F453312

General Info

Members Datasets Scaffolds Average Seq Length
486 185 972 706

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0009302|Ga0466963_0009302_225_2468
Length 730
Sequence MQRLRAVEERPVSFIPLADGETSREIDPVLDCLAFVARQADRPSSPVLLRAGLALSADGRLPFHQVEPALEQVGMRADCVTRKLKGWPSGKCPAVLELDDDRAAVLLDVRDRDGLIYAPGLAEPMWVKLEEIEGAFTGRAVVVETDPTRERENERPWDEAKRRHWFWSEVWKLRREFWPVLLAALIVNMLAFAMPLFTMNVYDRVIPNKAAATLWVLALGVLLALTFDFVLRIARARLIDEVGRSLDAKLSQKLFEKVMNLPMADRQGSTGALARRVSDYEMVRDFFASTTVVLAVDLTFMILFLAFITLVGGWLVLVPLAGISIMIAAGLSLQRQMGRVALDAQADSSLQHSVLVESISGAETLKAARAEGQMLGRWRRYAAMSAATSERMRKLSAIAVNSASISQQTISVGLLVGGFYRFQAGEMTMGAIIAIIMISGRSLQPVGQLAFLITRGKQAMATLTSLQRMMEAQDERQTAIRSIVPEIRAGHIEFGDVSFRYPNGARDSLSGLSLKINPGDRIGVIGRVASGKSTLGRVLCGLYGPTAGEILVDGLDSRQYHPHQLREAFRFVSQDADVFSGTVRDNLMLGAAQADDAQLIDAVVRSGADIFLSRDAAGFDLPVGERGGYLSGGQRSLLVLARALVTPSKLLFLDEPTGSMDTQTELYFIEHLKSALAPGQALVVATHRHNMLSILNRLIVIDGGKIIADGPRDEILRHLTAASDARKAAQ

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
155 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
179 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
184 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
185 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.94
Nodule 0
Rhizoplane 0.62
Rhizosphere 94.03
Stem 0
Stem Tuber 0.21
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0009302 3300044694 Bacteria 5918
2 JGI24736J21556_1000460 3300001904 Bacteria 7658
3 JGI24740J21852_10001915 3300001979 Bacteria 9552
4 JGI24740J21852_10011489 3300001979 Bacteria 3369
5 JGI24739J22299_10001191 3300001989 Bacteria 9738
6 JGI24739J22299_10010407 3300001989 Bacteria 3455
7 JGI24737J22298_10000444 3300001990 Bacteria 14187
8 JGI24737J22298_10002443 3300001990 Bacteria 6616
9 JGI24738J21930_10000153 3300002075 Bacteria 17238
10 Ga0055536_1002122 3300003781 Bacteria 11290
11 Ga0055530_10000156 3300003791 Bacteria 61575
12 Ga0055530_10000275 3300003791 Bacteria 46696
13 Ga0055531_10000420 3300003794 Bacteria 40245
14 Ga0065715_10000972 3300005293 Bacteria 12577
15 Ga0070658_10000630 3300005327 Bacteria 30439
16 Ga0070658_10000665 3300005327 Bacteria 29734
17 Ga0070658_10004821 3300005327 Bacteria 10987
18 Ga0070658_10014428 3300005327 Bacteria 6340
19 Ga0070676_10009683 3300005328 Bacteria 5211
20 Ga0070676_10011481 3300005328 Bacteria 4815
21 Ga0070676_10014636 3300005328 Bacteria 4315
22 Ga0070683_100003186 3300005329 Bacteria 13239
23 Ga0070683_100004208 3300005329 Bacteria 11798
24 Ga0070683_100018399 3300005329 Bacteria 6188
25 Ga0070683_100061483 3300005329 Bacteria 3493
26 Ga0070670_100009284 3300005331 Bacteria 8400
27 Ga0070670_100010220 3300005331 Bacteria 8009
28 Ga0070670_100012951 3300005331 Bacteria 7141
29 Ga0070670_100014272 3300005331 Bacteria 6816
30 Ga0070670_100046743 3300005331 Bacteria 3723
31 Ga0070677_10000689 3300005333 Bacteria 11305
32 Ga0068869_100000057 3300005334 Bacteria 49267
33 Ga0068869_100046477 3300005334 Bacteria 3130
34 Ga0070680_100084648 3300005336 Bacteria 2619
35 Ga0068868_100016440 3300005338 Bacteria 5494
36 Ga0070660_100000442 3300005339 Bacteria 27575
37 Ga0070660_100000645 3300005339 Bacteria 23105
38 Ga0070660_100021259 3300005339 Bacteria 4782
39 Ga0070687_100025208 3300005343 Bacteria 2850
40 Ga0070661_100002014 3300005344 Bacteria 14053
41 Ga0070661_100003567 3300005344 Bacteria 10712
42 Ga0070661_100006166 3300005344 Bacteria 8265
43 Ga0070692_10003547 3300005345 Bacteria 6346
44 Ga0070692_10012206 3300005345 Bacteria 3967
45 Ga0070668_100023975 3300005347 Bacteria 4620
46 Ga0070669_100001694 3300005353 Bacteria 15961
47 Ga0070669_100084591 3300005353 Bacteria 2367
48 Ga0070675_100005147 3300005354 Bacteria 9974
49 Ga0070675_100010139 3300005354 Bacteria 7349
50 Ga0070671_100009141 3300005355 Bacteria 7956
51 Ga0070674_100018993 3300005356 Bacteria 4359
52 Ga0070673_100000352 3300005364 Bacteria 24204
53 Ga0070659_100000562 3300005366 Bacteria 27149
54 Ga0070659_100002401 3300005366 Bacteria 13303
55 Ga0070659_100004599 3300005366 Bacteria 9865
56 Ga0070659_100010933 3300005366 Bacteria 6698
57 Ga0070659_100011499 3300005366 Bacteria 6547
58 Ga0070659_100012984 3300005366 Bacteria 6193
59 Ga0070659_100013761 3300005366 Bacteria 6032
60 Ga0070667_100001186 3300005367 Bacteria 23681
61 Ga0070667_100015947 3300005367 Bacteria 6217
62 Ga0070667_100019994 3300005367 Bacteria 5558
63 Ga0070667_100024076 3300005367 Bacteria 5056
64 Ga0070705_100042018 3300005440 Bacteria 2611
65 Ga0070663_100002395 3300005455 Bacteria 10543
66 Ga0070663_100007516 3300005455 Bacteria 6637
67 Ga0070663_100008224 3300005455 Bacteria 6407
68 Ga0070663_100032395 3300005455 Bacteria 3603
69 Ga0070678_100062711 3300005456 Bacteria 2746
70 Ga0070662_100002262 3300005457 Bacteria 11813
71 Ga0070662_100003101 3300005457 Bacteria 10323
72 Ga0070662_100003283 3300005457 Bacteria 10071
73 Ga0070662_100009545 3300005457 Bacteria 6350
74 Ga0070662_100015027 3300005457 Bacteria 5178
75 Ga0070662_100035715 3300005457 Bacteria 3512
76 Ga0070681_10013358 3300005458 Bacteria 8160
77 Ga0070681_10045592 3300005458 Bacteria 4385
78 Ga0070681_10080615 3300005458 Bacteria 3211
79 Ga0068867_100001418 3300005459 Bacteria 16578
80 Ga0068867_100016079 3300005459 Bacteria 5312
81 Ga0070679_100033148 3300005530 Bacteria 5114
82 Ga0070679_100037180 3300005530 Bacteria 4834
83 Ga0070679_100046744 3300005530 Bacteria 4315
84 Ga0070679_100053285 3300005530 Bacteria 4027
85 Ga0068853_100002369 3300005539 Bacteria 14090
86 Ga0068853_100002634 3300005539 Bacteria 13514
87 Ga0068853_100003611 3300005539 Bacteria 11848
88 Ga0068853_100009730 3300005539 Bacteria 7755
89 Ga0068853_100045265 3300005539 Bacteria 3768
90 Ga0070672_100000309 3300005543 Bacteria 27595
91 Ga0070672_100004829 3300005543 Bacteria 8858
92 Ga0070672_100010340 3300005543 Bacteria 6471
93 Ga0070672_100090262 3300005543 Bacteria 2471
94 Ga0070696_100006268 3300005546 Bacteria 7963
95 Ga0070696_100048534 3300005546 Bacteria 2947
96 Ga0070693_100000698 3300005547 Bacteria 14813
97 Ga0070665_100005510 3300005548 Bacteria 13030
98 Ga0070665_100006328 3300005548 Bacteria 12080
99 Ga0070665_100010824 3300005548 Bacteria 9227
100 Ga0068855_100001245 3300005563 Bacteria 31618
101 Ga0068855_100003063 3300005563 Bacteria 20459
102 Ga0068855_100005207 3300005563 Bacteria 15860
103 Ga0068855_100015434 3300005563 Bacteria 9195
104 Ga0070664_100000609 3300005564 Bacteria 27376
105 Ga0070664_100003701 3300005564 Bacteria 12330
106 Ga0070664_100015711 3300005564 Bacteria 6197
107 Ga0070664_100020986 3300005564 Bacteria 5381
108 Ga0070664_100034371 3300005564 Bacteria 4253
109 Ga0070664_100083691 3300005564 Bacteria 2753
110 Ga0068857_100000301 3300005577 Bacteria 34100
111 Ga0068857_100009634 3300005577 Bacteria 8393
112 Ga0068857_100023056 3300005577 Bacteria 5475
113 Ga0068857_100080853 3300005577 Bacteria 2902
114 Ga0068854_100000997 3300005578 Bacteria 17048
115 Ga0068854_100003061 3300005578 Bacteria 10407
116 Ga0068854_100004153 3300005578 Bacteria 9105
117 Ga0068854_100016727 3300005578 Bacteria 4894
118 Ga0068856_100001106 3300005614 Bacteria 28451
119 Ga0068856_100002130 3300005614 Bacteria 20542
120 Ga0068856_100007498 3300005614 Bacteria 10651
121 Ga0068852_100000600 3300005616 Bacteria 23608
122 Ga0068852_100000738 3300005616 Bacteria 21461
123 Ga0068852_100005843 3300005616 Bacteria 8836
124 Ga0068852_100009925 3300005616 Bacteria 7089
125 Ga0068852_100013587 3300005616 Bacteria 6233
126 Ga0068859_100001556 3300005617 Bacteria 23412
127 Ga0068859_100001794 3300005617 Bacteria 21857
128 Ga0068859_100003042 3300005617 Bacteria 17011
129 Ga0068859_100009102 3300005617 Bacteria 10028
130 Ga0068859_100014071 3300005617 Bacteria 8023
131 Ga0068859_100021156 3300005617 Bacteria 6528
132 Ga0068859_100052033 3300005617 Bacteria 4118
133 Ga0068859_100079330 3300005617 Bacteria 3322
134 Ga0068864_100003083 3300005618 Bacteria 13761
135 Ga0068864_100006323 3300005618 Bacteria 9714
136 Ga0068864_100010784 3300005618 Bacteria 7552
137 Ga0068861_100009535 3300005719 Bacteria 6708
138 Ga0068851_10015187 3300005834 Bacteria 3665
139 Ga0068863_100000409 3300005841 Bacteria 43632
140 Ga0068863_100020859 3300005841 Bacteria 6257
141 Ga0068863_100118125 3300005841 Bacteria 2527
142 Ga0068858_100002214 3300005842 Bacteria 19679
143 Ga0068858_100005528 3300005842 Bacteria 12373
144 Ga0068860_100001875 3300005843 Bacteria 22336
145 Ga0068860_100007458 3300005843 Bacteria 10937
146 Ga0068860_100019091 3300005843 Bacteria 6656
147 Ga0068860_100020289 3300005843 Bacteria 6437
148 Ga0068862_100020255 3300005844 Bacteria 5556
149 Ga0068862_100027380 3300005844 Bacteria 4798
150 Ga0068862_100048390 3300005844 Bacteria 3630
151 Ga0075363_100000577 3300006048 Bacteria 12042
152 Ga0075364_10003376 3300006051 Bacteria 9066
153 Ga0075362_10000371 3300006177 Bacteria 12945
154 Ga0097621_100099534 3300006237 Bacteria 2444
155 Ga0075370_10000015 3300006353 Bacteria 62164
156 Ga0068871_100018891 3300006358 Bacteria 5252
157 Ga0068871_100055529 3300006358 Bacteria 3215
158 Ga0068865_100005461 3300006881 Bacteria 7709
159 Ga0097620_100001556 3300006931 Bacteria 23412
160 Ga0097620_100001794 3300006931 Bacteria 21857
161 Ga0097620_100003042 3300006931 Bacteria 17011
162 Ga0097620_100009102 3300006931 Bacteria 10028
163 Ga0097620_100014071 3300006931 Bacteria 8023
164 Ga0097620_100021156 3300006931 Bacteria 6528
165 Ga0097620_100052033 3300006931 Bacteria 4118
166 Ga0097620_100079333 3300006931 Bacteria 3322
167 Ga0105245_10000120 3300009098 Bacteria 75923
168 Ga0105243_10037949 3300009148 Bacteria 3748
169 Ga0105243_10067668 3300009148 Bacteria 2876
170 Ga0105241_10056278 3300009174 Bacteria 3015
171 Ga0105241_10076583 3300009174 Bacteria 2609
172 Ga0105248_10000070 3300009177 Bacteria 119985
173 Ga0105248_10002859 3300009177 Bacteria 19156
174 Ga0105248_10003929 3300009177 Bacteria 16433
175 Ga0105248_10005247 3300009177 Bacteria 14273
176 Ga0105248_10008876 3300009177 Bacteria 11049
177 Ga0105248_10031993 3300009177 Bacteria 5878
178 Ga0105248_10046514 3300009177 Bacteria 4864
179 Ga0105248_10102578 3300009177 Bacteria 3225
180 Ga0105237_10025292 3300009545 Bacteria 6072
181 Ga0105238_10002072 3300009551 Bacteria 20253
182 Ga0105238_10026729 3300009551 Bacteria 5883
183 Ga0105249_10033876 3300009553 Bacteria 4626
184 Ga0105249_10052655 3300009553 Bacteria 3718
185 Ga0105239_10070630 3300010375 Bacteria 3836
186 Ga0157373_10002655 3300013100 Bacteria 13568
187 Ga0157373_10003531 3300013100 Bacteria 11817
188 Ga0157373_10009481 3300013100 Bacteria 7192
189 Ga0157373_10011294 3300013100 Bacteria 6567
190 Ga0157373_10047270 3300013100 Bacteria 3070
191 Ga0157371_10002465 3300013102 Bacteria 17632
192 Ga0157370_10003109 3300013104 Bacteria 19655
193 Ga0157370_10059558 3300013104 Bacteria 3628
194 Ga0157369_10000106 3300013105 Bacteria 117964
195 Ga0157369_10006521 3300013105 Bacteria 13520
196 Ga0157369_10008741 3300013105 Bacteria 11602
197 Ga0157369_10011222 3300013105 Bacteria 10184
198 Ga0157369_10046377 3300013105 Bacteria 4723
199 Ga0157378_10001619 3300013297 Bacteria 20359
200 Ga0163162_10010419 3300013306 Bacteria 9037
201 Ga0163162_10029404 3300013306 Bacteria 5438
202 Ga0157372_10002444 3300013307 Bacteria 20131
203 Ga0157372_10002958 3300013307 Bacteria 18313
204 Ga0157372_10027150 3300013307 Bacteria 6232
205 Ga0157375_10009817 3300013308 Bacteria 8415
206 Ga0163163_10000135 3300014325 Bacteria 75904
207 Ga0163163_10006001 3300014325 Bacteria 10568
208 Ga0157380_10000669 3300014326 Bacteria 21228
209 Ga0157380_10003259 3300014326 Bacteria 11116
210 Ga0157380_10004997 3300014326 Bacteria 9243
211 Ga0157379_10026092 3300014968 Bacteria 5199
212 Ga0163161_10007150 3300017792 Bacteria 7717
213 Ga0209675_1000287 3300025291 Bacteria 47834
214 Ga0209676_1000146 3300025292 Bacteria 174095
215 Ga0209676_1000672 3300025292 Bacteria 48630
216 Ga0209025_1009480 3300025294 Bacteria 6773
217 Ga0209050_1000423 3300025298 Bacteria 78194
218 Ga0209257_1000267 3300025304 Bacteria 119949
219 Ga0207697_10000587 3300025315 Bacteria 20735
220 Ga0207697_10002519 3300025315 Bacteria 9440
221 Ga0207682_10000415 3300025893 Bacteria 19590
222 Ga0207688_10000620 3300025901 Bacteria 17466
223 Ga0207688_10007839 3300025901 Bacteria 5810
224 Ga0207680_10004619 3300025903 Bacteria 6540
225 Ga0207647_10000052 3300025904 Bacteria 87651
226 Ga0207647_10003727 3300025904 Bacteria 11398
227 Ga0207647_10009965 3300025904 Bacteria 6731
228 Ga0207645_10005537 3300025907 Bacteria 9141
229 Ga0207645_10013396 3300025907 Bacteria 5526
230 Ga0207705_10000059 3300025909 Bacteria 155683
231 Ga0207705_10000404 3300025909 Bacteria 37967
232 Ga0207705_10002368 3300025909 Bacteria 14572
233 Ga0207705_10004063 3300025909 Bacteria 11103
234 Ga0207705_10027918 3300025909 Bacteria 4024
235 Ga0207707_10051277 3300025912 Bacteria 3593
236 Ga0207695_10010655 3300025913 Bacteria 11232
237 Ga0207695_10034930 3300025913 Bacteria 5460
238 Ga0207660_10007518 3300025917 Bacteria 7052
239 Ga0207660_10022877 3300025917 Bacteria 4214
240 Ga0207657_10000548 3300025919 Bacteria 40056
241 Ga0207657_10002437 3300025919 Bacteria 20086
242 Ga0207657_10005327 3300025919 Bacteria 13472
243 Ga0207657_10005545 3300025919 Bacteria 13176
244 Ga0207657_10008404 3300025919 Bacteria 10478
245 Ga0207657_10008408 3300025919 Bacteria 10476
246 Ga0207657_10008461 3300025919 Bacteria 10435
247 Ga0207657_10011911 3300025919 Bacteria 8607
248 Ga0207657_10012371 3300025919 Bacteria 8430
249 Ga0207657_10024536 3300025919 Bacteria 5577
250 Ga0207657_10074543 3300025919 Bacteria 2865
251 Ga0207649_10000602 3300025920 Bacteria 24352
252 Ga0207649_10002420 3300025920 Bacteria 10448
253 Ga0207649_10003589 3300025920 Bacteria 8475
254 Ga0207649_10034376 3300025920 Bacteria 3037
255 Ga0207652_10037465 3300025921 Bacteria 4104
256 Ga0207652_10043245 3300025921 Bacteria 3836
257 Ga0207681_10003558 3300025923 Bacteria 9700
258 Ga0207694_10000403 3300025924 Bacteria 40239
259 Ga0207650_10033970 3300025925 Bacteria 3697
260 Ga0207659_10002774 3300025926 Bacteria 10448
261 Ga0207644_10012961 3300025931 Bacteria 5546
262 Ga0207644_10025328 3300025931 Bacteria 4080
263 Ga0207690_10000043 3300025932 Bacteria 119547
264 Ga0207690_10001256 3300025932 Bacteria 16039
265 Ga0207690_10002540 3300025932 Bacteria 11029
266 Ga0207690_10006811 3300025932 Bacteria 6775
267 Ga0207690_10022529 3300025932 Bacteria 3921
268 Ga0207690_10049128 3300025932 Bacteria 2810
269 Ga0207706_10000587 3300025933 Bacteria 38710
270 Ga0207706_10000862 3300025933 Bacteria 31208
271 Ga0207706_10002596 3300025933 Bacteria 17593
272 Ga0207706_10003520 3300025933 Bacteria 14952
273 Ga0207706_10004255 3300025933 Bacteria 13472
274 Ga0207706_10007199 3300025933 Bacteria 10286
275 Ga0207706_10016285 3300025933 Bacteria 6715
276 Ga0207704_10000950 3300025938 Bacteria 12815
277 Ga0207691_10000114 3300025940 Bacteria 72745
278 Ga0207691_10000758 3300025940 Bacteria 31916
279 Ga0207691_10021068 3300025940 Bacteria 6159
280 Ga0207691_10033716 3300025940 Bacteria 4767
281 Ga0207711_10000051 3300025941 Bacteria 140854
282 Ga0207711_10001010 3300025941 Bacteria 26975
283 Ga0207711_10001857 3300025941 Bacteria 19257
284 Ga0207711_10011817 3300025941 Bacteria 7255
285 Ga0207711_10108674 3300025941 Bacteria 2464
286 Ga0207689_10000014 3300025942 Bacteria 122534
287 Ga0207661_10008523 3300025944 Bacteria 7326
288 Ga0207661_10020563 3300025944 Bacteria 4936
289 Ga0207679_10000410 3300025945 Bacteria 30698
290 Ga0207679_10011033 3300025945 Bacteria 5834
291 Ga0207667_10002998 3300025949 Bacteria 20964
292 Ga0207667_10018226 3300025949 Bacteria 7878
293 Ga0207667_10019880 3300025949 Bacteria 7482
294 Ga0207667_10026030 3300025949 Bacteria 6397
295 Ga0207667_10028797 3300025949 Bacteria 6030
296 Ga0207667_10048235 3300025949 Bacteria 4504
297 Ga0207651_10000066 3300025960 Bacteria 47049
298 Ga0207651_10012681 3300025960 Bacteria 4783
299 Ga0207712_10014575 3300025961 Bacteria 5061
300 Ga0207668_10003485 3300025972 Bacteria 9239
301 Ga0207668_10020644 3300025972 Bacteria 4190
302 Ga0207640_10002990 3300025981 Bacteria 9091
303 Ga0207640_10003583 3300025981 Bacteria 8371
304 Ga0207640_10008555 3300025981 Bacteria 5684
305 Ga0207658_10001547 3300025986 Bacteria 17818
306 Ga0207677_10010047 3300026023 Bacteria 5342
307 Ga0207677_10027257 3300026023 Bacteria 3596
308 Ga0207703_10001096 3300026035 Bacteria 25762
309 Ga0207703_10002755 3300026035 Bacteria 15051
310 Ga0207703_10082679 3300026035 Bacteria 2681
311 Ga0207639_10000121 3300026041 Bacteria 59338
312 Ga0207639_10003558 3300026041 Bacteria 10468
313 Ga0207639_10003913 3300026041 Bacteria 10048
314 Ga0207639_10018638 3300026041 Bacteria 4936
315 Ga0207639_10035671 3300026041 Bacteria 3681
316 Ga0207639_10045435 3300026041 Bacteria 3308
317 Ga0207639_10057618 3300026041 Bacteria 2984
318 Ga0207678_10001544 3300026067 Bacteria 21123
319 Ga0207678_10001849 3300026067 Bacteria 19394
320 Ga0207678_10004371 3300026067 Bacteria 12706
321 Ga0207678_10007518 3300026067 Bacteria 9633
322 Ga0207678_10022436 3300026067 Bacteria 5528
323 Ga0207678_10033167 3300026067 Bacteria 4500
324 Ga0207702_10015021 3300026078 Bacteria 6421
325 Ga0207641_10000190 3300026088 Bacteria 84715
326 Ga0207641_10001627 3300026088 Bacteria 21899
327 Ga0207676_10000139 3300026095 Bacteria 63189
328 Ga0207676_10000259 3300026095 Bacteria 45927
329 Ga0207676_10006542 3300026095 Bacteria 8238
330 Ga0207674_10000060 3300026116 Bacteria 112806
331 Ga0207674_10000796 3300026116 Bacteria 41120
332 Ga0207674_10001147 3300026116 Bacteria 34352
333 Ga0207674_10009017 3300026116 Bacteria 11459
334 Ga0207674_10010722 3300026116 Bacteria 10348
335 Ga0207674_10066141 3300026116 Bacteria 3642
336 Ga0207675_100016988 3300026118 Bacteria 6799
337 Ga0207683_10020084 3300026121 Bacteria 5710
338 Ga0207698_10006456 3300026142 Bacteria 7319
339 Ga0207698_10022765 3300026142 Bacteria 4363
340 Ga0207698_10026454 3300026142 Bacteria 4104
341 Ga0207698_10044073 3300026142 Bacteria 3348
342 Ga0209974_10000395 3300027876 Bacteria 14486
343 Ga0209974_10007534 3300027876 Bacteria 3746
344 Ga0268266_10005183 3300028379 Bacteria 12270
345 Ga0268266_10006525 3300028379 Bacteria 10677
346 Ga0268266_10014261 3300028379 Bacteria 6835
347 Ga0268265_10002885 3300028380 Bacteria 12625
348 Ga0268265_10014839 3300028380 Bacteria 5318
349 Ga0268265_10054336 3300028380 Bacteria 3038
350 Ga0268265_10077529 3300028380 Bacteria 2610
351 Ga0268264_10003736 3300028381 Bacteria 13072
352 Ga0268264_10016549 3300028381 Bacteria 6038
353 Ga0268264_10041799 3300028381 Bacteria 3793
354 Ga0268264_10071580 3300028381 Bacteria 2938
355 Ga0307408_100014965 3300031548 Bacteria 5162
356 Ga0307408_100021486 3300031548 Bacteria 4368
357 Ga0307408_100026938 3300031548 Bacteria 3955
358 Ga0307408_100031629 3300031548 Bacteria 3686
359 Ga0307408_100036965 3300031548 Bacteria 3436
360 Ga0307408_100040443 3300031548 Bacteria 3301
361 Ga0307408_100055878 3300031548 Bacteria 2860
362 Ga0307508_10003862 3300031616 Bacteria 14915
363 Ga0307405_10003848 3300031731 Bacteria 6990
364 Ga0307405_10010440 3300031731 Bacteria 4813
365 Ga0307405_10011796 3300031731 Bacteria 4600
366 Ga0307405_10058106 3300031731 Bacteria 2432
367 Ga0307413_10005434 3300031824 Bacteria 5690
368 Ga0307413_10006512 3300031824 Bacteria 5345
369 Ga0307413_10006602 3300031824 Bacteria 5316
370 Ga0307413_10009616 3300031824 Bacteria 4638
371 Ga0307413_10013610 3300031824 Bacteria 4096
372 Ga0307413_10017723 3300031824 Bacteria 3716
373 Ga0307413_10025206 3300031824 Bacteria 3257
374 Ga0307413_10033404 3300031824 Bacteria 2929
375 Ga0307413_10038748 3300031824 Bacteria 2765
376 Ga0307413_10040548 3300031824 Bacteria 2718
377 Ga0307410_10003362 3300031852 Bacteria 8014
378 Ga0307410_10005704 3300031852 Bacteria 6629
379 Ga0307410_10008914 3300031852 Bacteria 5598
380 Ga0307410_10010081 3300031852 Bacteria 5336
381 Ga0307410_10032041 3300031852 Bacteria 3378
382 Ga0307406_10007595 3300031901 Bacteria 6020
383 Ga0307406_10022256 3300031901 Bacteria 3758
384 Ga0307406_10026198 3300031901 Bacteria 3498
385 Ga0307407_10002208 3300031903 Bacteria 7516
386 Ga0307407_10002574 3300031903 Bacteria 7145
387 Ga0307407_10007572 3300031903 Bacteria 4925
388 Ga0307407_10020112 3300031903 Bacteria 3412
389 Ga0307412_10009435 3300031911 Bacteria 5600
390 Ga0307412_10020259 3300031911 Bacteria 4045
391 Ga0307412_10040739 3300031911 Bacteria 3006
392 Ga0307412_10057705 3300031911 Bacteria 2593
393 Ga0307412_10061739 3300031911 Bacteria 2520
394 Ga0307409_100003192 3300031995 Bacteria 8816
395 Ga0307409_100019742 3300031995 Bacteria 4573
396 Ga0307409_100026828 3300031995 Bacteria 4070
397 Ga0307409_100044026 3300031995 Bacteria 3358
398 Ga0307409_100048042 3300031995 Bacteria 3244
399 Ga0307409_100104704 3300031995 Bacteria 2357
400 Ga0307416_100006269 3300032002 Bacteria 7428
401 Ga0307416_100006554 3300032002 Bacteria 7300
402 Ga0307416_100035322 3300032002 Bacteria 3815
403 Ga0307416_100046660 3300032002 Bacteria 3421
404 Ga0307416_100113999 3300032002 Bacteria 2390
405 Ga0307414_10000136 3300032004 Bacteria 49913
406 Ga0307414_10000995 3300032004 Bacteria 14479
407 Ga0307414_10003089 3300032004 Bacteria 8840
408 Ga0307414_10004100 3300032004 Bacteria 7865
409 Ga0307414_10017352 3300032004 Bacteria 4401
410 Ga0307414_10023131 3300032004 Bacteria 3935
411 Ga0307414_10035536 3300032004 Bacteria 3317
412 Ga0307411_10000441 3300032005 Bacteria 14203
413 Ga0307411_10003230 3300032005 Bacteria 7508
414 Ga0307411_10007622 3300032005 Bacteria 5536
415 Ga0307411_10012708 3300032005 Bacteria 4610
416 Ga0307411_10013516 3300032005 Bacteria 4506
417 Ga0307411_10018759 3300032005 Bacteria 3978
418 Ga0307411_10021587 3300032005 Bacteria 3771
419 Ga0307411_10021952 3300032005 Bacteria 3748
420 Ga0307411_10023045 3300032005 Bacteria 3679
421 Ga0307411_10023710 3300032005 Bacteria 3641
422 Ga0307411_10025517 3300032005 Bacteria 3542
423 Ga0307411_10037181 3300032005 Bacteria 3058
424 Ga0307411_10038381 3300032005 Bacteria 3021
425 Ga0307411_10064172 3300032005 Bacteria 2458
426 Ga0395899_0000837 3300037312 Bacteria 29680
427 Ga0395899_0003076 3300037312 Bacteria 13291
428 Ga0395899_0007485 3300037312 Bacteria 8434
429 Ga0395899_0011843 3300037312 Bacteria 6678
430 Ga0395900_0000243 3300037418 Bacteria 85908
431 Ga0395900_0001848 3300037418 Bacteria 24139
432 Ga0395900_0031807 3300037418 Bacteria 5423
433 Ga0395898_0005294 3300037466 Bacteria 13952
434 Ga0395898_0013354 3300037466 Bacteria 8459
435 Ga0395898_0121552 3300037466 Bacteria 2502
436 Ga0395905_0000083 3300037471 Bacteria 158407
437 Ga0395905_0018223 3300037471 Bacteria 6664
438 Ga0395905_0022744 3300037471 Bacteria 5928
439 Ga0395905_0036112 3300037471 Bacteria 4641
440 Ga0395905_0040165 3300037471 Bacteria 4389
441 Ga0395901_0000636 3300038443 Bacteria 40673
442 Ga0395901_0001104 3300038443 Bacteria 28702
443 Ga0395901_0010395 3300038443 Bacteria 9427
444 Ga0395901_0014696 3300038443 Bacteria 7955
445 Ga0395901_0111012 3300038443 Bacteria 2879
446 Ga0395901_0165297 3300038443 Bacteria 2323
447 Ga0439445_0000331 3300042004 Bacteria 9241
448 Ga0450889_000331 3300042144 Bacteria 5294
449 Ga0466966_0000052 3300044684 Bacteria 88472
450 Ga0466966_0020340 3300044684 Bacteria 4366
451 Ga0466961_0046975 3300044693 Bacteria 2761
452 Ga0466963_0002238 3300044694 Bacteria 10729
453 Ga0466971_0003576 3300044719 Bacteria 6642
454 Ga0466957_0002522 3300044842 Bacteria 9850
455 Ga0466957_0003954 3300044842 Bacteria 8187
456 Ga0466958_0003043 3300045836 Bacteria 8595
457 Ga0466967_0003689 3300045976 Bacteria 10081
458 Ga0466967_0004314 3300045976 Bacteria 9562
459 Ga0466967_0007255 3300045976 Bacteria 7972
460 Ga0466967_0065994 3300045976 Bacteria 3223
461 Ga0495663_0000819 3300046525 Bacteria 10636
462 Ga0495621_0014362 3300046539 Bacteria 2504
463 Ga0495668_0004393 3300046616 Bacteria 10040
464 Ga0495668_0011812 3300046616 Bacteria 5205
465 Ga0495625_0002794 3300046660 Bacteria 18407
466 Ga0495669_0000119 3300046684 Bacteria 50758
467 Ga0495669_0000314 3300046684 Bacteria 26728
468 Ga0496102_0037672 3300048905 Bacteria 4363
469 Ga0496110_0028222 3300048913 Bacteria 4817
470 Ga0496114_0009172 3300048917 Bacteria 7843
471 Ga0501074_0014479 3300049590 Bacteria 5739
472 nmdc:mga03683_28_c1 3300050489 Bacteria 12954
473 nmdc:mga03n38_1106_c1 3300050490 Bacteria 7450
474 nmdc:mga00v17_16145_c1 3300050491 Bacteria 4206
475 nmdc:mga0k408_9_c2 3300050493 Bacteria 64937
476 nmdc:mga07m45_13_c1 3300050496 Bacteria 65600
477 nmdc:mga06r32_63150_c1 3300050510 Bacteria 3569
478 nmdc:mga08y16_132666_c1 3300050511 Bacteria 2589
479 nmdc:mga0sz30_2661_c1 3300050516 Bacteria 6370
480 Ga0500592_000103 3300053116 Bacteria 18368
481 Ga0500595_002791 3300053119 Bacteria 8417
482 Ga0500658_0000056 3300053134 Bacteria 57016
483 Ga0500627_0006709 3300053158 Bacteria 3945
484 Ga0466962_0008676 3300061719 Bacteria 4874
485 2852656124 2852653556 Bacteria 4050083
486 2885427240 2885427238 Bacteria 2291351
487 Ga0466963_0009302
488 JGI24736J21556_1000460
489 JGI24740J21852_10001915
490 JGI24740J21852_10011489
491 JGI24739J22299_10001191
492 JGI24739J22299_10010407
493 JGI24737J22298_10000444
494 JGI24737J22298_10002443
495 JGI24738J21930_10000153
496 Ga0055536_1002122
497 Ga0055530_10000156
498 Ga0055530_10000275
499 Ga0055531_10000420
500 Ga0065715_10000972
501 Ga0070658_10000630
502 Ga0070658_10000665
503 Ga0070658_10004821
504 Ga0070658_10014428
505 Ga0070676_10009683
506 Ga0070676_10011481
507 Ga0070676_10014636
508 Ga0070683_100003186
509 Ga0070683_100004208
510 Ga0070683_100018399
511 Ga0070683_100061483
512 Ga0070670_100009284
513 Ga0070670_100010220
514 Ga0070670_100012951
515 Ga0070670_100014272
516 Ga0070670_100046743
517 Ga0070677_10000689
518 Ga0068869_100000057
519 Ga0068869_100046477
520 Ga0070680_100084648
521 Ga0068868_100016440
522 Ga0070660_100000442
523 Ga0070660_100000645
524 Ga0070660_100021259
525 Ga0070687_100025208
526 Ga0070661_100002014
527 Ga0070661_100003567
528 Ga0070661_100006166
529 Ga0070692_10003547
530 Ga0070692_10012206
531 Ga0070668_100023975
532 Ga0070669_100001694
533 Ga0070669_100084591
534 Ga0070675_100005147
535 Ga0070675_100010139
536 Ga0070671_100009141
537 Ga0070674_100018993
538 Ga0070673_100000352
539 Ga0070659_100000562
540 Ga0070659_100002401
541 Ga0070659_100004599
542 Ga0070659_100010933
543 Ga0070659_100011499
544 Ga0070659_100012984
545 Ga0070659_100013761
546 Ga0070667_100001186
547 Ga0070667_100015947
548 Ga0070667_100019994
549 Ga0070667_100024076
550 Ga0070705_100042018
551 Ga0070663_100002395
552 Ga0070663_100007516
553 Ga0070663_100008224
554 Ga0070663_100032395
555 Ga0070678_100062711
556 Ga0070662_100002262
557 Ga0070662_100003101
558 Ga0070662_100003283
559 Ga0070662_100009545
560 Ga0070662_100015027
561 Ga0070662_100035715
562 Ga0070681_10013358
563 Ga0070681_10045592
564 Ga0070681_10080615
565 Ga0068867_100001418
566 Ga0068867_100016079
567 Ga0070679_100033148
568 Ga0070679_100037180
569 Ga0070679_100046744
570 Ga0070679_100053285
571 Ga0068853_100002369
572 Ga0068853_100002634
573 Ga0068853_100003611
574 Ga0068853_100009730
575 Ga0068853_100045265
576 Ga0070672_100000309
577 Ga0070672_100004829
578 Ga0070672_100010340
579 Ga0070672_100090262
580 Ga0070696_100006268
581 Ga0070696_100048534
582 Ga0070693_100000698
583 Ga0070665_100005510
584 Ga0070665_100006328
585 Ga0070665_100010824
586 Ga0068855_100001245
587 Ga0068855_100003063
588 Ga0068855_100005207
589 Ga0068855_100015434
590 Ga0070664_100000609
591 Ga0070664_100003701
592 Ga0070664_100015711
593 Ga0070664_100020986
594 Ga0070664_100034371
595 Ga0070664_100083691
596 Ga0068857_100000301
597 Ga0068857_100009634
598 Ga0068857_100023056
599 Ga0068857_100080853
600 Ga0068854_100000997
601 Ga0068854_100003061
602 Ga0068854_100004153
603 Ga0068854_100016727
604 Ga0068856_100001106
605 Ga0068856_100002130
606 Ga0068856_100007498
607 Ga0068852_100000600
608 Ga0068852_100000738
609 Ga0068852_100005843
610 Ga0068852_100009925
611 Ga0068852_100013587
612 Ga0068859_100001556
613 Ga0068859_100001794
614 Ga0068859_100003042
615 Ga0068859_100009102
616 Ga0068859_100014071
617 Ga0068859_100021156
618 Ga0068859_100052033
619 Ga0068859_100079330
620 Ga0068864_100003083
621 Ga0068864_100006323
622 Ga0068864_100010784
623 Ga0068861_100009535
624 Ga0068851_10015187
625 Ga0068863_100000409
626 Ga0068863_100020859
627 Ga0068863_100118125
628 Ga0068858_100002214
629 Ga0068858_100005528
630 Ga0068860_100001875
631 Ga0068860_100007458
632 Ga0068860_100019091
633 Ga0068860_100020289
634 Ga0068862_100020255
635 Ga0068862_100027380
636 Ga0068862_100048390
637 Ga0075363_100000577
638 Ga0075364_10003376
639 Ga0075362_10000371
640 Ga0097621_100099534
641 Ga0075370_10000015
642 Ga0068871_100018891
643 Ga0068871_100055529
644 Ga0068865_100005461
645 Ga0097620_100001556
646 Ga0097620_100001794
647 Ga0097620_100003042
648 Ga0097620_100009102
649 Ga0097620_100014071
650 Ga0097620_100021156
651 Ga0097620_100052033
652 Ga0097620_100079333
653 Ga0105245_10000120
654 Ga0105243_10037949
655 Ga0105243_10067668
656 Ga0105241_10056278
657 Ga0105241_10076583
658 Ga0105248_10000070
659 Ga0105248_10002859
660 Ga0105248_10003929
661 Ga0105248_10005247
662 Ga0105248_10008876
663 Ga0105248_10031993
664 Ga0105248_10046514
665 Ga0105248_10102578
666 Ga0105237_10025292
667 Ga0105238_10002072
668 Ga0105238_10026729
669 Ga0105249_10033876
670 Ga0105249_10052655
671 Ga0105239_10070630
672 Ga0157373_10002655
673 Ga0157373_10003531
674 Ga0157373_10009481
675 Ga0157373_10011294
676 Ga0157373_10047270
677 Ga0157371_10002465
678 Ga0157370_10003109
679 Ga0157370_10059558
680 Ga0157369_10000106
681 Ga0157369_10006521
682 Ga0157369_10008741
683 Ga0157369_10011222
684 Ga0157369_10046377
685 Ga0157378_10001619
686 Ga0163162_10010419
687 Ga0163162_10029404
688 Ga0157372_10002444
689 Ga0157372_10002958
690 Ga0157372_10027150
691 Ga0157375_10009817
692 Ga0163163_10000135
693 Ga0163163_10006001
694 Ga0157380_10000669
695 Ga0157380_10003259
696 Ga0157380_10004997
697 Ga0157379_10026092
698 Ga0163161_10007150
699 Ga0209675_1000287
700 Ga0209676_1000146
701 Ga0209676_1000672
702 Ga0209025_1009480
703 Ga0209050_1000423
704 Ga0209257_1000267
705 Ga0207697_10000587
706 Ga0207697_10002519
707 Ga0207682_10000415
708 Ga0207688_10000620
709 Ga0207688_10007839
710 Ga0207680_10004619
711 Ga0207647_10000052
712 Ga0207647_10003727
713 Ga0207647_10009965
714 Ga0207645_10005537
715 Ga0207645_10013396
716 Ga0207705_10000059
717 Ga0207705_10000404
718 Ga0207705_10002368
719 Ga0207705_10004063
720 Ga0207705_10027918
721 Ga0207707_10051277
722 Ga0207695_10010655
723 Ga0207695_10034930
724 Ga0207660_10007518
725 Ga0207660_10022877
726 Ga0207657_10000548
727 Ga0207657_10002437
728 Ga0207657_10005327
729 Ga0207657_10005545
730 Ga0207657_10008404
731 Ga0207657_10008408
732 Ga0207657_10008461
733 Ga0207657_10011911
734 Ga0207657_10012371
735 Ga0207657_10024536
736 Ga0207657_10074543
737 Ga0207649_10000602
738 Ga0207649_10002420
739 Ga0207649_10003589
740 Ga0207649_10034376
741 Ga0207652_10037465
742 Ga0207652_10043245
743 Ga0207681_10003558
744 Ga0207694_10000403
745 Ga0207650_10033970
746 Ga0207659_10002774
747 Ga0207644_10012961
748 Ga0207644_10025328
749 Ga0207690_10000043
750 Ga0207690_10001256
751 Ga0207690_10002540
752 Ga0207690_10006811
753 Ga0207690_10022529
754 Ga0207690_10049128
755 Ga0207706_10000587
756 Ga0207706_10000862
757 Ga0207706_10002596
758 Ga0207706_10003520
759 Ga0207706_10004255
760 Ga0207706_10007199
761 Ga0207706_10016285
762 Ga0207704_10000950
763 Ga0207691_10000114
764 Ga0207691_10000758
765 Ga0207691_10021068
766 Ga0207691_10033716
767 Ga0207711_10000051
768 Ga0207711_10001010
769 Ga0207711_10001857
770 Ga0207711_10011817
771 Ga0207711_10108674
772 Ga0207689_10000014
773 Ga0207661_10008523
774 Ga0207661_10020563
775 Ga0207679_10000410
776 Ga0207679_10011033
777 Ga0207667_10002998
778 Ga0207667_10018226
779 Ga0207667_10019880
780 Ga0207667_10026030
781 Ga0207667_10028797
782 Ga0207667_10048235
783 Ga0207651_10000066
784 Ga0207651_10012681
785 Ga0207712_10014575
786 Ga0207668_10003485
787 Ga0207668_10020644
788 Ga0207640_10002990
789 Ga0207640_10003583
790 Ga0207640_10008555
791 Ga0207658_10001547
792 Ga0207677_10010047
793 Ga0207677_10027257
794 Ga0207703_10001096
795 Ga0207703_10002755
796 Ga0207703_10082679
797 Ga0207639_10000121
798 Ga0207639_10003558
799 Ga0207639_10003913
800 Ga0207639_10018638
801 Ga0207639_10035671
802 Ga0207639_10045435
803 Ga0207639_10057618
804 Ga0207678_10001544
805 Ga0207678_10001849
806 Ga0207678_10004371
807 Ga0207678_10007518
808 Ga0207678_10022436
809 Ga0207678_10033167
810 Ga0207702_10015021
811 Ga0207641_10000190
812 Ga0207641_10001627
813 Ga0207676_10000139
814 Ga0207676_10000259
815 Ga0207676_10006542
816 Ga0207674_10000060
817 Ga0207674_10000796
818 Ga0207674_10001147
819 Ga0207674_10009017
820 Ga0207674_10010722
821 Ga0207674_10066141
822 Ga0207675_100016988
823 Ga0207683_10020084
824 Ga0207698_10006456
825 Ga0207698_10022765
826 Ga0207698_10026454
827 Ga0207698_10044073
828 Ga0209974_10000395
829 Ga0209974_10007534
830 Ga0268266_10005183
831 Ga0268266_10006525
832 Ga0268266_10014261
833 Ga0268265_10002885
834 Ga0268265_10014839
835 Ga0268265_10054336
836 Ga0268265_10077529
837 Ga0268264_10003736
838 Ga0268264_10016549
839 Ga0268264_10041799
840 Ga0268264_10071580
841 Ga0307408_100014965
842 Ga0307408_100021486
843 Ga0307408_100026938
844 Ga0307408_100031629
845 Ga0307408_100036965
846 Ga0307408_100040443
847 Ga0307408_100055878
848 Ga0307508_10003862
849 Ga0307405_10003848
850 Ga0307405_10010440
851 Ga0307405_10011796
852 Ga0307405_10058106
853 Ga0307413_10005434
854 Ga0307413_10006512
855 Ga0307413_10006602
856 Ga0307413_10009616
857 Ga0307413_10013610
858 Ga0307413_10017723
859 Ga0307413_10025206
860 Ga0307413_10033404
861 Ga0307413_10038748
862 Ga0307413_10040548
863 Ga0307410_10003362
864 Ga0307410_10005704
865 Ga0307410_10008914
866 Ga0307410_10010081
867 Ga0307410_10032041
868 Ga0307406_10007595
869 Ga0307406_10022256
870 Ga0307406_10026198
871 Ga0307407_10002208
872 Ga0307407_10002574
873 Ga0307407_10007572
874 Ga0307407_10020112
875 Ga0307412_10009435
876 Ga0307412_10020259
877 Ga0307412_10040739
878 Ga0307412_10057705
879 Ga0307412_10061739
880 Ga0307409_100003192
881 Ga0307409_100019742
882 Ga0307409_100026828
883 Ga0307409_100044026
884 Ga0307409_100048042
885 Ga0307409_100104704
886 Ga0307416_100006269
887 Ga0307416_100006554
888 Ga0307416_100035322
889 Ga0307416_100046660
890 Ga0307416_100113999
891 Ga0307414_10000136
892 Ga0307414_10000995
893 Ga0307414_10003089
894 Ga0307414_10004100
895 Ga0307414_10017352
896 Ga0307414_10023131
897 Ga0307414_10035536
898 Ga0307411_10000441
899 Ga0307411_10003230
900 Ga0307411_10007622
901 Ga0307411_10012708
902 Ga0307411_10013516
903 Ga0307411_10018759
904 Ga0307411_10021587
905 Ga0307411_10021952
906 Ga0307411_10023045
907 Ga0307411_10023710
908 Ga0307411_10025517
909 Ga0307411_10037181
910 Ga0307411_10038381
911 Ga0307411_10064172
912 Ga0395899_0000837
913 Ga0395899_0003076
914 Ga0395899_0007485
915 Ga0395899_0011843
916 Ga0395900_0000243
917 Ga0395900_0001848
918 Ga0395900_0031807
919 Ga0395898_0005294
920 Ga0395898_0013354
921 Ga0395898_0121552
922 Ga0395905_0000083
923 Ga0395905_0018223
924 Ga0395905_0022744
925 Ga0395905_0036112
926 Ga0395905_0040165
927 Ga0395901_0000636
928 Ga0395901_0001104
929 Ga0395901_0010395
930 Ga0395901_0014696
931 Ga0395901_0111012
932 Ga0395901_0165297
933 Ga0439445_0000331
934 Ga0450889_000331
935 Ga0466966_0000052
936 Ga0466966_0020340
937 Ga0466961_0046975
938 Ga0466963_0002238
939 Ga0466971_0003576
940 Ga0466957_0002522
941 Ga0466957_0003954
942 Ga0466958_0003043
943 Ga0466967_0003689
944 Ga0466967_0004314
945 Ga0466967_0007255
946 Ga0466967_0065994
947 Ga0495663_0000819
948 Ga0495621_0014362
949 Ga0495668_0004393
950 Ga0495668_0011812
951 Ga0495625_0002794
952 Ga0495669_0000119
953 Ga0495669_0000314
954 Ga0496102_0037672
955 Ga0496110_0028222
956 Ga0496114_0009172
957 Ga0501074_0014479
958 nmdc:mga03683_28_c1
959 nmdc:mga03n38_1106_c1
960 nmdc:mga00v17_16145_c1
961 nmdc:mga0k408_9_c2
962 nmdc:mga07m45_13_c1
963 nmdc:mga06r32_63150_c1
964 nmdc:mga08y16_132666_c1
965 nmdc:mga0sz30_2661_c1
966 Ga0500592_000103
967 Ga0500595_002791
968 Ga0500658_0000056
969 Ga0500627_0006709
970 Ga0466962_0008676
971 2852656124
972 2885427240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00664

ABC_membrane

ABC transporter transmembrane region

177

446

0.93

PF00005

ABC_tran

ABC transporter

509

658

0.86

Map