F453265

General Info

Members Datasets Scaffolds Average Seq Length
486 206 972 145

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10079749|Ga0157378_100797494
Length 158
Sequence MAMSTGAGNQGAVPNINVTPLIDVLLVLLIIFMAITPLKPSRFEAKVPAEPKNQPQVNILPNPLTLVIAINKDTKQITLNNEPYGDVTDTDKLNQKLAETFKIRTDTGVFRENTNEIEKTVFIKSPKSVKYGDVVKVIDAAKAAGASPIGLQIDDLQD

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
163 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
172 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
173 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
174 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
175 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
176 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
177 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
178 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
179 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
180 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
181 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
184 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
185 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
186 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
187 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
188 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
189 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.65
Metatranscriptomes 5.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0.82
Rhizosphere 97.94
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10079749 3300013297 Bacteria 2956
2 LJQas_1000046 3300000549 Bacteria 19569
3 rootL2_10264206 3300003322 Bacteria 3361
4 Ga0058859_10676841 3300004798 Unclassified 1912
5 Ga0058861_11802428 3300004800 Bacteria 1071
6 Ga0058861_11952247 3300004800 Bacteria 2142
7 Ga0058862_10038142 3300004803 Bacteria 1846
8 Ga0058862_12796120 3300004803 Bacteria 1398
9 Ga0065712_10084275 3300005290 Bacteria 2777
10 Ga0065712_10172630 3300005290 Bacteria 1217
11 Ga0065707_10494611 3300005295 Unclassified 762
12 Ga0070658_10003151 3300005327 Bacteria 13607
13 Ga0070676_10020763 3300005328 Bacteria 3672
14 Ga0070676_10114180 3300005328 Bacteria 1686
15 Ga0070676_10644401 3300005328 Bacteria 768
16 Ga0070683_100125420 3300005329 Bacteria 2427
17 Ga0070683_100154230 3300005329 Bacteria 2178
18 Ga0070683_100399986 3300005329 Bacteria 1310
19 Ga0070690_100000977 3300005330 Bacteria 14547
20 Ga0070670_100050126 3300005331 Bacteria 3588
21 Ga0070670_100099889 3300005331 Bacteria 2497
22 Ga0070670_100248611 3300005331 Bacteria 1549
23 Ga0070670_100260486 3300005331 Bacteria 1512
24 Ga0070670_100461188 3300005331 Bacteria 1127
25 Ga0070670_100955932 3300005331 Unclassified 778
26 Ga0070677_10044115 3300005333 Bacteria 1773
27 Ga0070677_10212972 3300005333 Bacteria 939
28 Ga0068869_100246821 3300005334 Bacteria 1424
29 Ga0068869_100492525 3300005334 Bacteria 1022
30 Ga0070666_10012473 3300005335 Bacteria 5362
31 Ga0070680_100097086 3300005336 Bacteria 2443
32 Ga0070680_100376228 3300005336 Bacteria 1209
33 Ga0070680_100579723 3300005336 Unclassified 962
34 Ga0068868_100769500 3300005338 Unclassified 866
35 Ga0070689_100010033 3300005340 Bacteria 6742
36 Ga0070689_100025579 3300005340 Bacteria 4436
37 Ga0070689_100067048 3300005340 Bacteria 2797
38 Ga0070661_100055572 3300005344 Bacteria 2899
39 Ga0070661_100165681 3300005344 Bacteria 1676
40 Ga0070661_100294796 3300005344 Bacteria 1261
41 Ga0070661_100824143 3300005344 Unclassified 762
42 Ga0070675_100132307 3300005354 Bacteria 2126
43 Ga0070675_100256198 3300005354 Bacteria 1532
44 Ga0070675_100722791 3300005354 Bacteria 908
45 Ga0070671_100007104 3300005355 Bacteria 8955
46 Ga0070671_100088828 3300005355 Bacteria 2587
47 Ga0070671_100829441 3300005355 Bacteria 806
48 Ga0070674_100011504 3300005356 Bacteria 5391
49 Ga0070674_100195594 3300005356 Bacteria 1558
50 Ga0070674_100809520 3300005356 Bacteria 810
51 Ga0070674_100918755 3300005356 Unclassified 763
52 Ga0070673_100025384 3300005364 Bacteria 4361
53 Ga0070688_100028723 3300005365 Bacteria 3323
54 Ga0070688_100630536 3300005365 Unclassified 823
55 Ga0070659_100002653 3300005366 Bacteria 12737
56 Ga0070659_100169025 3300005366 Bacteria 1790
57 Ga0070667_100004085 3300005367 Bacteria 12347
58 Ga0070701_10679088 3300005438 Bacteria 690
59 Ga0070705_100216328 3300005440 Bacteria 1324
60 Ga0070694_100480812 3300005444 Bacteria 985
61 Ga0070663_101205926 3300005455 Bacteria 665
62 Ga0070663_101494202 3300005455 Unclassified 600
63 Ga0070678_100031519 3300005456 Bacteria 3659
64 Ga0070678_100325705 3300005456 Bacteria 1313
65 Ga0070678_100401847 3300005456 Bacteria 1190
66 Ga0070678_100444031 3300005456 Bacteria 1135
67 Ga0070662_100013218 3300005457 Bacteria 5488
68 Ga0070681_10093706 3300005458 Bacteria 2952
69 Ga0070681_10131336 3300005458 Bacteria 2436
70 Ga0070681_11366107 3300005458 Bacteria 632
71 Ga0070681_11366696 3300005458 Unclassified 632
72 Ga0068867_100407527 3300005459 Bacteria 1148
73 Ga0070685_10264029 3300005466 Bacteria 1146
74 Ga0070685_10327400 3300005466 Bacteria 1040
75 Ga0070698_100390155 3300005471 Bacteria 1325
76 Ga0070679_100343491 3300005530 Bacteria 1441
77 Ga0070679_100380275 3300005530 Bacteria 1359
78 Ga0070684_100369341 3300005535 Bacteria 1321
79 Ga0068853_100002484 3300005539 Bacteria 13816
80 Ga0068853_100003686 3300005539 Bacteria 11752
81 Ga0068853_100021398 3300005539 Bacteria 5392
82 Ga0068853_100070061 3300005539 Bacteria 3052
83 Ga0070672_100007152 3300005543 Bacteria 7552
84 Ga0070672_100197567 3300005543 Bacteria 1681
85 Ga0070672_100773659 3300005543 Bacteria 843
86 Ga0070672_100841508 3300005543 Bacteria 809
87 Ga0070686_100001495 3300005544 Bacteria 13151
88 Ga0070695_100225877 3300005545 Unclassified 1351
89 Ga0070665_100086207 3300005548 Bacteria 3146
90 Ga0070704_100025265 3300005549 Bacteria 3909
91 Ga0068855_100083114 3300005563 Bacteria 3709
92 Ga0068855_100227095 3300005563 Bacteria 2092
93 Ga0068855_100238703 3300005563 Bacteria 2032
94 Ga0068855_100778902 3300005563 Bacteria 1018
95 Ga0070664_100022476 3300005564 Bacteria 5200
96 Ga0070664_100114976 3300005564 Bacteria 2351
97 Ga0070664_100249484 3300005564 Bacteria 1595
98 Ga0070664_100268060 3300005564 Bacteria 1537
99 Ga0068857_100014840 3300005577 Bacteria 6794
100 Ga0068854_100020855 3300005578 Bacteria 4440
101 Ga0068854_100059280 3300005578 Bacteria 2766
102 Ga0068854_100206023 3300005578 Bacteria 1549
103 Ga0068856_100667901 3300005614 Bacteria 1060
104 Ga0068856_101783470 3300005614 Bacteria 627
105 Ga0068852_100755176 3300005616 Bacteria 985
106 Ga0068852_101237379 3300005616 Unclassified 768
107 Ga0068859_100045018 3300005617 Bacteria 4434
108 Ga0068859_100051292 3300005617 Bacteria 4146
109 Ga0068859_100083242 3300005617 Bacteria 3242
110 Ga0068859_100164441 3300005617 Bacteria 2298
111 Ga0068859_100594385 3300005617 Bacteria 1200
112 Ga0068859_100639759 3300005617 Bacteria 1156
113 Ga0068859_101028202 3300005617 Bacteria 905
114 Ga0068864_100112430 3300005618 Bacteria 2427
115 Ga0068861_100302457 3300005719 Bacteria 1386
116 Ga0068861_100342327 3300005719 Bacteria 1309
117 Ga0068861_100561038 3300005719 Bacteria 1042
118 Ga0068861_100874453 3300005719 Bacteria 849
119 Ga0068851_10056750 3300005834 Bacteria 1998
120 Ga0068870_10130033 3300005840 Bacteria 1461
121 Ga0068863_100021552 3300005841 Bacteria 6148
122 Ga0068863_100024193 3300005841 Bacteria 5793
123 Ga0068863_100046910 3300005841 Bacteria 4101
124 Ga0068863_100169969 3300005841 Bacteria 2091
125 Ga0068858_100014558 3300005842 Bacteria 7412
126 Ga0068858_100090697 3300005842 Bacteria 2844
127 Ga0068858_100121102 3300005842 Bacteria 2447
128 Ga0068858_100415473 3300005842 Unclassified 1293
129 Ga0068860_100009533 3300005843 Bacteria 9644
130 Ga0068860_100039584 3300005843 Bacteria 4509
131 Ga0068862_100012354 3300005844 Bacteria 7060
132 Ga0068862_100164834 3300005844 Bacteria 1980
133 Ga0068862_100203940 3300005844 Bacteria 1784
134 Ga0068862_100617995 3300005844 Unclassified 1042
135 Ga0097621_100037170 3300006237 Bacteria 3899
136 Ga0097621_100037623 3300006237 Bacteria 3879
137 Ga0097621_100062165 3300006237 Bacteria 3065
138 Ga0068871_100006335 3300006358 Bacteria 8362
139 Ga0068871_100143375 3300006358 Bacteria 2032
140 Ga0068865_100009707 3300006881 Bacteria 5972
141 Ga0068865_100545274 3300006881 Bacteria 973
142 Ga0097620_100045017 3300006931 Bacteria 4434
143 Ga0097620_100051291 3300006931 Bacteria 4146
144 Ga0097620_100083242 3300006931 Bacteria 3242
145 Ga0097620_100164454 3300006931 Bacteria 2298
146 Ga0097620_100594317 3300006931 Bacteria 1200
147 Ga0097620_100639713 3300006931 Bacteria 1156
148 Ga0097620_101028245 3300006931 Bacteria 905
149 Ga0105240_10027492 3300009093 Bacteria 7446
150 Ga0105240_10072153 3300009093 Bacteria 4268
151 Ga0111539_10295630 3300009094 Bacteria 1884
152 Ga0105245_10038800 3300009098 Bacteria 4238
153 Ga0105247_10003372 3300009101 Bacteria 10452
154 Ga0105247_10031279 3300009101 Bacteria 3229
155 Ga0114129_11308702 3300009147 Unclassified 898
156 Ga0105243_10022372 3300009148 Bacteria 4804
157 Ga0105241_10011818 3300009174 Bacteria 6412
158 Ga0105241_10016645 3300009174 Bacteria 5396
159 Ga0105241_10568982 3300009174 Bacteria 1020
160 Ga0105242_10002021 3300009176 Bacteria 15959
161 Ga0105242_10514017 3300009176 Bacteria 1141
162 Ga0105248_10022710 3300009177 Bacteria 6962
163 Ga0105248_10048059 3300009177 Bacteria 4786
164 Ga0105248_10458270 3300009177 Bacteria 1437
165 Ga0105248_10528351 3300009177 Bacteria 1330
166 Ga0105237_10034430 3300009545 Bacteria 5128
167 Ga0105237_10122771 3300009545 Bacteria 2591
168 Ga0105237_10685595 3300009545 Unclassified 1031
169 Ga0105238_10193261 3300009551 Bacteria 2011
170 Ga0105249_10013312 3300009553 Bacteria 7264
171 Ga0105249_10025636 3300009553 Bacteria 5310
172 Ga0105249_10415650 3300009553 Bacteria 1378
173 Ga0105239_10038036 3300010375 Bacteria 5272
174 Ga0105239_10296953 3300010375 Bacteria 1819
175 Ga0105239_10391509 3300010375 Bacteria 1572
176 Ga0105239_10952292 3300010375 Bacteria 986
177 Ga0157373_10005770 3300013100 Bacteria 9270
178 Ga0157373_10049916 3300013100 Bacteria 2981
179 Ga0157373_10153488 3300013100 Bacteria 1620
180 Ga0157370_10091226 3300013104 Bacteria 2861
181 Ga0157370_10127515 3300013104 Bacteria 2375
182 Ga0157369_10024154 3300013105 Bacteria 6765
183 Ga0157369_10029573 3300013105 Bacteria 6053
184 Ga0157374_10191016 3300013296 Bacteria 2003
185 Ga0157374_10227231 3300013296 Bacteria 1833
186 Ga0157378_10009821 3300013297 Bacteria 8344
187 Ga0157378_10282808 3300013297 Bacteria 1599
188 Ga0157378_11245443 3300013297 Bacteria 784
189 Ga0157378_11438341 3300013297 Bacteria 733
190 Ga0157378_12410015 3300013297 Bacteria 578
191 Ga0163162_10005568 3300013306 Bacteria 12184
192 Ga0163162_10105838 3300013306 Bacteria 2907
193 Ga0163162_10288410 3300013306 Bacteria 1773
194 Ga0163162_10938163 3300013306 Bacteria 977
195 Ga0157372_10005151 3300013307 Bacteria 13898
196 Ga0157372_10247191 3300013307 Bacteria 2070
197 Ga0157372_10426497 3300013307 Bacteria 1546
198 Ga0157372_10734879 3300013307 Bacteria 1148
199 Ga0157375_10009349 3300013308 Bacteria 8604
200 Ga0157375_10117452 3300013308 Bacteria 2765
201 Ga0157375_10128708 3300013308 Bacteria 2650
202 Ga0157375_10156345 3300013308 Bacteria 2419
203 Ga0157375_10924079 3300013308 Bacteria 1015
204 Ga0163163_10001634 3300014325 Bacteria 18862
205 Ga0163163_10169781 3300014325 Bacteria 2228
206 Ga0163163_10352392 3300014325 Bacteria 1528
207 Ga0163163_10474141 3300014325 Bacteria 1312
208 Ga0163163_11564015 3300014325 Bacteria 721
209 Ga0157380_10019434 3300014326 Bacteria 5063
210 Ga0157380_10022818 3300014326 Bacteria 4719
211 Ga0157380_10028554 3300014326 Bacteria 4255
212 Ga0157380_10260124 3300014326 Bacteria 1576
213 Ga0157380_10430246 3300014326 Bacteria 1261
214 Ga0157379_10016638 3300014968 Bacteria 6467
215 Ga0157379_10671299 3300014968 Bacteria 971
216 Ga0157376_10030767 3300014969 Bacteria 4290
217 Ga0157376_10444302 3300014969 Bacteria 1263
218 Ga0157376_11741111 3300014969 Bacteria 659
219 Ga0157376_11751521 3300014969 Bacteria 657
220 Ga0163161_10003260 3300017792 Bacteria 11408
221 Ga0163161_10004498 3300017792 Bacteria 9700
222 Ga0163161_10081897 3300017792 Bacteria 2377
223 Ga0163161_10521412 3300017792 Bacteria 970
224 Ga0163161_11854867 3300017792 Bacteria 537
225 Ga0206356_10086126 3300020070 Bacteria 2488
226 Ga0206356_10569160 3300020070 Bacteria 696
227 Ga0206352_10504071 3300020078 Bacteria 3627
228 Ga0206352_10868348 3300020078 Bacteria 2263
229 Ga0207697_10149137 3300025315 Bacteria 1017
230 Ga0207682_10047281 3300025893 Bacteria 1771
231 Ga0207682_10142936 3300025893 Bacteria 1075
232 Ga0207710_10002224 3300025900 Bacteria 9125
233 Ga0207680_10104682 3300025903 Bacteria 1824
234 Ga0207645_10068323 3300025907 Bacteria 2272
235 Ga0207645_10125497 3300025907 Bacteria 1668
236 Ga0207645_10128829 3300025907 Bacteria 1646
237 Ga0207643_10199773 3300025908 Bacteria 1217
238 Ga0207705_10007741 3300025909 Bacteria 7895
239 Ga0207654_10058567 3300025911 Bacteria 2243
240 Ga0207654_10386092 3300025911 Bacteria 971
241 Ga0207654_10516993 3300025911 Bacteria 845
242 Ga0207707_10004139 3300025912 Bacteria 12848
243 Ga0207695_10100125 3300025913 Bacteria 2895
244 Ga0207660_10078520 3300025917 Bacteria 2419
245 Ga0207660_10493057 3300025917 Bacteria 994
246 Ga0207660_10958560 3300025917 Unclassified 698
247 Ga0207657_10012763 3300025919 Bacteria 8274
248 Ga0207649_10112158 3300025920 Bacteria 1824
249 Ga0207649_10114599 3300025920 Bacteria 1807
250 Ga0207649_10890969 3300025920 Unclassified 697
251 Ga0207652_10301432 3300025921 Bacteria 1446
252 Ga0207650_10002641 3300025925 Bacteria 12400
253 Ga0207650_10067090 3300025925 Bacteria 2691
254 Ga0207650_10127180 3300025925 Bacteria 1990
255 Ga0207650_10565783 3300025925 Bacteria 954
256 Ga0207659_10046334 3300025926 Bacteria 3070
257 Ga0207659_10578696 3300025926 Bacteria 956
258 Ga0207687_10116627 3300025927 Bacteria 1990
259 Ga0207644_10039451 3300025931 Bacteria 3333
260 Ga0207644_10057098 3300025931 Bacteria 2818
261 Ga0207690_10506283 3300025932 Bacteria 977
262 Ga0207706_10049676 3300025933 Bacteria 3706
263 Ga0207686_10029343 3300025934 Bacteria 3243
264 Ga0207670_10061539 3300025936 Unclassified 2562
265 Ga0207670_10069816 3300025936 Bacteria 2424
266 Ga0207670_10122693 3300025936 Bacteria 1891
267 Ga0207669_10009015 3300025937 Bacteria 4723
268 Ga0207669_10089757 3300025937 Bacteria 1997
269 Ga0207669_10398220 3300025937 Bacteria 1078
270 Ga0207704_10019542 3300025938 Bacteria 3561
271 Ga0207691_10007834 3300025940 Bacteria 10291
272 Ga0207691_10285111 3300025940 Bacteria 1421
273 Ga0207711_10013330 3300025941 Bacteria 6829
274 Ga0207711_10181837 3300025941 Bacteria 1912
275 Ga0207711_10274675 3300025941 Bacteria 1551
276 Ga0207711_10407972 3300025941 Unclassified 1263
277 Ga0207689_10107995 3300025942 Bacteria 2287
278 Ga0207661_10901667 3300025944 Bacteria 814
279 Ga0207661_11110299 3300025944 Bacteria 728
280 Ga0207679_10007789 3300025945 Bacteria 6806
281 Ga0207679_10038558 3300025945 Bacteria 3405
282 Ga0207679_10303524 3300025945 Bacteria 1377
283 Ga0207679_10936378 3300025945 Unclassified 793
284 Ga0207667_10111386 3300025949 Bacteria 2823
285 Ga0207667_10292902 3300025949 Bacteria 1663
286 Ga0207667_10601427 3300025949 Bacteria 1109
287 Ga0207651_10212552 3300025960 Bacteria 1558
288 Ga0207651_10796001 3300025960 Bacteria 838
289 Ga0207712_10015022 3300025961 Bacteria 4989
290 Ga0207712_10080565 3300025961 Bacteria 2369
291 Ga0207712_10297164 3300025961 Bacteria 1324
292 Ga0207668_10102868 3300025972 Bacteria 2126
293 Ga0207668_10167443 3300025972 Bacteria 1720
294 Ga0207668_11371176 3300025972 Bacteria 637
295 Ga0207640_10084434 3300025981 Bacteria 2180
296 Ga0207640_10143909 3300025981 Bacteria 1742
297 Ga0207658_10469794 3300025986 Bacteria 1116
298 Ga0207677_10250413 3300026023 Bacteria 1438
299 Ga0207703_10007286 3300026035 Bacteria 8794
300 Ga0207703_10099532 3300026035 Bacteria 2461
301 Ga0207703_10337068 3300026035 Unclassified 1385
302 Ga0207639_10006642 3300026041 Bacteria 7866
303 Ga0207639_10032399 3300026041 Bacteria 3847
304 Ga0207639_10088499 3300026041 Bacteria 2471
305 Ga0207639_10439610 3300026041 Bacteria 1182
306 Ga0207678_10614196 3300026067 Unclassified 954
307 Ga0207702_10559837 3300026078 Bacteria 1119
308 Ga0207641_10006727 3300026088 Bacteria 9631
309 Ga0207641_10115074 3300026088 Bacteria 2391
310 Ga0207641_10412127 3300026088 Bacteria 1299
311 Ga0207648_10114283 3300026089 Bacteria 2372
312 Ga0207648_10141963 3300026089 Bacteria 2117
313 Ga0207676_10012444 3300026095 Bacteria 6097
314 Ga0207676_10190129 3300026095 Bacteria 1806
315 Ga0207676_10199548 3300026095 Bacteria 1766
316 Ga0207676_10233282 3300026095 Bacteria 1646
317 Ga0207674_10093872 3300026116 Bacteria 2988
318 Ga0207674_10737605 3300026116 Bacteria 951
319 Ga0207675_100024548 3300026118 Bacteria 5604
320 Ga0207675_100196953 3300026118 Bacteria 1934
321 Ga0207675_100610013 3300026118 Bacteria 1095
322 Ga0207675_100716993 3300026118 Bacteria 1010
323 Ga0207675_102163793 3300026118 Bacteria 572
324 Ga0207675_102523653 3300026118 Bacteria 525
325 Ga0207683_10076206 3300026121 Bacteria 2969
326 Ga0207683_10115804 3300026121 Bacteria 2403
327 Ga0207683_10155822 3300026121 Unclassified 2063
328 Ga0207683_10436246 3300026121 Bacteria 1207
329 Ga0207698_10208495 3300026142 Bacteria 1756
330 Ga0207698_10244633 3300026142 Bacteria 1637
331 Ga0207698_11497869 3300026142 Bacteria 690
332 Ga0209998_10087984 3300027717 Unclassified 759
333 Ga0209974_10390032 3300027876 Unclassified 545
334 Ga0268265_10008577 3300028380 Bacteria 6905
335 Ga0268265_10622894 3300028380 Bacteria 1034
336 Ga0268265_10975116 3300028380 Bacteria 836
337 Ga0268264_10011769 3300028381 Bacteria 7213
338 Ga0268264_10028781 3300028381 Bacteria 4548
339 Ga0268264_10433218 3300028381 Bacteria 1270
340 Ga0268264_10530169 3300028381 Bacteria 1152
341 Ga0307408_100061068 3300031548 Bacteria 2750
342 Ga0307408_100169262 3300031548 Bacteria 1743
343 Ga0307408_100517677 3300031548 Bacteria 1047
344 Ga0307408_101354416 3300031548 Bacteria 669
345 Ga0307516_10214753 3300031730 Bacteria 1636
346 Ga0307405_10003798 3300031731 Bacteria 7019
347 Ga0307405_10007521 3300031731 Bacteria 5455
348 Ga0307405_10028332 3300031731 Bacteria 3261
349 Ga0307405_10105849 3300031731 Bacteria 1896
350 Ga0307405_10138314 3300031731 Bacteria 1694
351 Ga0307405_10753315 3300031731 Unclassified 811
352 Ga0307405_10816649 3300031731 Bacteria 782
353 Ga0307413_10000602 3300031824 Bacteria 12075
354 Ga0307413_10000854 3300031824 Bacteria 10726
355 Ga0307413_10003030 3300031824 Bacteria 6980
356 Ga0307413_10038556 3300031824 Bacteria 2771
357 Ga0307413_10116723 3300031824 Bacteria 1799
358 Ga0307413_10172623 3300031824 Bacteria 1532
359 Ga0307413_10185822 3300031824 Bacteria 1487
360 Ga0307410_10000567 3300031852 Bacteria 15190
361 Ga0307410_10014225 3300031852 Bacteria 4675
362 Ga0307410_10053373 3300031852 Bacteria 2735
363 Ga0307410_10066988 3300031852 Bacteria 2476
364 Ga0307410_10090475 3300031852 Bacteria 2170
365 Ga0307410_10156389 3300031852 Bacteria 1703
366 Ga0307410_10274314 3300031852 Unclassified 1320
367 Ga0307410_10750971 3300031852 Bacteria 826
368 Ga0307410_11008868 3300031852 Unclassified 718
369 Ga0307406_10006358 3300031901 Bacteria 6517
370 Ga0307406_10035246 3300031901 Bacteria 3076
371 Ga0307406_10246086 3300031901 Bacteria 1344
372 Ga0307406_10293042 3300031901 Bacteria 1246
373 Ga0307406_10349754 3300031901 Unclassified 1154
374 Ga0307406_10550601 3300031901 Bacteria 944
375 Ga0307406_10937633 3300031901 Bacteria 739
376 Ga0307407_10008319 3300031903 Bacteria 4755
377 Ga0307407_10013878 3300031903 Bacteria 3925
378 Ga0307407_10025337 3300031903 Bacteria 3125
379 Ga0307407_10092647 3300031903 Bacteria 1856
380 Ga0307407_10113102 3300031903 Unclassified 1708
381 Ga0307407_10309498 3300031903 Bacteria 1104
382 Ga0307407_10497409 3300031903 Unclassified 893
383 Ga0307412_10011279 3300031911 Bacteria 5171
384 Ga0307412_10013941 3300031911 Bacteria 4727
385 Ga0307412_10070646 3300031911 Bacteria 2381
386 Ga0307412_10171647 3300031911 Bacteria 1622
387 Ga0307412_10467946 3300031911 Unclassified 1042
388 Ga0307409_100003662 3300031995 Bacteria 8410
389 Ga0307409_100021401 3300031995 Bacteria 4432
390 Ga0307409_100070043 3300031995 Bacteria 2782
391 Ga0307409_100158572 3300031995 Bacteria 1976
392 Ga0307409_100310341 3300031995 Bacteria 1472
393 Ga0307409_100474960 3300031995 Bacteria 1212
394 Ga0307409_100901948 3300031995 Bacteria 897
395 Ga0307409_100963878 3300031995 Unclassified 869
396 Ga0307409_100995013 3300031995 Bacteria 856
397 Ga0307409_101210314 3300031995 Bacteria 779
398 Ga0307416_100008359 3300032002 Bacteria 6670
399 Ga0307416_100014607 3300032002 Bacteria 5390
400 Ga0307416_100291161 3300032002 Bacteria 1616
401 Ga0307416_100552304 3300032002 Bacteria 1225
402 Ga0307416_101117276 3300032002 Bacteria 893
403 Ga0307416_103185098 3300032002 Unclassified 549
404 Ga0307414_10008549 3300032004 Bacteria 5815
405 Ga0307414_10011807 3300032004 Bacteria 5140
406 Ga0307414_10112888 3300032004 Bacteria 2073
407 Ga0307414_10243253 3300032004 Bacteria 1491
408 Ga0307414_10382513 3300032004 Unclassified 1217
409 Ga0307414_10726490 3300032004 Bacteria 901
410 Ga0307411_10002453 3300032005 Bacteria 8200
411 Ga0307411_10002771 3300032005 Bacteria 7886
412 Ga0307411_10111928 3300032005 Bacteria 1956
413 Ga0307411_10216035 3300032005 Bacteria 1484
414 Ga0307411_10591345 3300032005 Unclassified 953
415 Ga0307411_10724387 3300032005 Bacteria 869
416 Ga0307415_100000794 3300032126 Bacteria 14334
417 Ga0307415_100006472 3300032126 Bacteria 6323
418 Ga0307415_100044197 3300032126 Bacteria 2977
419 Ga0307415_100106817 3300032126 Bacteria 2067
420 Ga0307415_100109467 3300032126 Bacteria 2046
421 Ga0307415_100112033 3300032126 Bacteria 2027
422 Ga0307415_100204429 3300032126 Bacteria 1570
423 Ga0307415_100695645 3300032126 Bacteria 917
424 Ga0307415_100845435 3300032126 Bacteria 839
425 Ga0307415_100885484 3300032126 Bacteria 822
426 Ga0316574_0894563 3300035398 Unclassified 537
427 Ga0395900_0336560 3300037418 Bacteria 1486
428 Ga0395905_0150007 3300037471 Bacteria 2193
429 Ga0395905_0667950 3300037471 Bacteria 941
430 Ga0436365_1583972 3300039437 Unclassified 656
431 Ga0439436_0201972 3300041404 Unclassified 569
432 Ga0439465_0060468 3300041413 Unclassified 1255
433 Ga0439465_0148920 3300041413 Bacteria 835
434 Ga0451795_0552206 3300041456 Bacteria 617
435 Ga0451805_118233 3300041461 Bacteria 693
436 Ga0439432_233092 3300042006 Unclassified 530
437 Ga0439464_0164344 3300042439 Bacteria 698
438 Ga0495621_0149083 3300046539 Bacteria 919
439 Ga0495668_0000708 3300046616 Bacteria 40231
440 Ga0495668_0001582 3300046616 Bacteria 21462
441 Ga0496105_0360431 3300048908 Unclassified 1160
442 Ga0496114_0045624 3300048917 Bacteria 3642
443 Ga0501305_010090 3300049161 Bacteria 1254
444 Ga0501209_036417 3300049656 Bacteria 1279
445 Ga0501209_198663 3300049656 Unclassified 616
446 Ga0501214_072098 3300049659 Bacteria 566
447 Ga0501235_020382 3300049669 Bacteria 1472
448 Ga0501242_014814 3300049674 Bacteria 968
449 Ga0501243_007263 3300049675 Bacteria 1692
450 Ga0501247_000280 3300049677 Bacteria 3665
451 Ga0501249_000931 3300049679 Bacteria 6417
452 Ga0501253_222677 3300049683 Bacteria 506
453 Ga0501257_006705 3300049686 Bacteria 2559
454 Ga0501258_001770 3300049687 Bacteria 1820
455 Ga0501259_016070 3300049688 Bacteria 1283
456 Ga0501225_0024107 3300049705 Bacteria 1675
457 Ga0501225_0035084 3300049705 Unclassified 1381
458 Ga0501229_008176 3300049706 Bacteria 1306
459 Ga0501263_001142 3300049760 Bacteria 2399
460 Ga0501263_043949 3300049760 Unclassified 663
461 Ga0501267_000918 3300049764 Bacteria 2418
462 Ga0501268_000095 3300049765 Bacteria 7222
463 Ga0501270_000746 3300049767 Bacteria 2889
464 Ga0501272_014986 3300049769 Bacteria 900
465 Ga0501273_002350 3300049770 Bacteria 1916
466 nmdc:mga08y16_1235823_c1 3300050511 Bacteria 716
467 nmdc:mga08y16_742357_c1 3300050511 Bacteria 978
468 nmdc:mga08y16_978446_c1 3300050511 Bacteria 827
469 Ga0500568_0068702 3300053139 Bacteria 1360
470 Ga0500616_0001207 3300053153 Bacteria 26194
471 Ga0501084_1593983 3300054114 Bacteria 546
472 Ga0587070_048906 3300059491 Unclassified 837
473 Ga0587070_158247 3300059491 Bacteria 573
474 Ga0587073_0052621 3300059492 Unclassified 928
475 Ga0587085_076697 3300059506 Bacteria 665
476 Ga0587091_023377 3300059511 Unclassified 1100
477 Ga0587125_000457 3300059607 Bacteria 2400
478 Ga0587101_001439 3300059623 Bacteria 2052
479 Ga0587109_033597 3300059624 Bacteria 986
480 Ga0587128_005250 3300059630 Bacteria 1539
481 Ga0587076_002257 3300059645 Bacteria 2133
482 Ga0587076_076268 3300059645 Bacteria 706
483 Ga0587079_009436 3300059647 Bacteria 1519
484 Ga0587124_000106 3300059660 Bacteria 3379
485 Ga0587071_018241 3300060344 Bacteria 1259
486 Ga0587111_0070313 3300060346 Bacteria 816
487 Ga0157378_10079749
488 LJQas_1000046
489 rootL2_10264206
490 Ga0058859_10676841
491 Ga0058861_11802428
492 Ga0058861_11952247
493 Ga0058862_10038142
494 Ga0058862_12796120
495 Ga0065712_10084275
496 Ga0065712_10172630
497 Ga0065707_10494611
498 Ga0070658_10003151
499 Ga0070676_10020763
500 Ga0070676_10114180
501 Ga0070676_10644401
502 Ga0070683_100125420
503 Ga0070683_100154230
504 Ga0070683_100399986
505 Ga0070690_100000977
506 Ga0070670_100050126
507 Ga0070670_100099889
508 Ga0070670_100248611
509 Ga0070670_100260486
510 Ga0070670_100461188
511 Ga0070670_100955932
512 Ga0070677_10044115
513 Ga0070677_10212972
514 Ga0068869_100246821
515 Ga0068869_100492525
516 Ga0070666_10012473
517 Ga0070680_100097086
518 Ga0070680_100376228
519 Ga0070680_100579723
520 Ga0068868_100769500
521 Ga0070689_100010033
522 Ga0070689_100025579
523 Ga0070689_100067048
524 Ga0070661_100055572
525 Ga0070661_100165681
526 Ga0070661_100294796
527 Ga0070661_100824143
528 Ga0070675_100132307
529 Ga0070675_100256198
530 Ga0070675_100722791
531 Ga0070671_100007104
532 Ga0070671_100088828
533 Ga0070671_100829441
534 Ga0070674_100011504
535 Ga0070674_100195594
536 Ga0070674_100809520
537 Ga0070674_100918755
538 Ga0070673_100025384
539 Ga0070688_100028723
540 Ga0070688_100630536
541 Ga0070659_100002653
542 Ga0070659_100169025
543 Ga0070667_100004085
544 Ga0070701_10679088
545 Ga0070705_100216328
546 Ga0070694_100480812
547 Ga0070663_101205926
548 Ga0070663_101494202
549 Ga0070678_100031519
550 Ga0070678_100325705
551 Ga0070678_100401847
552 Ga0070678_100444031
553 Ga0070662_100013218
554 Ga0070681_10093706
555 Ga0070681_10131336
556 Ga0070681_11366107
557 Ga0070681_11366696
558 Ga0068867_100407527
559 Ga0070685_10264029
560 Ga0070685_10327400
561 Ga0070698_100390155
562 Ga0070679_100343491
563 Ga0070679_100380275
564 Ga0070684_100369341
565 Ga0068853_100002484
566 Ga0068853_100003686
567 Ga0068853_100021398
568 Ga0068853_100070061
569 Ga0070672_100007152
570 Ga0070672_100197567
571 Ga0070672_100773659
572 Ga0070672_100841508
573 Ga0070686_100001495
574 Ga0070695_100225877
575 Ga0070665_100086207
576 Ga0070704_100025265
577 Ga0068855_100083114
578 Ga0068855_100227095
579 Ga0068855_100238703
580 Ga0068855_100778902
581 Ga0070664_100022476
582 Ga0070664_100114976
583 Ga0070664_100249484
584 Ga0070664_100268060
585 Ga0068857_100014840
586 Ga0068854_100020855
587 Ga0068854_100059280
588 Ga0068854_100206023
589 Ga0068856_100667901
590 Ga0068856_101783470
591 Ga0068852_100755176
592 Ga0068852_101237379
593 Ga0068859_100045018
594 Ga0068859_100051292
595 Ga0068859_100083242
596 Ga0068859_100164441
597 Ga0068859_100594385
598 Ga0068859_100639759
599 Ga0068859_101028202
600 Ga0068864_100112430
601 Ga0068861_100302457
602 Ga0068861_100342327
603 Ga0068861_100561038
604 Ga0068861_100874453
605 Ga0068851_10056750
606 Ga0068870_10130033
607 Ga0068863_100021552
608 Ga0068863_100024193
609 Ga0068863_100046910
610 Ga0068863_100169969
611 Ga0068858_100014558
612 Ga0068858_100090697
613 Ga0068858_100121102
614 Ga0068858_100415473
615 Ga0068860_100009533
616 Ga0068860_100039584
617 Ga0068862_100012354
618 Ga0068862_100164834
619 Ga0068862_100203940
620 Ga0068862_100617995
621 Ga0097621_100037170
622 Ga0097621_100037623
623 Ga0097621_100062165
624 Ga0068871_100006335
625 Ga0068871_100143375
626 Ga0068865_100009707
627 Ga0068865_100545274
628 Ga0097620_100045017
629 Ga0097620_100051291
630 Ga0097620_100083242
631 Ga0097620_100164454
632 Ga0097620_100594317
633 Ga0097620_100639713
634 Ga0097620_101028245
635 Ga0105240_10027492
636 Ga0105240_10072153
637 Ga0111539_10295630
638 Ga0105245_10038800
639 Ga0105247_10003372
640 Ga0105247_10031279
641 Ga0114129_11308702
642 Ga0105243_10022372
643 Ga0105241_10011818
644 Ga0105241_10016645
645 Ga0105241_10568982
646 Ga0105242_10002021
647 Ga0105242_10514017
648 Ga0105248_10022710
649 Ga0105248_10048059
650 Ga0105248_10458270
651 Ga0105248_10528351
652 Ga0105237_10034430
653 Ga0105237_10122771
654 Ga0105237_10685595
655 Ga0105238_10193261
656 Ga0105249_10013312
657 Ga0105249_10025636
658 Ga0105249_10415650
659 Ga0105239_10038036
660 Ga0105239_10296953
661 Ga0105239_10391509
662 Ga0105239_10952292
663 Ga0157373_10005770
664 Ga0157373_10049916
665 Ga0157373_10153488
666 Ga0157370_10091226
667 Ga0157370_10127515
668 Ga0157369_10024154
669 Ga0157369_10029573
670 Ga0157374_10191016
671 Ga0157374_10227231
672 Ga0157378_10009821
673 Ga0157378_10282808
674 Ga0157378_11245443
675 Ga0157378_11438341
676 Ga0157378_12410015
677 Ga0163162_10005568
678 Ga0163162_10105838
679 Ga0163162_10288410
680 Ga0163162_10938163
681 Ga0157372_10005151
682 Ga0157372_10247191
683 Ga0157372_10426497
684 Ga0157372_10734879
685 Ga0157375_10009349
686 Ga0157375_10117452
687 Ga0157375_10128708
688 Ga0157375_10156345
689 Ga0157375_10924079
690 Ga0163163_10001634
691 Ga0163163_10169781
692 Ga0163163_10352392
693 Ga0163163_10474141
694 Ga0163163_11564015
695 Ga0157380_10019434
696 Ga0157380_10022818
697 Ga0157380_10028554
698 Ga0157380_10260124
699 Ga0157380_10430246
700 Ga0157379_10016638
701 Ga0157379_10671299
702 Ga0157376_10030767
703 Ga0157376_10444302
704 Ga0157376_11741111
705 Ga0157376_11751521
706 Ga0163161_10003260
707 Ga0163161_10004498
708 Ga0163161_10081897
709 Ga0163161_10521412
710 Ga0163161_11854867
711 Ga0206356_10086126
712 Ga0206356_10569160
713 Ga0206352_10504071
714 Ga0206352_10868348
715 Ga0207697_10149137
716 Ga0207682_10047281
717 Ga0207682_10142936
718 Ga0207710_10002224
719 Ga0207680_10104682
720 Ga0207645_10068323
721 Ga0207645_10125497
722 Ga0207645_10128829
723 Ga0207643_10199773
724 Ga0207705_10007741
725 Ga0207654_10058567
726 Ga0207654_10386092
727 Ga0207654_10516993
728 Ga0207707_10004139
729 Ga0207695_10100125
730 Ga0207660_10078520
731 Ga0207660_10493057
732 Ga0207660_10958560
733 Ga0207657_10012763
734 Ga0207649_10112158
735 Ga0207649_10114599
736 Ga0207649_10890969
737 Ga0207652_10301432
738 Ga0207650_10002641
739 Ga0207650_10067090
740 Ga0207650_10127180
741 Ga0207650_10565783
742 Ga0207659_10046334
743 Ga0207659_10578696
744 Ga0207687_10116627
745 Ga0207644_10039451
746 Ga0207644_10057098
747 Ga0207690_10506283
748 Ga0207706_10049676
749 Ga0207686_10029343
750 Ga0207670_10061539
751 Ga0207670_10069816
752 Ga0207670_10122693
753 Ga0207669_10009015
754 Ga0207669_10089757
755 Ga0207669_10398220
756 Ga0207704_10019542
757 Ga0207691_10007834
758 Ga0207691_10285111
759 Ga0207711_10013330
760 Ga0207711_10181837
761 Ga0207711_10274675
762 Ga0207711_10407972
763 Ga0207689_10107995
764 Ga0207661_10901667
765 Ga0207661_11110299
766 Ga0207679_10007789
767 Ga0207679_10038558
768 Ga0207679_10303524
769 Ga0207679_10936378
770 Ga0207667_10111386
771 Ga0207667_10292902
772 Ga0207667_10601427
773 Ga0207651_10212552
774 Ga0207651_10796001
775 Ga0207712_10015022
776 Ga0207712_10080565
777 Ga0207712_10297164
778 Ga0207668_10102868
779 Ga0207668_10167443
780 Ga0207668_11371176
781 Ga0207640_10084434
782 Ga0207640_10143909
783 Ga0207658_10469794
784 Ga0207677_10250413
785 Ga0207703_10007286
786 Ga0207703_10099532
787 Ga0207703_10337068
788 Ga0207639_10006642
789 Ga0207639_10032399
790 Ga0207639_10088499
791 Ga0207639_10439610
792 Ga0207678_10614196
793 Ga0207702_10559837
794 Ga0207641_10006727
795 Ga0207641_10115074
796 Ga0207641_10412127
797 Ga0207648_10114283
798 Ga0207648_10141963
799 Ga0207676_10012444
800 Ga0207676_10190129
801 Ga0207676_10199548
802 Ga0207676_10233282
803 Ga0207674_10093872
804 Ga0207674_10737605
805 Ga0207675_100024548
806 Ga0207675_100196953
807 Ga0207675_100610013
808 Ga0207675_100716993
809 Ga0207675_102163793
810 Ga0207675_102523653
811 Ga0207683_10076206
812 Ga0207683_10115804
813 Ga0207683_10155822
814 Ga0207683_10436246
815 Ga0207698_10208495
816 Ga0207698_10244633
817 Ga0207698_11497869
818 Ga0209998_10087984
819 Ga0209974_10390032
820 Ga0268265_10008577
821 Ga0268265_10622894
822 Ga0268265_10975116
823 Ga0268264_10011769
824 Ga0268264_10028781
825 Ga0268264_10433218
826 Ga0268264_10530169
827 Ga0307408_100061068
828 Ga0307408_100169262
829 Ga0307408_100517677
830 Ga0307408_101354416
831 Ga0307516_10214753
832 Ga0307405_10003798
833 Ga0307405_10007521
834 Ga0307405_10028332
835 Ga0307405_10105849
836 Ga0307405_10138314
837 Ga0307405_10753315
838 Ga0307405_10816649
839 Ga0307413_10000602
840 Ga0307413_10000854
841 Ga0307413_10003030
842 Ga0307413_10038556
843 Ga0307413_10116723
844 Ga0307413_10172623
845 Ga0307413_10185822
846 Ga0307410_10000567
847 Ga0307410_10014225
848 Ga0307410_10053373
849 Ga0307410_10066988
850 Ga0307410_10090475
851 Ga0307410_10156389
852 Ga0307410_10274314
853 Ga0307410_10750971
854 Ga0307410_11008868
855 Ga0307406_10006358
856 Ga0307406_10035246
857 Ga0307406_10246086
858 Ga0307406_10293042
859 Ga0307406_10349754
860 Ga0307406_10550601
861 Ga0307406_10937633
862 Ga0307407_10008319
863 Ga0307407_10013878
864 Ga0307407_10025337
865 Ga0307407_10092647
866 Ga0307407_10113102
867 Ga0307407_10309498
868 Ga0307407_10497409
869 Ga0307412_10011279
870 Ga0307412_10013941
871 Ga0307412_10070646
872 Ga0307412_10171647
873 Ga0307412_10467946
874 Ga0307409_100003662
875 Ga0307409_100021401
876 Ga0307409_100070043
877 Ga0307409_100158572
878 Ga0307409_100310341
879 Ga0307409_100474960
880 Ga0307409_100901948
881 Ga0307409_100963878
882 Ga0307409_100995013
883 Ga0307409_101210314
884 Ga0307416_100008359
885 Ga0307416_100014607
886 Ga0307416_100291161
887 Ga0307416_100552304
888 Ga0307416_101117276
889 Ga0307416_103185098
890 Ga0307414_10008549
891 Ga0307414_10011807
892 Ga0307414_10112888
893 Ga0307414_10243253
894 Ga0307414_10382513
895 Ga0307414_10726490
896 Ga0307411_10002453
897 Ga0307411_10002771
898 Ga0307411_10111928
899 Ga0307411_10216035
900 Ga0307411_10591345
901 Ga0307411_10724387
902 Ga0307415_100000794
903 Ga0307415_100006472
904 Ga0307415_100044197
905 Ga0307415_100106817
906 Ga0307415_100109467
907 Ga0307415_100112033
908 Ga0307415_100204429
909 Ga0307415_100695645
910 Ga0307415_100845435
911 Ga0307415_100885484
912 Ga0316574_0894563
913 Ga0395900_0336560
914 Ga0395905_0150007
915 Ga0395905_0667950
916 Ga0436365_1583972
917 Ga0439436_0201972
918 Ga0439465_0060468
919 Ga0439465_0148920
920 Ga0451795_0552206
921 Ga0451805_118233
922 Ga0439432_233092
923 Ga0439464_0164344
924 Ga0495621_0149083
925 Ga0495668_0000708
926 Ga0495668_0001582
927 Ga0496105_0360431
928 Ga0496114_0045624
929 Ga0501305_010090
930 Ga0501209_036417
931 Ga0501209_198663
932 Ga0501214_072098
933 Ga0501235_020382
934 Ga0501242_014814
935 Ga0501243_007263
936 Ga0501247_000280
937 Ga0501249_000931
938 Ga0501253_222677
939 Ga0501257_006705
940 Ga0501258_001770
941 Ga0501259_016070
942 Ga0501225_0024107
943 Ga0501225_0035084
944 Ga0501229_008176
945 Ga0501263_001142
946 Ga0501263_043949
947 Ga0501267_000918
948 Ga0501268_000095
949 Ga0501270_000746
950 Ga0501272_014986
951 Ga0501273_002350
952 nmdc:mga08y16_1235823_c1
953 nmdc:mga08y16_742357_c1
954 nmdc:mga08y16_978446_c1
955 Ga0500568_0068702
956 Ga0500616_0001207
957 Ga0501084_1593983
958 Ga0587070_048906
959 Ga0587070_158247
960 Ga0587073_0052621
961 Ga0587085_076697
962 Ga0587091_023377
963 Ga0587125_000457
964 Ga0587101_001439
965 Ga0587109_033597
966 Ga0587128_005250
967 Ga0587076_002257
968 Ga0587076_076268
969 Ga0587079_009436
970 Ga0587124_000106
971 Ga0587071_018241
972 Ga0587111_0070313

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

9

156

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gph-assembly1.cif.gz_1 structure of the allosteric regulatory enzyme of purine biosynthesis 0.8213 106 141
6dg3-assembly1.cif.gz_K-2 lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.8052 108 143
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.7916 53 140
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.7637 53 140
4czj-assembly2.cif.gz_B c. crescentus mreb, double filament, amppnp 0.7216 80 141
ID Description Score Start End Superfamily
af_A4I5I9_9_225_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8237 106 142 3.30.420.40
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7552 106 141 3.40.50.2020
af_Q54IY2_24_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7059 109 143 3.40.50.720
af_F1R8V0_33_213_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7021 80 142 3.30.420.40
af_A0A0G2L4U4_1_160_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6996 109 142 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A849T2R7-F1-model_v4 Biopolymer transporter ExbD 0.9288 53 144 GO:0005886
GO:0015031
GO:0022857
AF-A0A136PGU9-F1-model_v4 deleted 0.9055 53 143
AF-A0A2A4WKM7-F1-model_v4 Biopolymer transporter ExbD 0.9002 52 143 GO:0005886
GO:0015031
GO:0022857
AF-B3E0F0-F1-model_v4 Biopolymer transport protein, MotA/TolQ/ExbB family 0.8951 53 143 GO:0005886
GO:0017038
GO:0022857
AF-A0A7C1D8K4-F1-model_v4 Protein TolR 0.8938 53 145 GO:0005886
GO:0015031
GO:0022857

Map