F453118
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 485 | 250 | 485 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10289559|Ga0207674_102895591 |
| Length | 252 |
| Sequence | MPTRVRPERGADPDVAQRSYRRGMTTNVTRLFLVRHGATQLTAEDRFSGSVGVDLSDEGRRQAAFLAERLALDAIAAVYASPLSRTFETAAIIARPHRLTPIERDGLREISHGRWEGLTRQEVEARYRDEYAAWEADPFTFAPEAGESGVAVLARALPVVREIVVRHAGQNVVVVSHKATLRLLLSSLLGFDARGYRDRLDQSPACLNVVDFKNPVRARLMLFNDISHYQNQPRRAEGNLSKWWDADGGAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 148 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 152 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 165 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 169 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 176 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 177 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 178 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 179 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 180 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 181 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 182 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 197 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 198 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 201 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 202 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 203 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 204 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 205 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 223 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 224 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 225 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 226 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 227 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 228 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 229 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 230 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 242 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 243 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 244 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 246 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 247 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 248 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 249 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.66 |
| Nodule | 0 |
| Rhizoplane | 4.12 |
| Rhizosphere | 85.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10165552 | 3300003323 | Bacteria | 2535 |
| 2 | Ga0070676_10002038 | 3300005328 | Bacteria | 10266 |
| 3 | Ga0070676_10074002 | 3300005328 | Unclassified | 2051 |
| 4 | Ga0070683_100005544 | 3300005329 | Bacteria | 10545 |
| 5 | Ga0070683_100006893 | 3300005329 | Bacteria | 9547 |
| 6 | Ga0070683_100342393 | 3300005329 | Bacteria | 1424 |
| 7 | Ga0070690_100001352 | 3300005330 | Bacteria | 12752 |
| 8 | Ga0070690_100065837 | 3300005330 | Bacteria | 2343 |
| 9 | Ga0068869_100036729 | 3300005334 | Bacteria | 3479 |
| 10 | Ga0068869_100061240 | 3300005334 | Bacteria | 2760 |
| 11 | Ga0070666_10354108 | 3300005335 | Unclassified | 1051 |
| 12 | Ga0070680_100022696 | 3300005336 | Bacteria | 5001 |
| 13 | Ga0070682_100208629 | 3300005337 | Bacteria | 1383 |
| 14 | Ga0068868_100055528 | 3300005338 | Bacteria | 3125 |
| 15 | Ga0068868_100099105 | 3300005338 | Bacteria | 2357 |
| 16 | Ga0068868_100119036 | 3300005338 | Unclassified | 2153 |
| 17 | Ga0070660_100010573 | 3300005339 | Bacteria | 6522 |
| 18 | Ga0070689_100010591 | 3300005340 | Bacteria | 6573 |
| 19 | Ga0070689_100011368 | 3300005340 | Bacteria | 6375 |
| 20 | Ga0070689_100014670 | 3300005340 | Bacteria | 5698 |
| 21 | Ga0070689_100072087 | 3300005340 | Bacteria | 2700 |
| 22 | Ga0070689_100255324 | 3300005340 | Bacteria | 1448 |
| 23 | Ga0070691_10014588 | 3300005341 | Bacteria | 3607 |
| 24 | Ga0070691_10072791 | 3300005341 | Bacteria | 1669 |
| 25 | Ga0070687_100059042 | 3300005343 | Bacteria | 2018 |
| 26 | Ga0070687_100075591 | 3300005343 | Bacteria | 1822 |
| 27 | Ga0070687_100138276 | 3300005343 | Bacteria | 1415 |
| 28 | Ga0070661_100340346 | 3300005344 | Bacteria | 1175 |
| 29 | Ga0070692_10149187 | 3300005345 | Unclassified | 1330 |
| 30 | Ga0070668_100009593 | 3300005347 | Bacteria | 7182 |
| 31 | Ga0070669_100095425 | 3300005353 | Unclassified | 2236 |
| 32 | Ga0070675_100000017 | 3300005354 | Bacteria | 180937 |
| 33 | Ga0070675_100047876 | 3300005354 | Bacteria | 3504 |
| 34 | Ga0070675_100799549 | 3300005354 | Unclassified | 862 |
| 35 | Ga0070674_100035647 | 3300005356 | Bacteria | 3334 |
| 36 | Ga0070673_100012483 | 3300005364 | Bacteria | 5833 |
| 37 | Ga0070673_100262266 | 3300005364 | Bacteria | 1510 |
| 38 | Ga0070673_100396401 | 3300005364 | Bacteria | 1233 |
| 39 | Ga0070688_100000437 | 3300005365 | Bacteria | 21038 |
| 40 | Ga0070688_100016828 | 3300005365 | Bacteria | 4186 |
| 41 | Ga0070688_100153784 | 3300005365 | Bacteria | 1574 |
| 42 | Ga0070659_100528267 | 3300005366 | Unclassified | 1008 |
| 43 | Ga0070709_10501696 | 3300005434 | Bacteria | 922 |
| 44 | Ga0070701_10012010 | 3300005438 | Bacteria | 3890 |
| 45 | Ga0070701_10227790 | 3300005438 | Bacteria | 1115 |
| 46 | Ga0070705_100016632 | 3300005440 | Bacteria | 3825 |
| 47 | Ga0070705_100186415 | 3300005440 | Bacteria | 1410 |
| 48 | Ga0070700_100000093 | 3300005441 | Bacteria | 60201 |
| 49 | Ga0070700_100003434 | 3300005441 | Bacteria | 8168 |
| 50 | Ga0070700_100142623 | 3300005441 | Bacteria | 1630 |
| 51 | Ga0070700_100329599 | 3300005441 | Bacteria | 1124 |
| 52 | Ga0070694_100009716 | 3300005444 | Bacteria | 5907 |
| 53 | Ga0070694_100122393 | 3300005444 | Bacteria | 1868 |
| 54 | Ga0070708_100392491 | 3300005445 | Bacteria | 1308 |
| 55 | Ga0070663_100046166 | 3300005455 | Bacteria | 3081 |
| 56 | Ga0070678_100040487 | 3300005456 | Bacteria | 3298 |
| 57 | Ga0070678_100090152 | 3300005456 | Bacteria | 2349 |
| 58 | Ga0070678_100187129 | 3300005456 | Bacteria | 1700 |
| 59 | Ga0070678_100322708 | 3300005456 | Unclassified | 1319 |
| 60 | Ga0070662_100125794 | 3300005457 | Unclassified | 1970 |
| 61 | Ga0070681_10012390 | 3300005458 | Bacteria | 8457 |
| 62 | Ga0068867_100005919 | 3300005459 | Bacteria | 8672 |
| 63 | Ga0070685_10004804 | 3300005466 | Bacteria | 6842 |
| 64 | Ga0070685_10011505 | 3300005466 | Bacteria | 4632 |
| 65 | Ga0070685_10434174 | 3300005466 | Unclassified | 916 |
| 66 | Ga0070706_100036336 | 3300005467 | Bacteria | 4549 |
| 67 | Ga0070706_100134490 | 3300005467 | Bacteria | 2308 |
| 68 | Ga0070706_100194753 | 3300005467 | Bacteria | 1894 |
| 69 | Ga0070707_100008429 | 3300005468 | Bacteria | 9575 |
| 70 | Ga0070707_100391834 | 3300005468 | Bacteria | 1349 |
| 71 | Ga0070698_100002974 | 3300005471 | Bacteria | 18643 |
| 72 | Ga0070698_100011845 | 3300005471 | Bacteria | 9252 |
| 73 | Ga0070698_100030672 | 3300005471 | Bacteria | 5574 |
| 74 | Ga0070698_100156298 | 3300005471 | Bacteria | 2226 |
| 75 | Ga0070698_100172151 | 3300005471 | Bacteria | 2106 |
| 76 | Ga0070699_100027788 | 3300005518 | Bacteria | 4878 |
| 77 | Ga0070699_100043189 | 3300005518 | Bacteria | 3902 |
| 78 | Ga0070699_100062134 | 3300005518 | Bacteria | 3237 |
| 79 | Ga0070699_100180459 | 3300005518 | Bacteria | 1873 |
| 80 | Ga0070679_100208887 | 3300005530 | Bacteria | 1916 |
| 81 | Ga0070684_100025046 | 3300005535 | Bacteria | 5011 |
| 82 | Ga0070684_100057334 | 3300005535 | Bacteria | 3401 |
| 83 | Ga0070684_100080971 | 3300005535 | Unclassified | 2873 |
| 84 | Ga0070684_100118662 | 3300005535 | Bacteria | 2378 |
| 85 | Ga0070697_100013378 | 3300005536 | Bacteria | 6436 |
| 86 | Ga0068853_100328621 | 3300005539 | Unclassified | 1419 |
| 87 | Ga0070672_100015292 | 3300005543 | Bacteria | 5461 |
| 88 | Ga0070686_100005262 | 3300005544 | Bacteria | 7149 |
| 89 | Ga0070686_100018108 | 3300005544 | Bacteria | 4128 |
| 90 | Ga0070686_100026899 | 3300005544 | Bacteria | 3476 |
| 91 | Ga0070695_100097202 | 3300005545 | Bacteria | 1977 |
| 92 | Ga0070695_100221606 | 3300005545 | Unclassified | 1363 |
| 93 | Ga0070696_100188009 | 3300005546 | Bacteria | 1536 |
| 94 | Ga0070696_100272639 | 3300005546 | Bacteria | 1287 |
| 95 | Ga0070693_100123452 | 3300005547 | Bacteria | 1609 |
| 96 | Ga0070704_100483719 | 3300005549 | Bacteria | 1071 |
| 97 | Ga0068855_100422377 | 3300005563 | Bacteria | 1458 |
| 98 | Ga0068854_100023598 | 3300005578 | Bacteria | 4204 |
| 99 | Ga0068854_100132448 | 3300005578 | Unclassified | 1905 |
| 100 | Ga0068856_100267817 | 3300005614 | Bacteria | 1724 |
| 101 | Ga0070702_100104918 | 3300005615 | Bacteria | 1741 |
| 102 | Ga0068852_100261537 | 3300005616 | Unclassified | 1662 |
| 103 | Ga0068859_100010892 | 3300005617 | Bacteria | 9152 |
| 104 | Ga0068859_100049689 | 3300005617 | Bacteria | 4212 |
| 105 | Ga0068859_100285061 | 3300005617 | Bacteria | 1745 |
| 106 | Ga0068859_100354065 | 3300005617 | Bacteria | 1563 |
| 107 | Ga0068864_100298744 | 3300005618 | Bacteria | 1507 |
| 108 | Ga0068861_100008361 | 3300005719 | Bacteria | 7119 |
| 109 | Ga0068870_10394379 | 3300005840 | Unclassified | 899 |
| 110 | Ga0068858_100022759 | 3300005842 | Bacteria | 5843 |
| 111 | Ga0068858_100267610 | 3300005842 | Unclassified | 1625 |
| 112 | Ga0068860_100238616 | 3300005843 | Unclassified | 1768 |
| 113 | Ga0068862_100144619 | 3300005844 | Unclassified | 2112 |
| 114 | Ga0068862_100520412 | 3300005844 | Bacteria | 1132 |
| 115 | Ga0070717_10243789 | 3300006028 | Bacteria | 1586 |
| 116 | Ga0075365_10017162 | 3300006038 | Bacteria | 4421 |
| 117 | Ga0075365_10039453 | 3300006038 | Bacteria | 3075 |
| 118 | Ga0075368_10033002 | 3300006042 | Bacteria | 2013 |
| 119 | Ga0075363_100066942 | 3300006048 | Bacteria | 1945 |
| 120 | Ga0075364_10004869 | 3300006051 | Bacteria | 7777 |
| 121 | Ga0075364_10005908 | 3300006051 | Bacteria | 7152 |
| 122 | Ga0075364_10029427 | 3300006051 | Bacteria | 3522 |
| 123 | Ga0075362_10000540 | 3300006177 | Bacteria | 11030 |
| 124 | Ga0075362_10009703 | 3300006177 | Bacteria | 3733 |
| 125 | Ga0075367_10004419 | 3300006178 | Bacteria | 6867 |
| 126 | Ga0075367_10053238 | 3300006178 | Bacteria | 2398 |
| 127 | Ga0075367_10117507 | 3300006178 | Bacteria | 1637 |
| 128 | Ga0075367_10118443 | 3300006178 | Bacteria | 1630 |
| 129 | Ga0075367_10383747 | 3300006178 | Unclassified | 888 |
| 130 | Ga0075369_10097159 | 3300006186 | Bacteria | 1319 |
| 131 | Ga0075366_10002022 | 3300006195 | Bacteria | 10294 |
| 132 | Ga0075366_10002099 | 3300006195 | Bacteria | 10134 |
| 133 | Ga0075366_10050017 | 3300006195 | Bacteria | 2481 |
| 134 | Ga0097621_100009912 | 3300006237 | Bacteria | 6940 |
| 135 | Ga0075370_10012782 | 3300006353 | Bacteria | 4446 |
| 136 | Ga0075370_10087532 | 3300006353 | Bacteria | 1795 |
| 137 | Ga0068871_100006098 | 3300006358 | Bacteria | 8487 |
| 138 | Ga0068871_100258614 | 3300006358 | Bacteria | 1518 |
| 139 | Ga0075428_100017953 | 3300006844 | Bacteria | 7818 |
| 140 | Ga0075428_100049932 | 3300006844 | Bacteria | 4589 |
| 141 | Ga0075428_100071381 | 3300006844 | Bacteria | 3795 |
| 142 | Ga0075428_100453172 | 3300006844 | Unclassified | 1374 |
| 143 | Ga0075428_100514911 | 3300006844 | Bacteria | 1280 |
| 144 | Ga0075430_100616594 | 3300006846 | Unclassified | 895 |
| 145 | Ga0075430_100735114 | 3300006846 | Bacteria | 813 |
| 146 | Ga0075431_100013319 | 3300006847 | Bacteria | 8311 |
| 147 | Ga0075431_100071440 | 3300006847 | Bacteria | 3581 |
| 148 | Ga0075433_10037480 | 3300006852 | Bacteria | 4183 |
| 149 | Ga0075433_10042542 | 3300006852 | Bacteria | 3942 |
| 150 | Ga0075433_10047644 | 3300006852 | Bacteria | 3728 |
| 151 | Ga0075433_10101326 | 3300006852 | Bacteria | 2550 |
| 152 | Ga0075433_10595456 | 3300006852 | Bacteria | 971 |
| 153 | Ga0075433_10778201 | 3300006852 | Unclassified | 837 |
| 154 | Ga0075434_100024686 | 3300006871 | Bacteria | 5879 |
| 155 | Ga0075434_100105405 | 3300006871 | Bacteria | 2829 |
| 156 | Ga0075434_100133844 | 3300006871 | Bacteria | 2499 |
| 157 | Ga0075434_100394721 | 3300006871 | Bacteria | 1404 |
| 158 | Ga0075434_100499636 | 3300006871 | Bacteria | 1237 |
| 159 | Ga0075429_100008047 | 3300006880 | Bacteria | 9165 |
| 160 | Ga0075429_100012573 | 3300006880 | Bacteria | 7341 |
| 161 | Ga0075429_100059760 | 3300006880 | Bacteria | 3320 |
| 162 | Ga0075429_100092135 | 3300006880 | Unclassified | 2643 |
| 163 | Ga0075429_100177517 | 3300006880 | Unclassified | 1866 |
| 164 | Ga0075429_100206065 | 3300006880 | Bacteria | 1723 |
| 165 | Ga0068865_100008771 | 3300006881 | Bacteria | 6249 |
| 166 | Ga0097620_100010892 | 3300006931 | Bacteria | 9152 |
| 167 | Ga0097620_100049686 | 3300006931 | Bacteria | 4212 |
| 168 | Ga0097620_100285069 | 3300006931 | Bacteria | 1745 |
| 169 | Ga0097620_100354019 | 3300006931 | Bacteria | 1563 |
| 170 | Ga0075435_100009191 | 3300007076 | Bacteria | 7136 |
| 171 | Ga0075435_100027677 | 3300007076 | Bacteria | 4437 |
| 172 | Ga0075435_100418997 | 3300007076 | Bacteria | 1153 |
| 173 | Ga0105244_10037284 | 3300009036 | Bacteria | 2543 |
| 174 | Ga0105240_10061201 | 3300009093 | Bacteria | 4692 |
| 175 | Ga0111539_10003060 | 3300009094 | Bacteria | 22153 |
| 176 | Ga0111539_10014458 | 3300009094 | Bacteria | 9850 |
| 177 | Ga0111539_10045603 | 3300009094 | Bacteria | 5247 |
| 178 | Ga0111539_10362381 | 3300009094 | Bacteria | 1687 |
| 179 | Ga0111539_10372613 | 3300009094 | Bacteria | 1662 |
| 180 | Ga0111539_10411049 | 3300009094 | Bacteria | 1576 |
| 181 | Ga0111539_10815746 | 3300009094 | Unclassified | 1086 |
| 182 | Ga0111539_11679136 | 3300009094 | Bacteria | 737 |
| 183 | Ga0105245_10108215 | 3300009098 | Bacteria | 2581 |
| 184 | Ga0114129_10006674 | 3300009147 | Bacteria | 16392 |
| 185 | Ga0114129_10016383 | 3300009147 | Bacteria | 10550 |
| 186 | Ga0114129_10314166 | 3300009147 | Bacteria | 2085 |
| 187 | Ga0114129_10327402 | 3300009147 | Bacteria | 2035 |
| 188 | Ga0114129_10366424 | 3300009147 | Bacteria | 1906 |
| 189 | Ga0114129_10388922 | 3300009147 | Bacteria | 1840 |
| 190 | Ga0114129_10426041 | 3300009147 | Bacteria | 1744 |
| 191 | Ga0114129_10983289 | 3300009147 | Bacteria | 1064 |
| 192 | Ga0105243_10009910 | 3300009148 | Bacteria | 7244 |
| 193 | Ga0105243_10019546 | 3300009148 | Bacteria | 5136 |
| 194 | Ga0105242_10914737 | 3300009176 | Unclassified | 878 |
| 195 | Ga0105248_10140214 | 3300009177 | Bacteria | 2727 |
| 196 | Ga0105248_10351764 | 3300009177 | Bacteria | 1659 |
| 197 | Ga0105248_10470641 | 3300009177 | Bacteria | 1416 |
| 198 | Ga0105249_10963326 | 3300009553 | Bacteria | 921 |
| 199 | Ga0105239_10398658 | 3300010375 | Bacteria | 1557 |
| 200 | Ga0105239_11482579 | 3300010375 | Unclassified | 784 |
| 201 | Ga0157374_10046819 | 3300013296 | Bacteria | 4007 |
| 202 | Ga0157378_10211449 | 3300013297 | Bacteria | 1839 |
| 203 | Ga0157378_10336459 | 3300013297 | Bacteria | 1471 |
| 204 | Ga0157378_10491078 | 3300013297 | Bacteria | 1225 |
| 205 | Ga0163162_10054885 | 3300013306 | Bacteria | 4009 |
| 206 | Ga0157375_10007654 | 3300013308 | Bacteria | 9449 |
| 207 | Ga0157375_10258692 | 3300013308 | Bacteria | 1902 |
| 208 | Ga0163163_10078747 | 3300014325 | Bacteria | 3293 |
| 209 | Ga0157379_10373311 | 3300014968 | Bacteria | 1308 |
| 210 | Ga0157376_10024822 | 3300014969 | Bacteria | 4714 |
| 211 | Ga0213876_10073933 | 3300021384 | Bacteria | 1800 |
| 212 | Ga0207697_10067501 | 3300025315 | Bacteria | 1495 |
| 213 | Ga0207656_10120445 | 3300025321 | Unclassified | 1221 |
| 214 | Ga0207653_10092472 | 3300025885 | Bacteria | 1061 |
| 215 | Ga0207645_10010682 | 3300025907 | Bacteria | 6297 |
| 216 | Ga0207645_10070391 | 3300025907 | Unclassified | 2237 |
| 217 | Ga0207643_10320072 | 3300025908 | Unclassified | 968 |
| 218 | Ga0207684_10107912 | 3300025910 | Bacteria | 2382 |
| 219 | Ga0207707_10020033 | 3300025912 | Bacteria | 5836 |
| 220 | Ga0207695_10303620 | 3300025913 | Bacteria | 1487 |
| 221 | Ga0207660_10014590 | 3300025917 | Bacteria | 5170 |
| 222 | Ga0207662_10002590 | 3300025918 | Bacteria | 9115 |
| 223 | Ga0207662_10023066 | 3300025918 | Bacteria | 3573 |
| 224 | Ga0207657_10010775 | 3300025919 | Bacteria | 9101 |
| 225 | Ga0207649_10263849 | 3300025920 | Bacteria | 1246 |
| 226 | Ga0207652_10152753 | 3300025921 | Unclassified | 2068 |
| 227 | Ga0207646_10002938 | 3300025922 | Bacteria | 19758 |
| 228 | Ga0207681_10006614 | 3300025923 | Bacteria | 7116 |
| 229 | Ga0207650_10027775 | 3300025925 | Unclassified | 4053 |
| 230 | Ga0207650_10071158 | 3300025925 | Unclassified | 2616 |
| 231 | Ga0207659_10039614 | 3300025926 | Bacteria | 3288 |
| 232 | Ga0207659_10696221 | 3300025926 | Unclassified | 870 |
| 233 | Ga0207687_10144129 | 3300025927 | Unclassified | 1810 |
| 234 | Ga0207690_10106889 | 3300025932 | Bacteria | 2009 |
| 235 | Ga0207690_10273154 | 3300025932 | Bacteria | 1314 |
| 236 | Ga0207690_10403236 | 3300025932 | Unclassified | 1091 |
| 237 | Ga0207706_10071622 | 3300025933 | Unclassified | 3049 |
| 238 | Ga0207706_10084186 | 3300025933 | Bacteria | 2796 |
| 239 | Ga0207706_10341336 | 3300025933 | Unclassified | 1303 |
| 240 | Ga0207686_10013858 | 3300025934 | Bacteria | 4472 |
| 241 | Ga0207686_10258424 | 3300025934 | Bacteria | 1276 |
| 242 | Ga0207670_10052345 | 3300025936 | Bacteria | 2745 |
| 243 | Ga0207670_10106385 | 3300025936 | Bacteria | 2012 |
| 244 | Ga0207670_10109432 | 3300025936 | Bacteria | 1988 |
| 245 | Ga0207670_10333514 | 3300025936 | Bacteria | 1197 |
| 246 | Ga0207670_10688437 | 3300025936 | Bacteria | 845 |
| 247 | Ga0207669_10001218 | 3300025937 | Bacteria | 10942 |
| 248 | Ga0207669_10068953 | 3300025937 | Bacteria | 2211 |
| 249 | Ga0207704_10007895 | 3300025938 | Bacteria | 5054 |
| 250 | Ga0207704_10048326 | 3300025938 | Bacteria | 2550 |
| 251 | Ga0207704_10275682 | 3300025938 | Unclassified | 1276 |
| 252 | Ga0207704_10386967 | 3300025938 | Bacteria | 1099 |
| 253 | Ga0207691_10006506 | 3300025940 | Bacteria | 11279 |
| 254 | Ga0207691_10032458 | 3300025940 | Bacteria | 4867 |
| 255 | Ga0207691_10124962 | 3300025940 | Bacteria | 2277 |
| 256 | Ga0207711_10070072 | 3300025941 | Bacteria | 3040 |
| 257 | Ga0207689_10017182 | 3300025942 | Bacteria | 6124 |
| 258 | Ga0207661_10001745 | 3300025944 | Bacteria | 14884 |
| 259 | Ga0207661_10005508 | 3300025944 | Bacteria | 8929 |
| 260 | Ga0207661_11001905 | 3300025944 | Bacteria | 769 |
| 261 | Ga0207651_10066846 | 3300025960 | Bacteria | 2527 |
| 262 | Ga0207651_10453940 | 3300025960 | Bacteria | 1100 |
| 263 | Ga0207712_10237270 | 3300025961 | Unclassified | 1467 |
| 264 | Ga0207712_10278223 | 3300025961 | Bacteria | 1365 |
| 265 | Ga0207668_10011609 | 3300025972 | Bacteria | 5358 |
| 266 | Ga0207640_10103133 | 3300025981 | Unclassified | 2005 |
| 267 | Ga0207658_10247212 | 3300025986 | Bacteria | 1514 |
| 268 | Ga0207677_10006548 | 3300026023 | Bacteria | 6395 |
| 269 | Ga0207677_10069787 | 3300026023 | Bacteria | 2473 |
| 270 | Ga0207678_10006988 | 3300026067 | Bacteria | 10020 |
| 271 | Ga0207708_10000122 | 3300026075 | Bacteria | 60186 |
| 272 | Ga0207708_10007213 | 3300026075 | Bacteria | 8217 |
| 273 | Ga0207708_10010749 | 3300026075 | Bacteria | 6804 |
| 274 | Ga0207641_10011424 | 3300026088 | Bacteria | 7289 |
| 275 | Ga0207641_10559718 | 3300026088 | Bacteria | 1116 |
| 276 | Ga0207648_10004342 | 3300026089 | Bacteria | 14590 |
| 277 | Ga0207674_10289559 | 3300026116 | Unclassified | 1586 |
| 278 | Ga0207675_100011234 | 3300026118 | Bacteria | 8388 |
| 279 | Ga0207675_100046533 | 3300026118 | Bacteria | 4053 |
| 280 | Ga0207683_10044445 | 3300026121 | Bacteria | 3883 |
| 281 | Ga0207683_10059496 | 3300026121 | Bacteria | 3356 |
| 282 | Ga0207683_10510540 | 3300026121 | Bacteria | 1110 |
| 283 | Ga0207698_10283352 | 3300026142 | Unclassified | 1534 |
| 284 | Ga0207698_10294480 | 3300026142 | Unclassified | 1508 |
| 285 | Ga0207428_10000043 | 3300027907 | Bacteria | 198931 |
| 286 | Ga0207428_10003562 | 3300027907 | Bacteria | 15046 |
| 287 | Ga0207428_10004590 | 3300027907 | Bacteria | 13090 |
| 288 | Ga0207428_10187423 | 3300027907 | Bacteria | 1560 |
| 289 | Ga0268266_10366785 | 3300028379 | Unclassified | 1356 |
| 290 | Ga0268264_10190157 | 3300028381 | Unclassified | 1871 |
| 291 | Ga0265338_10006197 | 3300028800 | Bacteria | 15330 |
| 292 | Ga0265338_10215693 | 3300028800 | Bacteria | 1437 |
| 293 | Ga0265320_10031567 | 3300031240 | Bacteria | 2719 |
| 294 | Ga0265320_10057846 | 3300031240 | Bacteria | 1858 |
| 295 | Ga0265325_10027919 | 3300031241 | Bacteria | 3047 |
| 296 | Ga0265339_10007411 | 3300031249 | Bacteria | 7091 |
| 297 | Ga0307513_10160352 | 3300031456 | Bacteria | 2143 |
| 298 | Ga0307408_100054016 | 3300031548 | Bacteria | 2904 |
| 299 | Ga0307508_10143771 | 3300031616 | Bacteria | 1989 |
| 300 | Ga0265314_10005749 | 3300031711 | Bacteria | 11127 |
| 301 | Ga0265314_10012258 | 3300031711 | Bacteria | 7012 |
| 302 | Ga0265314_10018821 | 3300031711 | Bacteria | 5366 |
| 303 | Ga0265342_10000227 | 3300031712 | Bacteria | 63446 |
| 304 | Ga0307516_10011544 | 3300031730 | Bacteria | 9587 |
| 305 | Ga0307413_10011872 | 3300031824 | Bacteria | 4306 |
| 306 | Ga0307406_10046876 | 3300031901 | Bacteria | 2721 |
| 307 | Ga0307407_10035354 | 3300031903 | Bacteria | 2744 |
| 308 | Ga0307407_10585309 | 3300031903 | Bacteria | 829 |
| 309 | Ga0307416_100024770 | 3300032002 | Bacteria | 4387 |
| 310 | Ga0307411_10004937 | 3300032005 | Bacteria | 6485 |
| 311 | Ga0307415_100019544 | 3300032126 | Bacteria | 4115 |
| 312 | Ga0307415_100324007 | 3300032126 | Unclassified | 1286 |
| 313 | Ga0373950_0000011 | 3300034818 | Bacteria | 365678 |
| 314 | Ga0373950_0000021 | 3300034818 | Bacteria | 209053 |
| 315 | Ga0373934_0148374 | 3300035086 | Bacteria | 960 |
| 316 | Ga0373956_0035009 | 3300035119 | Bacteria | 2213 |
| 317 | Ga0373956_0158509 | 3300035119 | Bacteria | 1066 |
| 318 | Ga0373956_0272215 | 3300035119 | Bacteria | 806 |
| 319 | Ga0373933_0001072 | 3300035724 | Bacteria | 16487 |
| 320 | Ga0373933_0072927 | 3300035724 | Bacteria | 2091 |
| 321 | Ga0373947_0499588 | 3300035725 | Bacteria | 826 |
| 322 | Ga0373937_0007204 | 3300036401 | Bacteria | 9624 |
| 323 | Ga0373937_0471220 | 3300036401 | Bacteria | 1193 |
| 324 | Ga0373925_0555092 | 3300037068 | Bacteria | 945 |
| 325 | Ga0436365_1544740 | 3300039437 | Bacteria | 1971 |
| 326 | Ga0436365_1910706 | 3300039437 | Bacteria | 907 |
| 327 | Ga0451789_1031512 | 3300041443 | Bacteria | 901 |
| 328 | Ga0451791_1366606 | 3300041451 | Bacteria | 920 |
| 329 | Ga0451793_0048559 | 3300041452 | Bacteria | 817 |
| 330 | Ga0451793_1487413 | 3300041452 | Bacteria | 1729 |
| 331 | Ga0451797_1585387 | 3300041453 | Bacteria | 2119 |
| 332 | Ga0451802_1886820 | 3300041460 | Bacteria | 1352 |
| 333 | Ga0451807_0265998 | 3300041486 | Bacteria | 945 |
| 334 | Ga0451807_0307229 | 3300041486 | Bacteria | 3458 |
| 335 | Ga0451853_1150549 | 3300041512 | Bacteria | 6256 |
| 336 | Ga0439433_0009629 | 3300041999 | Bacteria | 2108 |
| 337 | Ga0439435_0000521 | 3300042436 | Bacteria | 6160 |
| 338 | Ga0439435_0011880 | 3300042436 | Bacteria | 2097 |
| 339 | Ga0439435_0037560 | 3300042436 | Bacteria | 1342 |
| 340 | Ga0451577_0189775 | 3300042876 | Bacteria | 1854 |
| 341 | Ga0466965_0027204 | 3300044683 | Bacteria | 2775 |
| 342 | Ga0453684_0007820 | 3300044712 | Bacteria | 19492 |
| 343 | Ga0453684_0038985 | 3300044712 | Archaea | 6482 |
| 344 | Ga0453684_0066573 | 3300044712 | Bacteria | 4586 |
| 345 | Ga0451576_0031549 | 3300045051 | Bacteria | 5647 |
| 346 | Ga0451576_0047260 | 3300045051 | Bacteria | 4526 |
| 347 | Ga0451576_0690663 | 3300045051 | Bacteria | 1072 |
| 348 | Ga0451576_1590626 | 3300045051 | Bacteria | 678 |
| 349 | Ga0495628_0001563 | 3300046516 | Bacteria | 20963 |
| 350 | Ga0495628_0058395 | 3300046516 | Bacteria | 3032 |
| 351 | Ga0495628_0320286 | 3300046516 | Unclassified | 1144 |
| 352 | Ga0495630_0292400 | 3300046517 | Bacteria | 1245 |
| 353 | Ga0495640_0205189 | 3300046533 | Unclassified | 1248 |
| 354 | Ga0495667_0444361 | 3300046559 | Unclassified | 815 |
| 355 | Ga0495634_0093884 | 3300046642 | Bacteria | 1945 |
| 356 | Ga0495635_0242203 | 3300046663 | Unclassified | 1217 |
| 357 | Ga0495600_0045175 | 3300046809 | Bacteria | 2874 |
| 358 | Ga0495674_0242913 | 3300047319 | Unclassified | 1483 |
| 359 | Ga0495674_0275417 | 3300047319 | Bacteria | 1380 |
| 360 | Ga0495672_0000854 | 3300047320 | Bacteria | 32244 |
| 361 | Ga0495680_0068206 | 3300047322 | Unclassified | 2718 |
| 362 | Ga0495684_0049454 | 3300047471 | Bacteria | 3212 |
| 363 | Ga0495684_0286852 | 3300047471 | Unclassified | 1186 |
| 364 | Ga0495602_0459863 | 3300048088 | Bacteria | 897 |
| 365 | Ga0496100_0024395 | 3300048903 | Bacteria | 3689 |
| 366 | Ga0496101_0290372 | 3300048904 | Bacteria | 1279 |
| 367 | Ga0496105_0233560 | 3300048908 | Bacteria | 1494 |
| 368 | Ga0496106_0210658 | 3300048909 | Unclassified | 1548 |
| 369 | Ga0496107_0020555 | 3300048910 | Bacteria | 4665 |
| 370 | Ga0496109_0037707 | 3300048912 | Bacteria | 4368 |
| 371 | Ga0496110_0159677 | 3300048913 | Bacteria | 2043 |
| 372 | Ga0496111_0146523 | 3300048914 | Bacteria | 1751 |
| 373 | Ga0496112_0308670 | 3300048915 | Bacteria | 1527 |
| 374 | Ga0496114_0000144 | 3300048917 | Bacteria | 51829 |
| 375 | Ga0496114_0033660 | 3300048917 | Bacteria | 4224 |
| 376 | Ga0496115_0001324 | 3300048918 | Bacteria | 17654 |
| 377 | Ga0501034_0455019 | 3300049571 | Bacteria | 1197 |
| 378 | Ga0501036_0037780 | 3300049572 | Bacteria | 4084 |
| 379 | Ga0501039_0068781 | 3300049575 | Bacteria | 2749 |
| 380 | Ga0501039_0528239 | 3300049575 | Bacteria | 926 |
| 381 | Ga0501040_0182201 | 3300049576 | Bacteria | 1489 |
| 382 | Ga0501042_0487032 | 3300049578 | Bacteria | 895 |
| 383 | Ga0501067_0000002 | 3300049583 | Bacteria | 176461 |
| 384 | Ga0501067_0006257 | 3300049583 | Bacteria | 6604 |
| 385 | Ga0501067_0030681 | 3300049583 | Bacteria | 2981 |
| 386 | Ga0501067_0123110 | 3300049583 | Bacteria | 1443 |
| 387 | Ga0501068_0056472 | 3300049584 | Bacteria | 2380 |
| 388 | Ga0501069_0016493 | 3300049585 | Bacteria | 3969 |
| 389 | Ga0501069_0113688 | 3300049585 | Bacteria | 1543 |
| 390 | Ga0501070_0000004 | 3300049586 | Bacteria | 254956 |
| 391 | Ga0501072_0000020 | 3300049588 | Bacteria | 156058 |
| 392 | Ga0501072_0314186 | 3300049588 | Bacteria | 1245 |
| 393 | Ga0501073_0000914 | 3300049589 | Bacteria | 21232 |
| 394 | Ga0501073_0008532 | 3300049589 | Bacteria | 7598 |
| 395 | Ga0501073_0010418 | 3300049589 | Bacteria | 6818 |
| 396 | Ga0501073_0017283 | 3300049589 | Bacteria | 5225 |
| 397 | Ga0501073_0068864 | 3300049589 | Unclassified | 2466 |
| 398 | Ga0501075_0038230 | 3300049591 | Bacteria | 3587 |
| 399 | Ga0501075_0678132 | 3300049591 | Bacteria | 785 |
| 400 | Ga0501076_0021643 | 3300049592 | Bacteria | 4935 |
| 401 | Ga0501076_0044186 | 3300049592 | Bacteria | 3513 |
| 402 | Ga0501076_0105300 | 3300049592 | Bacteria | 2276 |
| 403 | Ga0501079_0249991 | 3300049741 | Bacteria | 1386 |
| 404 | Ga0501081_0030843 | 3300049743 | Bacteria | 3632 |
| 405 | Ga0501081_0271634 | 3300049743 | Unclassified | 1240 |
| 406 | Ga0501083_0003177 | 3300049744 | Bacteria | 11435 |
| 407 | Ga0501045_0221999 | 3300049824 | Bacteria | 1407 |
| 408 | nmdc:mga03683_33225_c1 | 3300050489 | Bacteria | 2080 |
| 409 | nmdc:mga03n38_432122_c1 | 3300050490 | Bacteria | 730 |
| 410 | nmdc:mga00v17_112418_c1 | 3300050491 | Unclassified | 1728 |
| 411 | nmdc:mga00v17_19076_c1 | 3300050491 | Bacteria | 3909 |
| 412 | nmdc:mga00v17_47356_c1 | 3300050491 | Bacteria | 2604 |
| 413 | nmdc:mga0yw44_3851_c1 | 3300050492 | Bacteria | 6747 |
| 414 | nmdc:mga0k408_350727_c1 | 3300050493 | Bacteria | 880 |
| 415 | nmdc:mga0k408_465_c1 | 3300050493 | Bacteria | 22259 |
| 416 | nmdc:mga0k408_47657_c1 | 3300050493 | Bacteria | 2477 |
| 417 | nmdc:mga0k408_5771_c1 | 3300050493 | Bacteria | 6590 |
| 418 | nmdc:mga0k408_64293_c1 | 3300050493 | Bacteria | 2135 |
| 419 | nmdc:mga06z11_107037_c1 | 3300050494 | Bacteria | 1543 |
| 420 | nmdc:mga06z11_13172_c1 | 3300050494 | Bacteria | 3622 |
| 421 | nmdc:mga06z11_23342_c1 | 3300050494 | Bacteria | 2904 |
| 422 | nmdc:mga06z11_9348_c1 | 3300050494 | Bacteria | 4128 |
| 423 | nmdc:mga04h51_39216_c1 | 3300050495 | Bacteria | 1538 |
| 424 | nmdc:mga04h51_77204_c1 | 3300050495 | Bacteria | 1175 |
| 425 | nmdc:mga07m45_11151_c1 | 3300050496 | Bacteria | 4716 |
| 426 | nmdc:mga07m45_57449_c1 | 3300050496 | Bacteria | 2200 |
| 427 | nmdc:mga05p37_210345_c1 | 3300050507 | Bacteria | 2352 |
| 428 | nmdc:mga05p37_217861_c1 | 3300050507 | Bacteria | 2305 |
| 429 | nmdc:mga05p37_269461_c1 | 3300050507 | Bacteria | 2035 |
| 430 | nmdc:mga05p37_28344_c1 | 3300050507 | Bacteria | 6829 |
| 431 | nmdc:mga05p37_34191_c1 | 3300050507 | Bacteria | 6225 |
| 432 | nmdc:mga05p37_352278_c1 | 3300050507 | Bacteria | 1733 |
| 433 | nmdc:mga05p37_380757_c1 | 3300050507 | Bacteria | 1653 |
| 434 | nmdc:mga05p37_677361_c1 | 3300050507 | Bacteria | 1150 |
| 435 | nmdc:mga05p37_73060_c1 | 3300050507 | Bacteria | 4221 |
| 436 | nmdc:mga05p37_950614_c1 | 3300050507 | Bacteria | 920 |
| 437 | nmdc:mga05p37_955_c1 | 3300050507 | Bacteria | 32691 |
| 438 | nmdc:mga09592_205514_c1 | 3300050508 | Bacteria | 1706 |
| 439 | nmdc:mga09592_34440_c1 | 3300050508 | Bacteria | 4233 |
| 440 | nmdc:mga09592_758704_c1 | 3300050508 | Bacteria | 823 |
| 441 | nmdc:mga09592_768_c1 | 3300050508 | Bacteria | 24736 |
| 442 | nmdc:mga09592_96145_c1 | 3300050508 | Bacteria | 2534 |
| 443 | nmdc:mga0qj67_114379_c1 | 3300050509 | Bacteria | 2179 |
| 444 | nmdc:mga0qj67_201566_c1 | 3300050509 | Bacteria | 1617 |
| 445 | nmdc:mga06r32_37087_c1 | 3300050510 | Bacteria | 4611 |
| 446 | nmdc:mga06r32_740562_c1 | 3300050510 | Unclassified | 946 |
| 447 | nmdc:mga08y16_160079_c1 | 3300050511 | Bacteria | 2339 |
| 448 | nmdc:mga08y16_330855_c1 | 3300050511 | Bacteria | 1567 |
| 449 | nmdc:mga08y16_342060_c1 | 3300050511 | Bacteria | 1538 |
| 450 | nmdc:mga08y16_4107_c1 | 3300050511 | Bacteria | 15189 |
| 451 | nmdc:mga08y16_643205_c1 | 3300050511 | Bacteria | 1065 |
| 452 | nmdc:mga08y16_734_c1 | 3300050511 | Bacteria | 31115 |
| 453 | nmdc:mga0n895_366097_c1 | 3300050512 | Bacteria | 1459 |
| 454 | nmdc:mga0n895_41264_c1 | 3300050512 | Bacteria | 4484 |
| 455 | nmdc:mga0n895_44534_c1 | 3300050512 | Bacteria | 4327 |
| 456 | nmdc:mga0n895_469361_c1 | 3300050512 | Bacteria | 1270 |
| 457 | nmdc:mga0n895_542023_c1 | 3300050512 | Bacteria | 1170 |
| 458 | nmdc:mga0n895_91860_c1 | 3300050512 | Unclassified | 3038 |
| 459 | nmdc:mga0n895_92700_c1 | 3300050512 | Bacteria | 3024 |
| 460 | nmdc:mga0rr50_133356_c1 | 3300050513 | Bacteria | 1991 |
| 461 | nmdc:mga0rr50_5999_c1 | 3300050513 | Bacteria | 7332 |
| 462 | nmdc:mga0rr50_93507_c1 | 3300050513 | Bacteria | 2346 |
| 463 | nmdc:mga08x19_81960_c1 | 3300050514 | Bacteria | 2119 |
| 464 | nmdc:mga0a205_226256_c1 | 3300050515 | Bacteria | 1755 |
| 465 | nmdc:mga0a205_237581_c1 | 3300050515 | Bacteria | 1704 |
| 466 | nmdc:mga0a205_24535_c1 | 3300050515 | Bacteria | 5736 |
| 467 | nmdc:mga0a205_261110_c1 | 3300050515 | Bacteria | 1609 |
| 468 | nmdc:mga0a205_26638_c2 | 3300050515 | Bacteria | 4707 |
| 469 | Ga0495595_0152961 | 3300053084 | Unclassified | 1136 |
| 470 | Ga0495619_0004515 | 3300053085 | Bacteria | 8890 |
| 471 | Ga0500566_0169295 | 3300053094 | Unclassified | 1131 |
| 472 | Ga0500641_0002076 | 3300053096 | Bacteria | 7106 |
| 473 | Ga0500616_0063854 | 3300053153 | Bacteria | 1898 |
| 474 | Ga0501084_0682340 | 3300054114 | Bacteria | 867 |
| 475 | Ga0590071_000387 | 3300059421 | Bacteria | 12959 |
| 476 | Ga0590071_001992 | 3300059421 | Bacteria | 5223 |
| 477 | Ga0590074_001506 | 3300059423 | Bacteria | 3768 |
| 478 | Ga0590075_000057 | 3300059424 | Bacteria | 28475 |
| 479 | Ga0590075_000353 | 3300059424 | Bacteria | 12802 |
| 480 | Ga0590077_000444 | 3300059426 | Bacteria | 11626 |
| 481 | Ga0590077_000726 | 3300059426 | Bacteria | 8636 |
| 482 | Ga0501082_0005148 | 3300060353 | Bacteria | 11383 |
| 483 | Ga0501082_0113936 | 3300060353 | Bacteria | 2342 |
| 484 | Ga0501082_0145106 | 3300060353 | Unclassified | 2060 |
| 485 | Ga0530510_0135234 | 3300061734 | Bacteria | 1815 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005467 | Ga0070706_100194753 | Ga0070706_1001947532 | 199 |
| 2 | 3300005468 | Ga0070707_100391834 | Ga0070707_1003918342 | 199 |
| 3 | 3300005471 | Ga0070698_100011845 | Ga0070698_1000118455 | 199 |
| 4 | 3300005518 | Ga0070699_100062134 | Ga0070699_1000621342 | 199 |
| 5 | 3300045051 | Ga0451576_1590626 | Ga0451576_1590626_52_660 | 199 |
| 6 | 3300048908 | Ga0496105_0233560 | Ga0496105_0233560_394_1023 | 203 |
| 7 | 3300005343 | Ga0070687_100138276 | Ga0070687_1001382762 | 205 |
| 8 | 3300042436 | Ga0439435_0037560 | Ga0439435_0037560_10_687 | 205 |
| 9 | 3300050491 | nmdc:mga00v17_112418_c1 | nmdc:mga00v17_112418_c1_957_1613 | 205 |
| 10 | 3300009094 | Ga0111539_10815746 | Ga0111539_108157462 | 208 |
| 11 | 3300006178 | Ga0075367_10117507 | Ga0075367_101175073 | 214 |
| 12 | 3300006195 | Ga0075366_10050017 | Ga0075366_100500175 | 214 |
| 13 | 3300046516 | Ga0495628_0001563 | Ga0495628_0001563_14914_15597 | 214 |
| 14 | 3300009094 | Ga0111539_10411049 | Ga0111539_104110492 | 215 |
| 15 | 3300050515 | nmdc:mga0a205_261110_c1 | nmdc:mga0a205_261110_c1_533_1183 | 215 |
| 16 | 3300053094 | Ga0500566_0169295 | Ga0500566_0169295_456_1121 | 216 |
| 17 | 3300005445 | Ga0070708_100392491 | Ga0070708_1003924912 | 217 |
| 18 | 3300006852 | Ga0075433_10778201 | Ga0075433_107782011 | 217 |
| 19 | 3300049576 | Ga0501040_0182201 | Ga0501040_0182201_761_1420 | 217 |
| 20 | 3300049591 | Ga0501075_0038230 | Ga0501075_0038230_2496_3155 | 217 |
| 21 | 3300049592 | Ga0501076_0021643 | Ga0501076_0021643_1698_2357 | 217 |
| 22 | 3300060353 | Ga0501082_0113936 | Ga0501082_0113936_934_1593 | 217 |
| 23 | 3300005329 | Ga0070683_100342393 | Ga0070683_1003423932 | 218 |
| 24 | 3300005434 | Ga0070709_10501696 | Ga0070709_105016961 | 218 |
| 25 | 3300005547 | Ga0070693_100123452 | Ga0070693_1001234522 | 218 |
| 26 | 3300006028 | Ga0070717_10243789 | Ga0070717_102437892 | 218 |
| 27 | 3300028800 | Ga0265338_10215693 | Ga0265338_102156932 | 218 |
| 28 | 3300031240 | Ga0265320_10031567 | Ga0265320_100315672 | 218 |
| 29 | 3300031711 | Ga0265314_10005749 | Ga0265314_100057492 | 218 |
| 30 | 3300031712 | Ga0265342_10000227 | Ga0265342_1000022715 | 218 |
| 31 | 3300031903 | Ga0307407_10585309 | Ga0307407_105853091 | 218 |
| 32 | 3300035725 | Ga0373947_0499588 | Ga0373947_0499588_69_743 | 218 |
| 33 | 3300037068 | Ga0373925_0555092 | Ga0373925_0555092_214_888 | 218 |
| 34 | 3300050511 | nmdc:mga08y16_342060_c1 | nmdc:mga08y16_342060_c1_173_841 | 218 |
| 35 | 3300061734 | Ga0530510_0135234 | Ga0530510_0135234_856_1518 | 218 |
| 36 | 3300005339 | Ga0070660_100010573 | Ga0070660_1000105733 | 219 |
| 37 | 3300005344 | Ga0070661_100340346 | Ga0070661_1003403462 | 219 |
| 38 | 3300005438 | Ga0070701_10227790 | Ga0070701_102277902 | 219 |
| 39 | 3300005441 | Ga0070700_100000093 | Ga0070700_10000009314 | 219 |
| 40 | 3300005458 | Ga0070681_10012390 | Ga0070681_100123903 | 219 |
| 41 | 3300005530 | Ga0070679_100208887 | Ga0070679_1002088872 | 219 |
| 42 | 3300005549 | Ga0070704_100483719 | Ga0070704_1004837192 | 219 |
| 43 | 3300005844 | Ga0068862_100520412 | Ga0068862_1005204122 | 219 |
| 44 | 3300006871 | Ga0075434_100394721 | Ga0075434_1003947211 | 219 |
| 45 | 3300009094 | Ga0111539_10362381 | Ga0111539_103623812 | 219 |
| 46 | 3300009177 | Ga0105248_10351764 | Ga0105248_103517642 | 219 |
| 47 | 3300010375 | Ga0105239_11482579 | Ga0105239_114825791 | 219 |
| 48 | 3300025912 | Ga0207707_10020033 | Ga0207707_100200335 | 219 |
| 49 | 3300025919 | Ga0207657_10010775 | Ga0207657_100107756 | 219 |
| 50 | 3300025920 | Ga0207649_10263849 | Ga0207649_102638492 | 219 |
| 51 | 3300025921 | Ga0207652_10152753 | Ga0207652_101527532 | 219 |
| 52 | 3300025941 | Ga0207711_10070072 | Ga0207711_100700723 | 219 |
| 53 | 3300026075 | Ga0207708_10000122 | Ga0207708_1000012214 | 219 |
| 54 | 3300032126 | Ga0307415_100324007 | Ga0307415_1003240072 | 219 |
| 55 | 3300035119 | Ga0373956_0272215 | Ga0373956_0272215_11_670 | 219 |
| 56 | 3300044712 | Ga0453684_0038985 | Ga0453684_0038985_737_1408 | 219 |
| 57 | 3300044712 | Ga0453684_0066573 | Ga0453684_0066573_3716_4381 | 219 |
| 58 | 3300047322 | Ga0495680_0068206 | Ga0495680_0068206_1332_2021 | 219 |
| 59 | 3300047471 | Ga0495684_0286852 | Ga0495684_0286852_67_756 | 219 |
| 60 | 3300048088 | Ga0495602_0459863 | Ga0495602_0459863_169_828 | 219 |
| 61 | 3300048915 | Ga0496112_0308670 | Ga0496112_0308670_383_1042 | 219 |
| 62 | 3300050508 | nmdc:mga09592_758704_c1 | nmdc:mga09592_758704_c1_13_681 | 219 |
| 63 | 3300050511 | nmdc:mga08y16_643205_c1 | nmdc:mga08y16_643205_c1_36_701 | 219 |
| 64 | 3300050513 | nmdc:mga0rr50_93507_c1 | nmdc:mga0rr50_93507_c1_1598_2287 | 219 |
| 65 | 3300005329 | Ga0070683_100006893 | Ga0070683_1000068937 | 220 |
| 66 | 3300005354 | Ga0070675_100799549 | Ga0070675_1007995491 | 220 |
| 67 | 3300005441 | Ga0070700_100142623 | Ga0070700_1001426232 | 220 |
| 68 | 3300005518 | Ga0070699_100180459 | Ga0070699_1001804592 | 220 |
| 69 | 3300005535 | Ga0070684_100057334 | Ga0070684_1000573344 | 220 |
| 70 | 3300005563 | Ga0068855_100422377 | Ga0068855_1004223772 | 220 |
| 71 | 3300005618 | Ga0068864_100298744 | Ga0068864_1002987441 | 220 |
| 72 | 3300006178 | Ga0075367_10383747 | Ga0075367_103837472 | 220 |
| 73 | 3300006844 | Ga0075428_100071381 | Ga0075428_1000713812 | 220 |
| 74 | 3300006846 | Ga0075430_100616594 | Ga0075430_1006165941 | 220 |
| 75 | 3300006846 | Ga0075430_100735114 | Ga0075430_1007351141 | 220 |
| 76 | 3300006847 | Ga0075431_100071440 | Ga0075431_1000714403 | 220 |
| 77 | 3300006871 | Ga0075434_100133844 | Ga0075434_1001338442 | 220 |
| 78 | 3300006880 | Ga0075429_100008047 | Ga0075429_1000080475 | 220 |
| 79 | 3300006880 | Ga0075429_100177517 | Ga0075429_1001775172 | 220 |
| 80 | 3300007076 | Ga0075435_100009191 | Ga0075435_1000091915 | 220 |
| 81 | 3300009093 | Ga0105240_10061201 | Ga0105240_100612012 | 220 |
| 82 | 3300009094 | Ga0111539_10045603 | Ga0111539_100456033 | 220 |
| 83 | 3300009094 | Ga0111539_10372613 | Ga0111539_103726132 | 220 |
| 84 | 3300009147 | Ga0114129_10006674 | Ga0114129_100066749 | 220 |
| 85 | 3300009147 | Ga0114129_10388922 | Ga0114129_103889221 | 220 |
| 86 | 3300009177 | Ga0105248_10470641 | Ga0105248_104706412 | 220 |
| 87 | 3300025315 | Ga0207697_10067501 | Ga0207697_100675012 | 220 |
| 88 | 3300025913 | Ga0207695_10303620 | Ga0207695_103036202 | 220 |
| 89 | 3300025932 | Ga0207690_10273154 | Ga0207690_102731542 | 220 |
| 90 | 3300025944 | Ga0207661_10005508 | Ga0207661_100055087 | 220 |
| 91 | 3300027907 | Ga0207428_10003562 | Ga0207428_100035624 | 220 |
| 92 | 3300027907 | Ga0207428_10187423 | Ga0207428_101874232 | 220 |
| 93 | 3300031548 | Ga0307408_100054016 | Ga0307408_1000540163 | 220 |
| 94 | 3300032002 | Ga0307416_100024770 | Ga0307416_1000247704 | 220 |
| 95 | 3300041999 | Ga0439433_0009629 | Ga0439433_0009629_264_932 | 220 |
| 96 | 3300042436 | Ga0439435_0011880 | Ga0439435_0011880_79_747 | 220 |
| 97 | 3300049571 | Ga0501034_0455019 | Ga0501034_0455019_220_888 | 220 |
| 98 | 3300049575 | Ga0501039_0068781 | Ga0501039_0068781_801_1463 | 220 |
| 99 | 3300049578 | Ga0501042_0487032 | Ga0501042_0487032_100_762 | 220 |
| 100 | 3300049591 | Ga0501075_0678132 | Ga0501075_0678132_86_754 | 220 |
| 101 | 3300049592 | Ga0501076_0044186 | Ga0501076_0044186_2735_3397 | 220 |
| 102 | 3300049743 | Ga0501081_0271634 | Ga0501081_0271634_292_960 | 220 |
| 103 | 3300050491 | nmdc:mga00v17_47356_c1 | nmdc:mga00v17_47356_c1_407_1075 | 220 |
| 104 | 3300050507 | nmdc:mga05p37_210345_c1 | nmdc:mga05p37_210345_c1_1472_2152 | 220 |
| 105 | 3300050507 | nmdc:mga05p37_34191_c1 | nmdc:mga05p37_34191_c1_1686_2354 | 220 |
| 106 | 3300050507 | nmdc:mga05p37_73060_c1 | nmdc:mga05p37_73060_c1_792_1454 | 220 |
| 107 | 3300050508 | nmdc:mga09592_96145_c1 | nmdc:mga09592_96145_c1_75_743 | 220 |
| 108 | 3300050509 | nmdc:mga0qj67_114379_c1 | nmdc:mga0qj67_114379_c1_1293_1961 | 220 |
| 109 | 3300050509 | nmdc:mga0qj67_201566_c1 | nmdc:mga0qj67_201566_c1_105_773 | 220 |
| 110 | 3300050511 | nmdc:mga08y16_160079_c1 | nmdc:mga08y16_160079_c1_1169_1837 | 220 |
| 111 | 3300050511 | nmdc:mga08y16_330855_c1 | nmdc:mga08y16_330855_c1_577_1245 | 220 |
| 112 | 3300050512 | nmdc:mga0n895_366097_c1 | nmdc:mga0n895_366097_c1_776_1438 | 220 |
| 113 | 3300050512 | nmdc:mga0n895_44534_c1 | nmdc:mga0n895_44534_c1_1358_2026 | 220 |
| 114 | 3300050513 | nmdc:mga0rr50_5999_c1 | nmdc:mga0rr50_5999_c1_5393_6061 | 220 |
| 115 | 3300054114 | Ga0501084_0682340 | Ga0501084_0682340_56_724 | 220 |
| 116 | 3300059421 | Ga0590071_000387 | Ga0590071_000387_3130_3798 | 220 |
| 117 | 3300059424 | Ga0590075_000353 | Ga0590075_000353_6812_7480 | 220 |
| 118 | 3300059426 | Ga0590077_000726 | Ga0590077_000726_4732_5400 | 220 |
| 119 | 3300060353 | Ga0501082_0145106 | Ga0501082_0145106_1118_1780 | 220 |
| 120 | 3300005354 | Ga0070675_100000017 | Ga0070675_1000000175 | 221 |
| 121 | 3300005535 | Ga0070684_100118662 | Ga0070684_1001186622 | 221 |
| 122 | 3300006852 | Ga0075433_10101326 | Ga0075433_101013261 | 221 |
| 123 | 3300009036 | Ga0105244_10037284 | Ga0105244_100372843 | 221 |
| 124 | 3300025944 | Ga0207661_11001905 | Ga0207661_110019051 | 221 |
| 125 | 3300031241 | Ga0265325_10027919 | Ga0265325_100279192 | 221 |
| 126 | 3300036401 | Ga0373937_0471220 | Ga0373937_0471220_18_689 | 221 |
| 127 | 3300041512 | Ga0451853_1150549 | Ga0451853_1150549_1867_2535 | 221 |
| 128 | 3300044712 | Ga0453684_0007820 | Ga0453684_0007820_3286_3960 | 221 |
| 129 | 3300046559 | Ga0495667_0444361 | Ga0495667_0444361_108_779 | 221 |
| 130 | 3300046663 | Ga0495635_0242203 | Ga0495635_0242203_121_792 | 221 |
| 131 | 3300047319 | Ga0495674_0275417 | Ga0495674_0275417_585_1256 | 221 |
| 132 | 3300050493 | nmdc:mga0k408_350727_c1 | nmdc:mga0k408_350727_c1_100_765 | 221 |
| 133 | 3300050494 | nmdc:mga06z11_23342_c1 | nmdc:mga06z11_23342_c1_2146_2811 | 221 |
| 134 | 3300050510 | nmdc:mga06r32_740562_c1 | nmdc:mga06r32_740562_c1_45_716 | 221 |
| 135 | 3300005471 | Ga0070698_100156298 | Ga0070698_1001562982 | 222 |
| 136 | 3300005545 | Ga0070695_100221606 | Ga0070695_1002216061 | 222 |
| 137 | 3300005546 | Ga0070696_100188009 | Ga0070696_1001880092 | 222 |
| 138 | 3300006852 | Ga0075433_10595456 | Ga0075433_105954562 | 222 |
| 139 | 3300006871 | Ga0075434_100105405 | Ga0075434_1001054053 | 222 |
| 140 | 3300009094 | Ga0111539_11679136 | Ga0111539_116791361 | 222 |
| 141 | 3300009147 | Ga0114129_10327402 | Ga0114129_103274022 | 222 |
| 142 | 3300009147 | Ga0114129_10426041 | Ga0114129_104260412 | 222 |
| 143 | 3300041452 | Ga0451793_0048559 | Ga0451793_0048559_41_709 | 222 |
| 144 | 3300042436 | Ga0439435_0000521 | Ga0439435_0000521_1774_2451 | 222 |
| 145 | 3300049575 | Ga0501039_0528239 | Ga0501039_0528239_21_743 | 222 |
| 146 | 3300049585 | Ga0501069_0016493 | Ga0501069_0016493_1753_2430 | 222 |
| 147 | 3300049586 | Ga0501070_0000004 | Ga0501070_0000004_103295_103972 | 222 |
| 148 | 3300049588 | Ga0501072_0314186 | Ga0501072_0314186_60_737 | 222 |
| 149 | 3300049589 | Ga0501073_0008532 | Ga0501073_0008532_2645_3322 | 222 |
| 150 | 3300049743 | Ga0501081_0030843 | Ga0501081_0030843_2909_3586 | 222 |
| 151 | 3300049744 | Ga0501083_0003177 | Ga0501083_0003177_2844_3521 | 222 |
| 152 | 3300050507 | nmdc:mga05p37_269461_c1 | nmdc:mga05p37_269461_c1_797_1477 | 222 |
| 153 | 3300050507 | nmdc:mga05p37_352278_c1 | nmdc:mga05p37_352278_c1_636_1307 | 222 |
| 154 | 3300050507 | nmdc:mga05p37_950614_c1 | nmdc:mga05p37_950614_c1_84_755 | 222 |
| 155 | 3300050512 | nmdc:mga0n895_92700_c1 | nmdc:mga0n895_92700_c1_1183_1854 | 222 |
| 156 | 3300050514 | nmdc:mga08x19_81960_c1 | nmdc:mga08x19_81960_c1_879_1550 | 222 |
| 157 | 3300060353 | Ga0501082_0005148 | Ga0501082_0005148_7869_8546 | 222 |
| 158 | 3300003323 | rootH1_10165552 | rootH1_101655522 | 223 |
| 159 | 3300005328 | Ga0070676_10002038 | Ga0070676_100020382 | 223 |
| 160 | 3300005328 | Ga0070676_10074002 | Ga0070676_100740023 | 223 |
| 161 | 3300005329 | Ga0070683_100005544 | Ga0070683_1000055444 | 223 |
| 162 | 3300005330 | Ga0070690_100001352 | Ga0070690_1000013528 | 223 |
| 163 | 3300005330 | Ga0070690_100065837 | Ga0070690_1000658371 | 223 |
| 164 | 3300005334 | Ga0068869_100036729 | Ga0068869_1000367294 | 223 |
| 165 | 3300005334 | Ga0068869_100061240 | Ga0068869_1000612401 | 223 |
| 166 | 3300005335 | Ga0070666_10354108 | Ga0070666_103541081 | 223 |
| 167 | 3300005336 | Ga0070680_100022696 | Ga0070680_1000226963 | 223 |
| 168 | 3300005337 | Ga0070682_100208629 | Ga0070682_1002086291 | 223 |
| 169 | 3300005338 | Ga0068868_100055528 | Ga0068868_1000555283 | 223 |
| 170 | 3300005338 | Ga0068868_100099105 | Ga0068868_1000991053 | 223 |
| 171 | 3300005338 | Ga0068868_100119036 | Ga0068868_1001190362 | 223 |
| 172 | 3300005340 | Ga0070689_100010591 | Ga0070689_1000105914 | 223 |
| 173 | 3300005340 | Ga0070689_100011368 | Ga0070689_1000113681 | 223 |
| 174 | 3300005340 | Ga0070689_100014670 | Ga0070689_1000146704 | 223 |
| 175 | 3300005340 | Ga0070689_100072087 | Ga0070689_1000720873 | 223 |
| 176 | 3300005340 | Ga0070689_100255324 | Ga0070689_1002553243 | 223 |
| 177 | 3300005341 | Ga0070691_10014588 | Ga0070691_100145882 | 223 |
| 178 | 3300005341 | Ga0070691_10072791 | Ga0070691_100727912 | 223 |
| 179 | 3300005343 | Ga0070687_100059042 | Ga0070687_1000590422 | 223 |
| 180 | 3300005343 | Ga0070687_100075591 | Ga0070687_1000755913 | 223 |
| 181 | 3300005345 | Ga0070692_10149187 | Ga0070692_101491872 | 223 |
| 182 | 3300005347 | Ga0070668_100009593 | Ga0070668_1000095933 | 223 |
| 183 | 3300005353 | Ga0070669_100095425 | Ga0070669_1000954252 | 223 |
| 184 | 3300005354 | Ga0070675_100047876 | Ga0070675_1000478763 | 223 |
| 185 | 3300005356 | Ga0070674_100035647 | Ga0070674_1000356475 | 223 |
| 186 | 3300005364 | Ga0070673_100012483 | Ga0070673_1000124834 | 223 |
| 187 | 3300005364 | Ga0070673_100262266 | Ga0070673_1002622662 | 223 |
| 188 | 3300005364 | Ga0070673_100396401 | Ga0070673_1003964012 | 223 |
| 189 | 3300005365 | Ga0070688_100000437 | Ga0070688_10000043725 | 223 |
| 190 | 3300005365 | Ga0070688_100016828 | Ga0070688_1000168286 | 223 |
| 191 | 3300005365 | Ga0070688_100153784 | Ga0070688_1001537842 | 223 |
| 192 | 3300005366 | Ga0070659_100528267 | Ga0070659_1005282672 | 223 |
| 193 | 3300005438 | Ga0070701_10012010 | Ga0070701_100120104 | 223 |
| 194 | 3300005440 | Ga0070705_100016632 | Ga0070705_1000166324 | 223 |
| 195 | 3300005440 | Ga0070705_100186415 | Ga0070705_1001864152 | 223 |
| 196 | 3300005441 | Ga0070700_100003434 | Ga0070700_1000034345 | 223 |
| 197 | 3300005441 | Ga0070700_100329599 | Ga0070700_1003295992 | 223 |
| 198 | 3300005444 | Ga0070694_100009716 | Ga0070694_1000097163 | 223 |
| 199 | 3300005444 | Ga0070694_100122393 | Ga0070694_1001223933 | 223 |
| 200 | 3300005455 | Ga0070663_100046166 | Ga0070663_1000461661 | 223 |
| 201 | 3300005456 | Ga0070678_100040487 | Ga0070678_1000404871 | 223 |
| 202 | 3300005456 | Ga0070678_100090152 | Ga0070678_1000901522 | 223 |
| 203 | 3300005456 | Ga0070678_100187129 | Ga0070678_1001871292 | 223 |
| 204 | 3300005456 | Ga0070678_100322708 | Ga0070678_1003227082 | 223 |
| 205 | 3300005457 | Ga0070662_100125794 | Ga0070662_1001257942 | 223 |
| 206 | 3300005459 | Ga0068867_100005919 | Ga0068867_1000059192 | 223 |
| 207 | 3300005466 | Ga0070685_10004804 | Ga0070685_100048043 | 223 |
| 208 | 3300005466 | Ga0070685_10011505 | Ga0070685_100115053 | 223 |
| 209 | 3300005466 | Ga0070685_10434174 | Ga0070685_104341742 | 223 |
| 210 | 3300005467 | Ga0070706_100036336 | Ga0070706_1000363362 | 223 |
| 211 | 3300005467 | Ga0070706_100134490 | Ga0070706_1001344903 | 223 |
| 212 | 3300005468 | Ga0070707_100008429 | Ga0070707_1000084295 | 223 |
| 213 | 3300005471 | Ga0070698_100002974 | Ga0070698_10000297415 | 223 |
| 214 | 3300005471 | Ga0070698_100030672 | Ga0070698_1000306724 | 223 |
| 215 | 3300005471 | Ga0070698_100172151 | Ga0070698_1001721512 | 223 |
| 216 | 3300005518 | Ga0070699_100027788 | Ga0070699_1000277883 | 223 |
| 217 | 3300005518 | Ga0070699_100043189 | Ga0070699_1000431892 | 223 |
| 218 | 3300005535 | Ga0070684_100025046 | Ga0070684_1000250465 | 223 |
| 219 | 3300005535 | Ga0070684_100080971 | Ga0070684_1000809714 | 223 |
| 220 | 3300005536 | Ga0070697_100013378 | Ga0070697_1000133782 | 223 |
| 221 | 3300005539 | Ga0068853_100328621 | Ga0068853_1003286212 | 223 |
| 222 | 3300005543 | Ga0070672_100015292 | Ga0070672_1000152924 | 223 |
| 223 | 3300005544 | Ga0070686_100005262 | Ga0070686_1000052625 | 223 |
| 224 | 3300005544 | Ga0070686_100018108 | Ga0070686_1000181083 | 223 |
| 225 | 3300005544 | Ga0070686_100026899 | Ga0070686_1000268992 | 223 |
| 226 | 3300005545 | Ga0070695_100097202 | Ga0070695_1000972023 | 223 |
| 227 | 3300005546 | Ga0070696_100272639 | Ga0070696_1002726392 | 223 |
| 228 | 3300005578 | Ga0068854_100023598 | Ga0068854_1000235983 | 223 |
| 229 | 3300005578 | Ga0068854_100132448 | Ga0068854_1001324482 | 223 |
| 230 | 3300005614 | Ga0068856_100267817 | Ga0068856_1002678172 | 223 |
| 231 | 3300005615 | Ga0070702_100104918 | Ga0070702_1001049181 | 223 |
| 232 | 3300005616 | Ga0068852_100261537 | Ga0068852_1002615372 | 223 |
| 233 | 3300005617 | Ga0068859_100010892 | Ga0068859_1000108922 | 223 |
| 234 | 3300005617 | Ga0068859_100049689 | Ga0068859_1000496894 | 223 |
| 235 | 3300005617 | Ga0068859_100285061 | Ga0068859_1002850611 | 223 |
| 236 | 3300005617 | Ga0068859_100354065 | Ga0068859_1003540652 | 223 |
| 237 | 3300005719 | Ga0068861_100008361 | Ga0068861_1000083614 | 223 |
| 238 | 3300005840 | Ga0068870_10394379 | Ga0068870_103943791 | 223 |
| 239 | 3300005842 | Ga0068858_100022759 | Ga0068858_1000227592 | 223 |
| 240 | 3300005842 | Ga0068858_100267610 | Ga0068858_1002676102 | 223 |
| 241 | 3300005843 | Ga0068860_100238616 | Ga0068860_1002386162 | 223 |
| 242 | 3300005844 | Ga0068862_100144619 | Ga0068862_1001446192 | 223 |
| 243 | 3300006038 | Ga0075365_10017162 | Ga0075365_100171623 | 223 |
| 244 | 3300006038 | Ga0075365_10039453 | Ga0075365_100394532 | 223 |
| 245 | 3300006042 | Ga0075368_10033002 | Ga0075368_100330021 | 223 |
| 246 | 3300006048 | Ga0075363_100066942 | Ga0075363_1000669423 | 223 |
| 247 | 3300006051 | Ga0075364_10004869 | Ga0075364_100048693 | 223 |
| 248 | 3300006051 | Ga0075364_10005908 | Ga0075364_100059082 | 223 |
| 249 | 3300006051 | Ga0075364_10029427 | Ga0075364_100294273 | 223 |
| 250 | 3300006177 | Ga0075362_10000540 | Ga0075362_100005402 | 223 |
| 251 | 3300006177 | Ga0075362_10009703 | Ga0075362_100097033 | 223 |
| 252 | 3300006178 | Ga0075367_10004419 | Ga0075367_100044193 | 223 |
| 253 | 3300006178 | Ga0075367_10053238 | Ga0075367_100532384 | 223 |
| 254 | 3300006178 | Ga0075367_10118443 | Ga0075367_101184432 | 223 |
| 255 | 3300006186 | Ga0075369_10097159 | Ga0075369_100971592 | 223 |
| 256 | 3300006195 | Ga0075366_10002022 | Ga0075366_100020222 | 223 |
| 257 | 3300006195 | Ga0075366_10002099 | Ga0075366_100020994 | 223 |
| 258 | 3300006237 | Ga0097621_100009912 | Ga0097621_1000099126 | 223 |
| 259 | 3300006353 | Ga0075370_10012782 | Ga0075370_100127825 | 223 |
| 260 | 3300006353 | Ga0075370_10087532 | Ga0075370_100875322 | 223 |
| 261 | 3300006358 | Ga0068871_100006098 | Ga0068871_1000060981 | 223 |
| 262 | 3300006358 | Ga0068871_100258614 | Ga0068871_1002586141 | 223 |
| 263 | 3300006844 | Ga0075428_100017953 | Ga0075428_1000179538 | 223 |
| 264 | 3300006844 | Ga0075428_100049932 | Ga0075428_1000499322 | 223 |
| 265 | 3300006844 | Ga0075428_100453172 | Ga0075428_1004531722 | 223 |
| 266 | 3300006844 | Ga0075428_100514911 | Ga0075428_1005149112 | 223 |
| 267 | 3300006847 | Ga0075431_100013319 | Ga0075431_1000133195 | 223 |
| 268 | 3300006852 | Ga0075433_10037480 | Ga0075433_100374803 | 223 |
| 269 | 3300006852 | Ga0075433_10042542 | Ga0075433_100425425 | 223 |
| 270 | 3300006852 | Ga0075433_10047644 | Ga0075433_100476443 | 223 |
| 271 | 3300006871 | Ga0075434_100024686 | Ga0075434_1000246863 | 223 |
| 272 | 3300006871 | Ga0075434_100499636 | Ga0075434_1004996362 | 223 |
| 273 | 3300006880 | Ga0075429_100012573 | Ga0075429_1000125733 | 223 |
| 274 | 3300006880 | Ga0075429_100059760 | Ga0075429_1000597602 | 223 |
| 275 | 3300006880 | Ga0075429_100092135 | Ga0075429_1000921353 | 223 |
| 276 | 3300006880 | Ga0075429_100206065 | Ga0075429_1002060652 | 223 |
| 277 | 3300006881 | Ga0068865_100008771 | Ga0068865_1000087713 | 223 |
| 278 | 3300006931 | Ga0097620_100010892 | Ga0097620_10001089210 | 223 |
| 279 | 3300006931 | Ga0097620_100049686 | Ga0097620_1000496864 | 223 |
| 280 | 3300006931 | Ga0097620_100285069 | Ga0097620_1002850691 | 223 |
| 281 | 3300006931 | Ga0097620_100354019 | Ga0097620_1003540192 | 223 |
| 282 | 3300007076 | Ga0075435_100027677 | Ga0075435_1000276772 | 223 |
| 283 | 3300007076 | Ga0075435_100418997 | Ga0075435_1004189972 | 223 |
| 284 | 3300009094 | Ga0111539_10003060 | Ga0111539_100030606 | 223 |
| 285 | 3300009094 | Ga0111539_10014458 | Ga0111539_100144585 | 223 |
| 286 | 3300009098 | Ga0105245_10108215 | Ga0105245_101082152 | 223 |
| 287 | 3300009147 | Ga0114129_10016383 | Ga0114129_100163834 | 223 |
| 288 | 3300009147 | Ga0114129_10314166 | Ga0114129_103141662 | 223 |
| 289 | 3300009147 | Ga0114129_10366424 | Ga0114129_103664242 | 223 |
| 290 | 3300009147 | Ga0114129_10983289 | Ga0114129_109832892 | 223 |
| 291 | 3300009148 | Ga0105243_10009910 | Ga0105243_100099104 | 223 |
| 292 | 3300009148 | Ga0105243_10019546 | Ga0105243_100195462 | 223 |
| 293 | 3300009176 | Ga0105242_10914737 | Ga0105242_109147371 | 223 |
| 294 | 3300009177 | Ga0105248_10140214 | Ga0105248_101402142 | 223 |
| 295 | 3300009553 | Ga0105249_10963326 | Ga0105249_109633262 | 223 |
| 296 | 3300010375 | Ga0105239_10398658 | Ga0105239_103986581 | 223 |
| 297 | 3300013296 | Ga0157374_10046819 | Ga0157374_100468193 | 223 |
| 298 | 3300013297 | Ga0157378_10211449 | Ga0157378_102114492 | 223 |
| 299 | 3300013297 | Ga0157378_10336459 | Ga0157378_103364591 | 223 |
| 300 | 3300013297 | Ga0157378_10491078 | Ga0157378_104910782 | 223 |
| 301 | 3300013306 | Ga0163162_10054885 | Ga0163162_100548852 | 223 |
| 302 | 3300013308 | Ga0157375_10007654 | Ga0157375_100076546 | 223 |
| 303 | 3300013308 | Ga0157375_10258692 | Ga0157375_102586922 | 223 |
| 304 | 3300014325 | Ga0163163_10078747 | Ga0163163_100787473 | 223 |
| 305 | 3300014968 | Ga0157379_10373311 | Ga0157379_103733111 | 223 |
| 306 | 3300014969 | Ga0157376_10024822 | Ga0157376_100248223 | 223 |
| 307 | 3300021384 | Ga0213876_10073933 | Ga0213876_100739333 | 223 |
| 308 | 3300025321 | Ga0207656_10120445 | Ga0207656_101204452 | 223 |
| 309 | 3300025885 | Ga0207653_10092472 | Ga0207653_100924722 | 223 |
| 310 | 3300025907 | Ga0207645_10010682 | Ga0207645_100106822 | 223 |
| 311 | 3300025907 | Ga0207645_10070391 | Ga0207645_100703913 | 223 |
| 312 | 3300025908 | Ga0207643_10320072 | Ga0207643_103200721 | 223 |
| 313 | 3300025910 | Ga0207684_10107912 | Ga0207684_101079122 | 223 |
| 314 | 3300025917 | Ga0207660_10014590 | Ga0207660_100145902 | 223 |
| 315 | 3300025918 | Ga0207662_10002590 | Ga0207662_100025905 | 223 |
| 316 | 3300025918 | Ga0207662_10023066 | Ga0207662_100230663 | 223 |
| 317 | 3300025922 | Ga0207646_10002938 | Ga0207646_1000293814 | 223 |
| 318 | 3300025923 | Ga0207681_10006614 | Ga0207681_100066146 | 223 |
| 319 | 3300025925 | Ga0207650_10027775 | Ga0207650_100277757 | 223 |
| 320 | 3300025925 | Ga0207650_10071158 | Ga0207650_100711583 | 223 |
| 321 | 3300025926 | Ga0207659_10039614 | Ga0207659_100396143 | 223 |
| 322 | 3300025926 | Ga0207659_10696221 | Ga0207659_106962212 | 223 |
| 323 | 3300025927 | Ga0207687_10144129 | Ga0207687_101441292 | 223 |
| 324 | 3300025932 | Ga0207690_10106889 | Ga0207690_101068892 | 223 |
| 325 | 3300025932 | Ga0207690_10403236 | Ga0207690_104032362 | 223 |
| 326 | 3300025933 | Ga0207706_10071622 | Ga0207706_100716223 | 223 |
| 327 | 3300025933 | Ga0207706_10084186 | Ga0207706_100841863 | 223 |
| 328 | 3300025933 | Ga0207706_10341336 | Ga0207706_103413362 | 223 |
| 329 | 3300025934 | Ga0207686_10013858 | Ga0207686_100138583 | 223 |
| 330 | 3300025934 | Ga0207686_10258424 | Ga0207686_102584242 | 223 |
| 331 | 3300025936 | Ga0207670_10052345 | Ga0207670_100523453 | 223 |
| 332 | 3300025936 | Ga0207670_10106385 | Ga0207670_101063851 | 223 |
| 333 | 3300025936 | Ga0207670_10109432 | Ga0207670_101094323 | 223 |
| 334 | 3300025936 | Ga0207670_10333514 | Ga0207670_103335142 | 223 |
| 335 | 3300025936 | Ga0207670_10688437 | Ga0207670_106884371 | 223 |
| 336 | 3300025937 | Ga0207669_10001218 | Ga0207669_100012189 | 223 |
| 337 | 3300025937 | Ga0207669_10068953 | Ga0207669_100689532 | 223 |
| 338 | 3300025938 | Ga0207704_10007895 | Ga0207704_100078956 | 223 |
| 339 | 3300025938 | Ga0207704_10048326 | Ga0207704_100483264 | 223 |
| 340 | 3300025938 | Ga0207704_10275682 | Ga0207704_102756822 | 223 |
| 341 | 3300025938 | Ga0207704_10386967 | Ga0207704_103869672 | 223 |
| 342 | 3300025940 | Ga0207691_10006506 | Ga0207691_100065067 | 223 |
| 343 | 3300025940 | Ga0207691_10032458 | Ga0207691_100324585 | 223 |
| 344 | 3300025940 | Ga0207691_10124962 | Ga0207691_101249624 | 223 |
| 345 | 3300025942 | Ga0207689_10017182 | Ga0207689_100171824 | 223 |
| 346 | 3300025944 | Ga0207661_10001745 | Ga0207661_100017457 | 223 |
| 347 | 3300025960 | Ga0207651_10066846 | Ga0207651_100668464 | 223 |
| 348 | 3300025960 | Ga0207651_10453940 | Ga0207651_104539402 | 223 |
| 349 | 3300025961 | Ga0207712_10237270 | Ga0207712_102372702 | 223 |
| 350 | 3300025961 | Ga0207712_10278223 | Ga0207712_102782232 | 223 |
| 351 | 3300025972 | Ga0207668_10011609 | Ga0207668_100116095 | 223 |
| 352 | 3300025981 | Ga0207640_10103133 | Ga0207640_101031332 | 223 |
| 353 | 3300025986 | Ga0207658_10247212 | Ga0207658_102472122 | 223 |
| 354 | 3300026023 | Ga0207677_10006548 | Ga0207677_100065486 | 223 |
| 355 | 3300026023 | Ga0207677_10069787 | Ga0207677_100697872 | 223 |
| 356 | 3300026067 | Ga0207678_10006988 | Ga0207678_100069887 | 223 |
| 357 | 3300026075 | Ga0207708_10007213 | Ga0207708_100072133 | 223 |
| 358 | 3300026075 | Ga0207708_10010749 | Ga0207708_100107492 | 223 |
| 359 | 3300026088 | Ga0207641_10011424 | Ga0207641_100114245 | 223 |
| 360 | 3300026088 | Ga0207641_10559718 | Ga0207641_105597182 | 223 |
| 361 | 3300026089 | Ga0207648_10004342 | Ga0207648_100043424 | 223 |
| 362 | 3300026116 | Ga0207674_10289559 | Ga0207674_102895591 | 223 |
| 363 | 3300026118 | Ga0207675_100011234 | Ga0207675_1000112345 | 223 |
| 364 | 3300026118 | Ga0207675_100046533 | Ga0207675_1000465332 | 223 |
| 365 | 3300026121 | Ga0207683_10044445 | Ga0207683_100444452 | 223 |
| 366 | 3300026121 | Ga0207683_10059496 | Ga0207683_100594962 | 223 |
| 367 | 3300026121 | Ga0207683_10510540 | Ga0207683_105105401 | 223 |
| 368 | 3300026142 | Ga0207698_10283352 | Ga0207698_102833522 | 223 |
| 369 | 3300026142 | Ga0207698_10294480 | Ga0207698_102944802 | 223 |
| 370 | 3300027907 | Ga0207428_10000043 | Ga0207428_10000043168 | 223 |
| 371 | 3300027907 | Ga0207428_10004590 | Ga0207428_100045909 | 223 |
| 372 | 3300028379 | Ga0268266_10366785 | Ga0268266_103667852 | 223 |
| 373 | 3300028381 | Ga0268264_10190157 | Ga0268264_101901572 | 223 |
| 374 | 3300028800 | Ga0265338_10006197 | Ga0265338_100061977 | 223 |
| 375 | 3300031240 | Ga0265320_10057846 | Ga0265320_100578462 | 223 |
| 376 | 3300031249 | Ga0265339_10007411 | Ga0265339_100074115 | 223 |
| 377 | 3300031456 | Ga0307513_10160352 | Ga0307513_101603521 | 223 |
| 378 | 3300031616 | Ga0307508_10143771 | Ga0307508_101437713 | 223 |
| 379 | 3300031711 | Ga0265314_10012258 | Ga0265314_100122584 | 223 |
| 380 | 3300031711 | Ga0265314_10018821 | Ga0265314_100188212 | 223 |
| 381 | 3300031730 | Ga0307516_10011544 | Ga0307516_100115448 | 223 |
| 382 | 3300031824 | Ga0307413_10011872 | Ga0307413_100118724 | 223 |
| 383 | 3300031901 | Ga0307406_10046876 | Ga0307406_100468765 | 223 |
| 384 | 3300031903 | Ga0307407_10035354 | Ga0307407_100353543 | 223 |
| 385 | 3300032005 | Ga0307411_10004937 | Ga0307411_100049375 | 223 |
| 386 | 3300032126 | Ga0307415_100019544 | Ga0307415_1000195443 | 223 |
| 387 | 3300034818 | Ga0373950_0000011 | Ga0373950_0000011_110690_111364 | 223 |
| 388 | 3300034818 | Ga0373950_0000021 | Ga0373950_0000021_198120_198794 | 223 |
| 389 | 3300035086 | Ga0373934_0148374 | Ga0373934_0148374_137_814 | 223 |
| 390 | 3300035119 | Ga0373956_0035009 | Ga0373956_0035009_1427_2101 | 223 |
| 391 | 3300035119 | Ga0373956_0158509 | Ga0373956_0158509_28_702 | 223 |
| 392 | 3300035724 | Ga0373933_0001072 | Ga0373933_0001072_8110_8784 | 223 |
| 393 | 3300035724 | Ga0373933_0072927 | Ga0373933_0072927_582_1256 | 223 |
| 394 | 3300036401 | Ga0373937_0007204 | Ga0373937_0007204_586_1260 | 223 |
| 395 | 3300039437 | Ga0436365_1544740 | Ga0436365_1544740_289_987 | 223 |
| 396 | 3300039437 | Ga0436365_1910706 | Ga0436365_1910706_162_851 | 223 |
| 397 | 3300041443 | Ga0451789_1031512 | Ga0451789_1031512_97_768 | 223 |
| 398 | 3300041451 | Ga0451791_1366606 | Ga0451791_1366606_116_790 | 223 |
| 399 | 3300041452 | Ga0451793_1487413 | Ga0451793_1487413_476_1147 | 223 |
| 400 | 3300041453 | Ga0451797_1585387 | Ga0451797_1585387_470_1141 | 223 |
| 401 | 3300041460 | Ga0451802_1886820 | Ga0451802_1886820_339_1010 | 223 |
| 402 | 3300041486 | Ga0451807_0265998 | Ga0451807_0265998_93_764 | 223 |
| 403 | 3300041486 | Ga0451807_0307229 | Ga0451807_0307229_1115_1786 | 223 |
| 404 | 3300042876 | Ga0451577_0189775 | Ga0451577_0189775_571_1290 | 223 |
| 405 | 3300044683 | Ga0466965_0027204 | Ga0466965_0027204_1628_2299 | 223 |
| 406 | 3300045051 | Ga0451576_0031549 | Ga0451576_0031549_2302_3003 | 223 |
| 407 | 3300045051 | Ga0451576_0047260 | Ga0451576_0047260_3679_4398 | 223 |
| 408 | 3300045051 | Ga0451576_0690663 | Ga0451576_0690663_163_852 | 223 |
| 409 | 3300046516 | Ga0495628_0058395 | Ga0495628_0058395_1350_2069 | 223 |
| 410 | 3300046516 | Ga0495628_0320286 | Ga0495628_0320286_441_1127 | 223 |
| 411 | 3300046517 | Ga0495630_0292400 | Ga0495630_0292400_418_1116 | 223 |
| 412 | 3300046533 | Ga0495640_0205189 | Ga0495640_0205189_44_730 | 223 |
| 413 | 3300046642 | Ga0495634_0093884 | Ga0495634_0093884_800_1519 | 223 |
| 414 | 3300046809 | Ga0495600_0045175 | Ga0495600_0045175_1455_2141 | 223 |
| 415 | 3300047319 | Ga0495674_0242913 | Ga0495674_0242913_44_730 | 223 |
| 416 | 3300047320 | Ga0495672_0000854 | Ga0495672_0000854_2848_3525 | 223 |
| 417 | 3300047471 | Ga0495684_0049454 | Ga0495684_0049454_1908_2672 | 223 |
| 418 | 3300048903 | Ga0496100_0024395 | Ga0496100_0024395_445_1134 | 223 |
| 419 | 3300048904 | Ga0496101_0290372 | Ga0496101_0290372_162_851 | 223 |
| 420 | 3300048909 | Ga0496106_0210658 | Ga0496106_0210658_270_956 | 223 |
| 421 | 3300048910 | Ga0496107_0020555 | Ga0496107_0020555_860_1546 | 223 |
| 422 | 3300048912 | Ga0496109_0037707 | Ga0496109_0037707_3212_3898 | 223 |
| 423 | 3300048913 | Ga0496110_0159677 | Ga0496110_0159677_43_729 | 223 |
| 424 | 3300048914 | Ga0496111_0146523 | Ga0496111_0146523_645_1331 | 223 |
| 425 | 3300048917 | Ga0496114_0000144 | Ga0496114_0000144_253_942 | 223 |
| 426 | 3300048917 | Ga0496114_0033660 | Ga0496114_0033660_975_1655 | 223 |
| 427 | 3300048918 | Ga0496115_0001324 | Ga0496115_0001324_12181_12870 | 223 |
| 428 | 3300049572 | Ga0501036_0037780 | Ga0501036_0037780_2241_2915 | 223 |
| 429 | 3300049583 | Ga0501067_0000002 | Ga0501067_0000002_4492_5166 | 223 |
| 430 | 3300049583 | Ga0501067_0006257 | Ga0501067_0006257_5448_6149 | 223 |
| 431 | 3300049583 | Ga0501067_0030681 | Ga0501067_0030681_1086_1763 | 223 |
| 432 | 3300049583 | Ga0501067_0123110 | Ga0501067_0123110_278_949 | 223 |
| 433 | 3300049584 | Ga0501068_0056472 | Ga0501068_0056472_185_877 | 223 |
| 434 | 3300049585 | Ga0501069_0113688 | Ga0501069_0113688_59_760 | 223 |
| 435 | 3300049588 | Ga0501072_0000020 | Ga0501072_0000020_152817_153491 | 223 |
| 436 | 3300049589 | Ga0501073_0000914 | Ga0501073_0000914_7195_7890 | 223 |
| 437 | 3300049589 | Ga0501073_0010418 | Ga0501073_0010418_546_1220 | 223 |
| 438 | 3300049589 | Ga0501073_0017283 | Ga0501073_0017283_4373_5074 | 223 |
| 439 | 3300049589 | Ga0501073_0068864 | Ga0501073_0068864_616_1305 | 223 |
| 440 | 3300049592 | Ga0501076_0105300 | Ga0501076_0105300_1287_1964 | 223 |
| 441 | 3300049741 | Ga0501079_0249991 | Ga0501079_0249991_491_1183 | 223 |
| 442 | 3300049824 | Ga0501045_0221999 | Ga0501045_0221999_174_866 | 223 |
| 443 | 3300050489 | nmdc:mga03683_33225_c1 | nmdc:mga03683_33225_c1_1068_1751 | 223 |
| 444 | 3300050490 | nmdc:mga03n38_432122_c1 | nmdc:mga03n38_432122_c1_35_712 | 223 |
| 445 | 3300050491 | nmdc:mga00v17_19076_c1 | nmdc:mga00v17_19076_c1_1778_2455 | 223 |
| 446 | 3300050492 | nmdc:mga0yw44_3851_c1 | nmdc:mga0yw44_3851_c1_2094_2777 | 223 |
| 447 | 3300050493 | nmdc:mga0k408_465_c1 | nmdc:mga0k408_465_c1_13751_14434 | 223 |
| 448 | 3300050493 | nmdc:mga0k408_47657_c1 | nmdc:mga0k408_47657_c1_31_708 | 223 |
| 449 | 3300050493 | nmdc:mga0k408_5771_c1 | nmdc:mga0k408_5771_c1_2589_3266 | 223 |
| 450 | 3300050493 | nmdc:mga0k408_64293_c1 | nmdc:mga0k408_64293_c1_1092_1784 | 223 |
| 451 | 3300050494 | nmdc:mga06z11_107037_c1 | nmdc:mga06z11_107037_c1_150_827 | 223 |
| 452 | 3300050494 | nmdc:mga06z11_13172_c1 | nmdc:mga06z11_13172_c1_2469_3152 | 223 |
| 453 | 3300050494 | nmdc:mga06z11_9348_c1 | nmdc:mga06z11_9348_c1_3126_3803 | 223 |
| 454 | 3300050495 | nmdc:mga04h51_39216_c1 | nmdc:mga04h51_39216_c1_90_767 | 223 |
| 455 | 3300050495 | nmdc:mga04h51_77204_c1 | nmdc:mga04h51_77204_c1_121_798 | 223 |
| 456 | 3300050496 | nmdc:mga07m45_11151_c1 | nmdc:mga07m45_11151_c1_1620_2297 | 223 |
| 457 | 3300050496 | nmdc:mga07m45_57449_c1 | nmdc:mga07m45_57449_c1_577_1260 | 223 |
| 458 | 3300050507 | nmdc:mga05p37_217861_c1 | nmdc:mga05p37_217861_c1_1560_2249 | 223 |
| 459 | 3300050507 | nmdc:mga05p37_28344_c1 | nmdc:mga05p37_28344_c1_1441_2124 | 223 |
| 460 | 3300050507 | nmdc:mga05p37_380757_c1 | nmdc:mga05p37_380757_c1_195_878 | 223 |
| 461 | 3300050507 | nmdc:mga05p37_677361_c1 | nmdc:mga05p37_677361_c1_238_915 | 223 |
| 462 | 3300050507 | nmdc:mga05p37_955_c1 | nmdc:mga05p37_955_c1_26945_27631 | 223 |
| 463 | 3300050508 | nmdc:mga09592_205514_c1 | nmdc:mga09592_205514_c1_646_1332 | 223 |
| 464 | 3300050508 | nmdc:mga09592_34440_c1 | nmdc:mga09592_34440_c1_1172_1858 | 223 |
| 465 | 3300050508 | nmdc:mga09592_768_c1 | nmdc:mga09592_768_c1_942_1625 | 223 |
| 466 | 3300050510 | nmdc:mga06r32_37087_c1 | nmdc:mga06r32_37087_c1_2199_2885 | 223 |
| 467 | 3300050511 | nmdc:mga08y16_4107_c1 | nmdc:mga08y16_4107_c1_7674_8363 | 223 |
| 468 | 3300050511 | nmdc:mga08y16_734_c1 | nmdc:mga08y16_734_c1_22734_23417 | 223 |
| 469 | 3300050512 | nmdc:mga0n895_41264_c1 | nmdc:mga0n895_41264_c1_189_866 | 223 |
| 470 | 3300050512 | nmdc:mga0n895_469361_c1 | nmdc:mga0n895_469361_c1_444_1118 | 223 |
| 471 | 3300050512 | nmdc:mga0n895_542023_c1 | nmdc:mga0n895_542023_c1_154_840 | 223 |
| 472 | 3300050512 | nmdc:mga0n895_91860_c1 | nmdc:mga0n895_91860_c1_811_1488 | 223 |
| 473 | 3300050513 | nmdc:mga0rr50_133356_c1 | nmdc:mga0rr50_133356_c1_89_778 | 223 |
| 474 | 3300050515 | nmdc:mga0a205_226256_c1 | nmdc:mga0a205_226256_c1_928_1605 | 223 |
| 475 | 3300050515 | nmdc:mga0a205_237581_c1 | nmdc:mga0a205_237581_c1_435_1109 | 223 |
| 476 | 3300050515 | nmdc:mga0a205_24535_c1 | nmdc:mga0a205_24535_c1_548_1225 | 223 |
| 477 | 3300050515 | nmdc:mga0a205_26638_c2 | nmdc:mga0a205_26638_c2_2498_3184 | 223 |
| 478 | 3300053084 | Ga0495595_0152961 | Ga0495595_0152961_266_952 | 223 |
| 479 | 3300053085 | Ga0495619_0004515 | Ga0495619_0004515_8074_8760 | 223 |
| 480 | 3300053096 | Ga0500641_0002076 | Ga0500641_0002076_790_1473 | 223 |
| 481 | 3300053153 | Ga0500616_0063854 | Ga0500616_0063854_1053_1730 | 223 |
| 482 | 3300059421 | Ga0590071_001992 | Ga0590071_001992_4234_4917 | 223 |
| 483 | 3300059423 | Ga0590074_001506 | Ga0590074_001506_111_794 | 223 |
| 484 | 3300059424 | Ga0590075_000057 | Ga0590075_000057_13501_14184 | 223 |
| 485 | 3300059426 | Ga0590077_000444 | Ga0590077_000444_10081_10764 | 223 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ij6-assembly1.cif.gz_B | crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine | 0.9336 | 3 | 202 |
| 4ij5-assembly1.cif.gz_B | crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 | 0.9318 | 3 | 202 |
| 1ebb-assembly1.cif.gz_A | bacillus stearothermophilus yhfr | 0.9179 | 3 | 202 |
| 6s2q-assembly2.cif.gz_D | mycobacterial hydrolase 1 | 0.9098 | 1 | 199 |
| 4pz9-assembly1.cif.gz_A | the native structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c | 0.9078 | 1 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLH5_165_364_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9474 | 4 | 202 | 3.40.50.1240 |
| af_P9WLH5_165_364_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9337 | 4 | 202 | 3.40.50.1240 |
| 4ij6B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9336 | 3 | 202 | 3.40.50.1240 |
| 1ebbA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9179 | 3 | 202 | 3.40.50.1240 |
| af_F4KI56_14_225_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9163 | 2 | 206 | 3.40.50.1240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A497AI05-F1-model_v4 | Histidine phosphatase family protein | 0.9682 | 1 | 207 |
GO:0005737
GO:0016791 |
| AF-A0A350MUW0-F1-model_v4 | Alpha-ribazole phosphatase | 0.959 | 2 | 206 |
GO:0005737
GO:0016791 |
| AF-A0A354FBG7-F1-model_v4 | Alpha-ribazole phosphatase | 0.959 | 9 | 137 |
GO:0004331
GO:0005829 GO:0043456 GO:0045820 |
| AF-A0A4Q3KHS8-F1-model_v4 | phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) | 0.9575 | 1 | 165 |
GO:0006096
GO:0016868 |
| AF-A0A3M1G1M7-F1-model_v4 | Alpha-ribazole phosphatase (EC 3.1.3.73) | 0.9565 | 2 | 186 |
GO:0009236
GO:0043755 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar