050508	nmdc:mga09592_298_c1	nmdc:mga09592_298_c1_13308_14213	300
175	3300050510	nmdc:mga06r32_28795_c1	nmdc:mga06r32_28795_c1_2756_3661	300
176	3300050510	nmdc:mga06r32_3461_c1	nmdc:mga06r32_3461_c1_10995_11900	300
177	3300050511	nmdc:mga08y16_672017_c1	nmdc:mga08y16_672017_c1_24_929	300
178	3300050512	nmdc:mga0n895_307652_c1	nmdc:mga0n895_307652_c1_518_1423	300
179	3300050513	nmdc:mga0rr50_231154_c1	nmdc:mga0rr50_231154_c1_374_1282	300
180	3300050514	nmdc:mga08x19_109731_c1	nmdc:mga08x19_109731_c1_626_1528	300
181	3300060353	Ga0501082_0262269	Ga0501082_0262269_382_1290	300
182	3300013306	Ga0163162_10759799	Ga0163162_107597991	301
183	3300005341	Ga0070691_10033159	Ga0070691_100331593	302
184	3300005841	Ga0068863_100301902	Ga0068863_1003019022	302
185	3300005985	Ga0081539_10021097	Ga0081539_100210973	302
186	3300006195	Ga0075366_10000351	Ga0075366_100003519	302
187	3300013297	Ga0157378_10046671	Ga0157378_100466714	302
188	3300013306	Ga0163162_10120133	Ga0163162_101201332	302
189	3300025939	Ga0207665_10097020	Ga0207665_100970201	302
190	3300026035	Ga0207703_10297497	Ga0207703_102974972	302
191	3300026095	Ga0207676_10408939	Ga0207676_104089392	302
192	3300031548	Ga0307408_100044132	Ga0307408_1000441324	302
193	3300031548	Ga0307408_100270172	Ga0307408_1002701722	302
194	3300031731	Ga0307405_10042185	Ga0307405_100421853	302
195	3300032005	Ga0307411_10173205	Ga0307411_101732052	302
196	3300042001	Ga0439441_011263	Ga0439441_011263_197_1126	302
197	3300042461	Ga0439460_0052751	Ga0439460_0052751_258_1175	302
198	3300045836	Ga0466958_0063351	Ga0466958_0063351_986_1912	302
199	3300046615	Ga0495656_0089234	Ga0495656_0089234_22_948	302
200	3300049572	Ga0501036_0345821	Ga0501036_0345821_43_975	302
201	3300049575	Ga0501039_0160276	Ga0501039_0160276_159_1067	302
202	3300049577	Ga0501041_0005794	Ga0501041_0005794_5234_6142	302
203	3300049580	Ga0501046_0367717	Ga0501046_0367717_43_951	302
204	3300049582	Ga0501048_0097087	Ga0501048_0097087_569_1477	302
205	3300049824	Ga0501045_0056064	Ga0501045_0056064_1857_2765	302
206	3300050493	nmdc:mga0k408_43_c1	nmdc:mga0k408_43_c1_13703_14686	302
207	3300003203	JGI25406J46586_10017692	JGI25406J46586_100176924	303
208	3300005295	Ga0065707_10008289	Ga0065707_100082893	303
209	3300005330	Ga0070690_100000203	Ga0070690_1000002039	303
210	3300005331	Ga0070670_100007866	Ga0070670_1000078665	303
211	3300005331	Ga0070670_100063900	Ga0070670_1000639002	303
212	3300005334	Ga0068869_100001312	Ga0068869_1000013128	303
213	3300005334	Ga0068869_100043755	Ga0068869_1000437552	303
214	3300005335	Ga0070666_10028686	Ga0070666_100286861	303
215	3300005336	Ga0070680_100003010	Ga0070680_1000030106	303
216	3300005336	Ga0070680_100141795	Ga0070680_1001417952	303
217	3300005337	Ga0070682_100013141	Ga0070682_1000131412	303
218	3300005338	Ga0068868_100003713	Ga0068868_1000037134	303
219	3300005340	Ga0070689_100005620	Ga0070689_1000056204	303
220	3300005341	Ga0070691_10000424	Ga0070691_100004246	303
221	3300005343	Ga0070687_100000070	Ga0070687_1000000705	303
222	3300005344	Ga0070661_100116547	Ga0070661_1001165472	303
223	3300005345	Ga0070692_10001698	Ga0070692_100016985	303
224	3300005347	Ga0070668_100278125	Ga0070668_1002781252	303
225	3300005353	Ga0070669_100068469	Ga0070669_1000684692	303
226	3300005354	Ga0070675_100033256	Ga0070675_1000332563	303
227	3300005355	Ga0070671_100403641	Ga0070671_1004036412	303
228	3300005364	Ga0070673_100052377	Ga0070673_1000523773	303
229	3300005364	Ga0070673_100239467	Ga0070673_1002394672	303
230	3300005365	Ga0070688_100025480	Ga0070688_1000254802	303
231	3300005406	Ga0070703_10002578	Ga0070703_100025784	303
232	3300005438	Ga0070701_10000661	Ga0070701_100006616	303
233	3300005440	Ga0070705_100001132	Ga0070705_1000011327	303
234	3300005441	Ga0070700_100000651	Ga0070700_10000065115	303
235	3300005444	Ga0070694_100000669	Ga0070694_1000006698	303
236	3300005444	Ga0070694_100420336	Ga0070694_1004203361	303
237	3300005458	Ga0070681_10156921	Ga0070681_101569212	303
238	3300005459	Ga0068867_100002241	Ga0068867_1000022418	303
239	3300005459	Ga0068867_100098804	Ga0068867_1000988042	303
240	3300005518	Ga0070699_100034673	Ga0070699_1000346734	303
241	3300005518	Ga0070699_100144970	Ga0070699_1001449702	303
242	3300005530	Ga0070679_100006007	Ga0070679_1000060074	303
243	3300005543	Ga0070672_100039185	Ga0070672_1000391853	303
244	3300005544	Ga0070686_100002595	Ga0070686_1000025955	303
245	3300005545	Ga0070695_100000808	Ga0070695_10000080810	303
246	3300005546	Ga0070696_100000441	Ga0070696_10000044110	303
247	3300005546	Ga0070696_100101461	Ga0070696_1001014611	303
248	3300005547	Ga0070693_100000574	Ga0070693_1000005746	303
249	3300005549	Ga0070704_100000617	Ga0070704_1000006177	303
250	3300005549	Ga0070704_100029861	Ga0070704_1000298613	303
251	3300005549	Ga0070704_100231645	Ga0070704_1002316451	303
252	3300005563	Ga0068855_100010150	Ga0068855_1000101506	303
253	3300005563	Ga0068855_100343635	Ga0068855_1003436352	303
254	3300005564	Ga0070664_100176117	Ga0070664_1001761172	303
255	3300005577	Ga0068857_100472591	Ga0068857_1004725912	303
256	3300005578	Ga0068854_100002203	Ga0068854_1000022036	303
257	3300005578	Ga0068854_100382541	Ga0068854_1003825411	303
258	3300005614	Ga0068856_100031347	Ga0068856_1000313474	303
259	3300005615	Ga0070702_100000349	Ga0070702_10000034910	303
260	3300005616	Ga0068852_100125630	Ga0068852_1001256303	303
261	3300005617	Ga0068859_100003478	Ga0068859_1000034784	303
262	3300005618	Ga0068864_100006249	Ga0068864_1000062494	303
263	3300005618	Ga0068864_100380456	Ga0068864_1003804562	303
264	3300005718	Ga0068866_10000640	Ga0068866_100006406	303
265	3300005719	Ga0068861_100000246	Ga0068861_1000002468	303
266	3300005840	Ga0068870_10063856	Ga0068870_100638562	303
267	3300005841	Ga0068863_100014294	Ga0068863_1000142945	303
268	3300005842	Ga0068858_100005536	Ga0068858_1000055367	303
269	3300005842	Ga0068858_100031795	Ga0068858_1000317953	303
270	3300005843	Ga0068860_100014566	Ga0068860_1000145667	303
271	3300005843	Ga0068860_100088152	Ga0068860_1000881522	303
272	3300005843	Ga0068860_100197309	Ga0068860_1001973091	303
273	3300005844	Ga0068862_100000668	Ga0068862_1000006685	303
274	3300005985	Ga0081539_10000668	Ga0081539_1000066868	303
275	3300006237	Ga0097621_100001417	Ga0097621_1000014176	303
276	3300006358	Ga0068871_100001297	Ga0068871_1000012979	303
277	3300006844	Ga0075428_100000591	Ga0075428_10000059132	303
278	3300006846	Ga0075430_100002128	Ga0075430_10000212811	303
279	3300006846	Ga0075430_100259278	Ga0075430_1002592781	303
280	3300006871	Ga0075434_100005507	Ga0075434_1000055079	303
281	3300006880	Ga0075429_100443522	Ga0075429_1004435222	303
282	3300006881	Ga0068865_100001575	Ga0068865_1000015758	303
283	3300006914	Ga0075436_100012897	Ga0075436_1000128972	303
284	3300006914	Ga0075436_100015316	Ga0075436_1000153162	303
285	3300006914	Ga0075436_100017350	Ga0075436_1000173504	303
286	3300006914	Ga0075436_100019559	Ga0075436_1000195592	303
287	3300006914	Ga0075436_100220232	Ga0075436_1002202321	303
288	3300006931	Ga0097620_100003478	Ga0097620_1000034784	303
289	3300007076	Ga0075435_100001714	Ga0075435_1000017142	303
290	3300007076	Ga0075435_100005065	Ga0075435_1000050657	303
291	3300009094	Ga0111539_10009997	Ga0111539_100099976	303
292	3300009094	Ga0111539_10013658	Ga0111539_100136588	303
293	3300009094	Ga0111539_10058589	Ga0111539_100585894	303
294	3300009098	Ga0105245_10003710	Ga0105245_100037107	303
295	3300009147	Ga0114129_10036857	Ga0114129_100368574	303
296	3300009147	Ga0114129_10544490	Ga0114129_105444901	303
297	3300009148	Ga0105243_10001954	Ga0105243_100019547	303
298	3300009148	Ga0105243_10137696	Ga0105243_101376962	303
299	3300009176	Ga0105242_10002505	Ga0105242_100025057	303
300	3300009553	Ga0105249_10014390	Ga0105249_100143906	303
301	3300009553	Ga0105249_10393117	Ga0105249_103931172	303
302	3300010375	Ga0105239_10013511	Ga0105239_100135116	303
303	3300013296	Ga0157374_10163767	Ga0157374_101637672	303
304	3300013297	Ga0157378_10001142	Ga0157378_1000114218	303
305	3300013306	Ga0163162_10126417	Ga0163162_101264172	303
306	3300013308	Ga0157375_10009737	Ga0157375_100097378	303
307	3300014326	Ga0157380_10024772	Ga0157380_100247724	303
308	3300014326	Ga0157380_10050716	Ga0157380_100507163	303
309	3300014968	Ga0157379_10069942	Ga0157379_100699423	303
310	3300014969	Ga0157376_10323920	Ga0157376_103239202	303
311	3300025899	Ga0207642_10004895	Ga0207642_100048954	303
312	3300025903	Ga0207680_10052801	Ga0207680_100528013	303
313	3300025904	Ga0207647_10118085	Ga0207647_101180852	303
314	3300025907	Ga0207645_10032433	Ga0207645_100324332	303
315	3300025908	Ga0207643_10054464	Ga0207643_100544642	303
316	3300025911	Ga0207654_10135412	Ga0207654_101354122	303
317	3300025917	Ga0207660_10003216	Ga0207660_100032165	303
318	3300025918	Ga0207662_10000088	Ga0207662_100000885	303
319	3300025921	Ga0207652_10007461	Ga0207652_100074618	303
320	3300025923	Ga0207681_10080139	Ga0207681_100801392	303
321	3300025925	Ga0207650_10009964	Ga0207650_100099645	303
322	3300025925	Ga0207650_10055001	Ga0207650_100550012	303
323	3300025925	Ga0207650_10114086	Ga0207650_101140862	303
324	3300025926	Ga0207659_10031894	Ga0207659_100318943	303
325	3300025926	Ga0207659_10059492	Ga0207659_100594921	303
326	3300025927	Ga0207687_10014600	Ga0207687_100146002	303
327	3300025934	Ga0207686_10000543	Ga0207686_1000054320	303
328	3300025935	Ga0207709_10003149	Ga0207709_100031498	303
329	3300025936	Ga0207670_10014768	Ga0207670_100147684	303
330	3300025938	Ga0207704_10003526	Ga0207704_100035266	303
331	3300025940	Ga0207691_10000717	Ga0207691_100007175	303
332	3300025940	Ga0207691_10114510	Ga0207691_101145102	303
333	3300025940	Ga0207691_10198116	Ga0207691_101981162	303
334	3300025942	Ga0207689_10002986	Ga0207689_100029869	303
335	3300025942	Ga0207689_10057678	Ga0207689_100576783	303
336	3300025945	Ga0207679_10041893	Ga0207679_100418932	303
337	3300025949	Ga0207667_10011779	Ga0207667_100117796	303
338	3300025960	Ga0207651_10090961	Ga0207651_100909612	303
339	3300025960	Ga0207651_10093728	Ga0207651_100937282	303
340	3300025961	Ga0207712_10055403	Ga0207712_100554033	303
341	3300025972	Ga0207668_10022385	Ga0207668_100223852	303
342	3300025981	Ga0207640_10004993	Ga0207640_100049936	303
343	3300025986	Ga0207658_10014857	Ga0207658_100148572	303
344	3300026023	Ga0207677_10003201	Ga0207677_100032015	303
345	3300026035	Ga0207703_10003517	Ga0207703_100035177	303
346	3300026075	Ga0207708_10000326	Ga0207708_100003266	303
347	3300026078	Ga0207702_10027494	Ga0207702_100274944	303
348	3300026088	Ga0207641_10028127	Ga0207641_100281271	303
349	3300026088	Ga0207641_10125157	Ga0207641_101251571	303
350	3300026089	Ga0207648_10000071	Ga0207648_1000007188	303
351	3300026095	Ga0207676_10001540	Ga0207676_1000154012	303
352	3300026118	Ga0207675_100000040	Ga0207675_1000000409	303
353	3300026118	Ga0207675_100027980	Ga0207675_1000279802	303
354	3300026142	Ga0207698_10088153	Ga0207698_100881533	303
355	3300027614	Ga0209970_1004597	Ga0209970_10045972	303
356	3300027682	Ga0209971_1003083	Ga0209971_10030832	303
357	3300027907	Ga0207428_10003555	Ga0207428_1000355514	303
358	3300027907	Ga0207428_10007867	Ga0207428_100078676	303
359	3300028379	Ga0268266_10137590	Ga0268266_101375902	303
360	3300028380	Ga0268265_10007368	Ga0268265_100073686	303
361	3300028380	Ga0268265_10022745	Ga0268265_100227452	303
362	3300028381	Ga0268264_10000527	Ga0268264_100005276	303
363	3300028381	Ga0268264_10303844	Ga0268264_103038441	303
364	3300031548	Ga0307408_100123123	Ga0307408_1001231232	303
365	3300031852	Ga0307410_10027952	Ga0307410_100279522	303
366	3300031995	Ga0307409_100290608	Ga0307409_1002906082	303
367	3300032002	Ga0307416_100162184	Ga0307416_1001621842	303
368	3300032004	Ga0307414_10102981	Ga0307414_101029812	303
369	3300035083	Ga0373926_0000873	Ga0373926_0000873_4694_5629	303
370	3300035085	Ga0373929_0022357	Ga0373929_0022357_12_923	303
371	3300035089	Ga0373944_0002284	Ga0373944_0002284_3419_4354	303
372	3300035091	Ga0373951_0029675	Ga0373951_0029675_337_1248	303
373	3300035112	Ga0373932_0001399	Ga0373932_0001399_2125_3036	303
374	3300035113	Ga0373936_0003827	Ga0373936_0003827_2315_3250	303
375	3300035114	Ga0373939_0048557	Ga0373939_0048557_175_1086	303
376	3300035116	Ga0373945_0007903	Ga0373945_0007903_593_1528	303
377	3300035119	Ga0373956_0000003	Ga0373956_0000003_78046_78975	303
378	3300035170	Ga0373943_0000584	Ga0373943_0000584_11304_12239	303
379	3300035170	Ga0373943_0001182	Ga0373943_0001182_1552_2463	303
380	3300035171	Ga0373946_0004732	Ga0373946_0004732_1105_2040	303
381	3300035171	Ga0373946_0053775	Ga0373946_0053775_740_1651	303
382	3300035172	Ga0373955_0006439	Ga0373955_0006439_1244_2173	303
383	3300035207	Ga0373942_0051598	Ga0373942_0051598_102_1013	303
384	3300035410	Ga0373924_0046301	Ga0373924_0046301_855_1766	303
385	3300035691	Ga0373931_0001098	Ga0373931_0001098_10501_11412	303
386	3300035691	Ga0373931_0003090	Ga0373931_0003090_1978_2889	303
387	3300035692	Ga0373935_0001505	Ga0373935_0001505_3554_4489	303
388	3300035692	Ga0373935_0005854	Ga0373935_0005854_445_1356	303
389	3300035695	Ga0373927_0009907	Ga0373927_0009907_2416_3351	303
390	3300035695	Ga0373927_0106632	Ga0373927_0106632_40_987	303
391	3300035724	Ga0373933_0005782	Ga0373933_0005782_2949_3878	303
392	3300035725	Ga0373947_0002482	Ga0373947_0002482_1721_2632	303
393	3300035725	Ga0373947_0010627	Ga0373947_0010627_1903_2838	303
394	3300035725	Ga0373947_0195854	Ga0373947_0195854_262_1245	303
395	3300036401	Ga0373937_0000196	Ga0373937_0000196_3564_4493	303
396	3300036401	Ga0373937_0093153	Ga0373937_0093153_1520_2455	303
397	3300037068	Ga0373925_0006465	Ga0373925_0006465_1505_2416	303
398	3300037068	Ga0373925_0018613	Ga0373925_0018613_275_1204	303
399	3300042436	Ga0439435_0000004	Ga0439435_0000004_21456_22367	303
400	3300042436	Ga0439435_0003387	Ga0439435_0003387_138_1073	303
401	3300042436	Ga0439435_0042862	Ga0439435_0042862_65_1000	303
402	3300042437	Ga0439444_0002891	Ga0439444_0002891_142_1077	303
403	3300042437	Ga0439444_0003422	Ga0439444_0003422_1028_1939	303
404	3300042461	Ga0439460_0000235	Ga0439460_0000235_3128_4039	303
405	3300042876	Ga0451577_0090389	Ga0451577_0090389_1419_2342	303
406	3300045051	Ga0451576_0003049	Ga0451576_0003049_19158_20069	303
407	3300045051	Ga0451576_0017751	Ga0451576_0017751_2366_3277	303
408	3300046455	Ga0495603_0006975	Ga0495603_0006975_2269_3204	303
409	3300046462	Ga0495651_0004749	Ga0495651_0004749_3414_4343	303
410	3300046472	Ga0495580_0016385	Ga0495580_0016385_516_1499	303
411	3300046475	Ga0495639_0004241	Ga0495639_0004241_204_1139	303
412	3300046499	Ga0495594_0213938	Ga0495594_0213938_107_1042	303
413	3300046526	Ga0495666_0020290	Ga0495666_0020290_1119_2054	303
414	3300046535	Ga0495586_0154656	Ga0495586_0154656_177_1112	303
415	3300046539	Ga0495621_0019434	Ga0495621_0019434_348_1259	303
416	3300046674	Ga0495588_0091551	Ga0495588_0091551_361_1296	303
417	3300046681	Ga0495647_0001142	Ga0495647_0001142_2091_3026	303
418	3300046683	Ga0495658_0229228	Ga0495658_0229228_70_1005	303
419	3300047318	Ga0495636_0064728	Ga0495636_0064728_76_987	303
420	3300047321	Ga0495676_0046054	Ga0495676_0046054_82_1017	303
421	3300047322	Ga0495680_0233925	Ga0495680_0233925_40_969	303
422	3300049570	Ga0501033_0280586	Ga0501033_0280586_13_924	303
423	3300049572	Ga0501036_0025737	Ga0501036_0025737_1877_2788	303
424	3300049573	Ga0501037_0239812	Ga0501037_0239812_276_1187	303
425	3300049574	Ga0501038_0100785	Ga0501038_0100785_1273_2184	303
426	3300049575	Ga0501039_0009254	Ga0501039_0009254_3951_4862	303
427	3300049576	Ga0501040_0167054	Ga0501040_0167054_533_1444	303
428	3300049576	Ga0501040_0266408	Ga0501040_0266408_226_1137	303
429	3300049577	Ga0501041_0003184	Ga0501041_0003184_6488_7399	303
430	3300049577	Ga0501041_0058572	Ga0501041_0058572_37_963	303
431	3300049578	Ga0501042_0075126	Ga0501042_0075126_1479_2390	303
432	3300049578	Ga0501042_0379585	Ga0501042_0379585_38_964	303
433	3300049580	Ga0501046_0088647	Ga0501046_0088647_1146_2057	303
434	3300049582	Ga0501048_0007566	Ga0501048_0007566_2033_2944	303
435	3300049584	Ga0501068_0018113	Ga0501068_0018113_361_1272	303
436	3300049587	Ga0501071_0042155	Ga0501071_0042155_290_1201	303
437	3300049587	Ga0501071_0066887	Ga0501071_0066887_1646_2557	303
438	3300049587	Ga0501071_0154141	Ga0501071_0154141_157_1083	303
439	3300049588	Ga0501072_0006904	Ga0501072_0006904_2175_3086	303
440	3300049588	Ga0501072_0092486	Ga0501072_0092486_516_1427	303
441	3300049588	Ga0501072_0219290	Ga0501072_0219290_444_1367	303
442	3300049589	Ga0501073_0087455	Ga0501073_0087455_235_1158	303
443	3300049590	Ga0501074_0047071	Ga0501074_0047071_1248_2159	303
444	3300049591	Ga0501075_0012964	Ga0501075_0012964_3000_3911	303
445	3300049592	Ga0501076_0015151	Ga0501076_0015151_1567_2478	303
446	3300049592	Ga0501076_0093854	Ga0501076_0093854_249_1172	303
447	3300049593	Ga0501077_0011299	Ga0501077_0011299_278_1201	303
448	3300049741	Ga0501079_0095441	Ga0501079_0095441_853_1764	303
449	3300049741	Ga0501079_0260356	Ga0501079_0260356_85_996	303
450	3300049742	Ga0501080_0006525	Ga0501080_0006525_3792_4715	303
451	3300049742	Ga0501080_0102203	Ga0501080_0102203_1260_2171	303
452	3300049743	Ga0501081_0005928	Ga0501081_0005928_1397_2308	303
453	3300049743	Ga0501081_0162736	Ga0501081_0162736_128_1039	303
454	3300049744	Ga0501083_0150642	Ga0501083_0150642_32_1018	303
455	3300049822	Ga0501035_0213794	Ga0501035_0213794_696_1607	303
456	3300049824	Ga0501045_0015834	Ga0501045_0015834_3003_3914	303
457	3300049824	Ga0501045_0312667	Ga0501045_0312667_119_1030	303
458	3300050507	nmdc:mga05p37_106851_c1	nmdc:mga05p37_106851_c1_226_1137	303
459	3300050508	nmdc:mga09592_114167_c1	nmdc:mga09592_114167_c1_1166_2101	303
460	3300050508	nmdc:mga09592_19136_c1	nmdc:mga09592_19136_c1_3324_4250	303
461	3300050508	nmdc:mga09592_5555_c1	nmdc:mga09592_5555_c1_3188_4123	303
462	3300050508	nmdc:mga09592_55815_c1	nmdc:mga09592_55815_c1_2297_3208	303
463	3300050509	nmdc:mga0qj67_264489_c1	nmdc:mga0qj67_264489_c1_287_1213	303
464	3300050509	nmdc:mga0qj67_2983_c1	nmdc:mga0qj67_2983_c1_3157_4092	303
465	3300050509	nmdc:mga0qj67_7066_c1	nmdc:mga0qj67_7066_c1_1419_2330	303
466	3300050509	nmdc:mga0qj67_87830_c1	nmdc:mga0qj67_87830_c1_442_1449	303
467	3300050510	nmdc:mga06r32_37440_c1	nmdc:mga06r32_37440_c1_2643_3578	303
468	3300050510	nmdc:mga06r32_413629_c1	nmdc:mga06r32_413629_c1_346_1257	303
469	3300050510	nmdc:mga06r32_98883_c1	nmdc:mga06r32_98883_c1_1519_2526	303
470	3300050511	nmdc:mga08y16_21638_c1	nmdc:mga08y16_21638_c1_4211_5122	303
471	3300050511	nmdc:mga08y16_45641_c1	nmdc:mga08y16_45641_c1_393_1328	303
472	3300050511	nmdc:mga08y16_65413_c1	nmdc:mga08y16_65413_c1_711_1622	303
473	3300050511	nmdc:mga08y16_8048_c1	nmdc:mga08y16_8048_c1_3275_4201	303
474	3300050512	nmdc:mga0n895_14651_c1	nmdc:mga0n895_14651_c1_6046_6957	303
475	3300050512	nmdc:mga0n895_5640_c1	nmdc:mga0n895_5640_c1_1879_2790	303
476	3300050513	nmdc:mga0rr50_3125_c1	nmdc:mga0rr50_3125_c1_7770_8681	303
477	3300050513	nmdc:mga0rr50_55453_c1	nmdc:mga0rr50_55453_c1_128_1039	303
478	3300050514	nmdc:mga08x19_11530_c1	nmdc:mga08x19_11530_c1_471_1382	303
479	3300050514	nmdc:mga08x19_13820_c1	nmdc:mga08x19_13820_c1_1804_2715	303
480	3300050514	nmdc:mga08x19_17549_c1	nmdc:mga08x19_17549_c1_3281_4192	303
481	3300050514	nmdc:mga08x19_2402_c1	nmdc:mga08x19_2402_c1_3136_4047	303
482	3300050515	nmdc:mga0a205_8945_c1	nmdc:mga0a205_8945_c1_486_1397	303
483	3300053085	Ga0495619_0284816	Ga0495619_0284816_103_1032	303
484	3300054114	Ga0501084_0050139	Ga0501084_0050139_2496_3407	303
485	3300054114	Ga0501084_0361780	Ga0501084_0361780_227_1153	303
486	3300060353	Ga0501082_0091248	Ga0501082_0091248_1207_2118	303
487	3300061734	Ga0530510_0000208	Ga0530510_0000208_33799_34710	303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03466

LysR_substrate

LysR substrate binding domain

124

334

0.98 PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

41

100

0.96 PF12727

PBP_like

PBP superfamily domain

199

330

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4ihs-assembly1.cif.gz_A	crystal structure of benm_dbd/catb site 1 dna complex	0.9559	1	86
4ihs-assembly3.cif.gz_C	crystal structure of benm_dbd/catb site 1 dna complex	0.9557	1	86
4ihs-assembly1.cif.gz_B	crystal structure of benm_dbd/catb site 1 dna complex	0.9533	1	87
4iht-assembly2.cif.gz_C	crystal structure of benm_dbd/bena site 1 dna complex	0.9447	1	85
4iht-assembly1.cif.gz_A	crystal structure of benm_dbd/bena site 1 dna complex	0.9446	1	86

ID	Description	Score	Start	End	Superfamily
af_P77309_1_86_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.984	1	80	1.10.10.10
af_P36771_5_92_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.979	1	80	1.10.10.10
af_Q47141_1_83_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9766	1	82	1.10.10.10
af_P37641_3_87_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9742	3	80	1.10.10.10
af_P45463_8_91_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9724	4	84	1.10.10.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2G6K8T7-F1-model_v4	LysR family transcriptional regulator	0.9744	3	73	GO:0003700 GO:0005829
AF-A0A6N3U979-F1-model_v4	deleted	0.9728	1	74
AF-E8UYI9-F1-model_v4	Regulatory protein LysR	0.9699	4	75	GO:0003700
AF-A0A658JMP9-F1-model_v4	deleted	0.9688	1	79
AF-A0A7Y8HXQ6-F1-model_v4	LysR family transcriptional regulator	0.9679	1	79	GO:0000976 GO:0003700

Feature Viewer

pLDDT	pTM	Quality
90.32	0.68	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F453407

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03466

LysR_substrate

LysR substrate binding domain

124

334

0.98

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

41

100

0.96

PF12727

PBP_like

PBP superfamily domain

199

330

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map