F453118

General Info

Members Datasets Scaffolds Average Seq Length
485 250 485 226

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10289559|Ga0207674_102895591
Length 252
Sequence MPTRVRPERGADPDVAQRSYRRGMTTNVTRLFLVRHGATQLTAEDRFSGSVGVDLSDEGRRQAAFLAERLALDAIAAVYASPLSRTFETAAIIARPHRLTPIERDGLREISHGRWEGLTRQEVEARYRDEYAAWEADPFTFAPEAGESGVAVLARALPVVREIVVRHAGQNVVVVSHKATLRLLLSSLLGFDARGYRDRLDQSPACLNVVDFKNPVRARLMLFNDISHYQNQPRRAEGNLSKWWDADGGAAK

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
170 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
171 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
172 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
173 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
174 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
242 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.66
Nodule 0
Rhizoplane 4.12
Rhizosphere 85.57
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10165552 3300003323 Bacteria 2535
2 Ga0070676_10002038 3300005328 Bacteria 10266
3 Ga0070676_10074002 3300005328 Unclassified 2051
4 Ga0070683_100005544 3300005329 Bacteria 10545
5 Ga0070683_100006893 3300005329 Bacteria 9547
6 Ga0070683_100342393 3300005329 Bacteria 1424
7 Ga0070690_100001352 3300005330 Bacteria 12752
8 Ga0070690_100065837 3300005330 Bacteria 2343
9 Ga0068869_100036729 3300005334 Bacteria 3479
10 Ga0068869_100061240 3300005334 Bacteria 2760
11 Ga0070666_10354108 3300005335 Unclassified 1051
12 Ga0070680_100022696 3300005336 Bacteria 5001
13 Ga0070682_100208629 3300005337 Bacteria 1383
14 Ga0068868_100055528 3300005338 Bacteria 3125
15 Ga0068868_100099105 3300005338 Bacteria 2357
16 Ga0068868_100119036 3300005338 Unclassified 2153
17 Ga0070660_100010573 3300005339 Bacteria 6522
18 Ga0070689_100010591 3300005340 Bacteria 6573
19 Ga0070689_100011368 3300005340 Bacteria 6375
20 Ga0070689_100014670 3300005340 Bacteria 5698
21 Ga0070689_100072087 3300005340 Bacteria 2700
22 Ga0070689_100255324 3300005340 Bacteria 1448
23 Ga0070691_10014588 3300005341 Bacteria 3607
24 Ga0070691_10072791 3300005341 Bacteria 1669
25 Ga0070687_100059042 3300005343 Bacteria 2018
26 Ga0070687_100075591 3300005343 Bacteria 1822
27 Ga0070687_100138276 3300005343 Bacteria 1415
28 Ga0070661_100340346 3300005344 Bacteria 1175
29 Ga0070692_10149187 3300005345 Unclassified 1330
30 Ga0070668_100009593 3300005347 Bacteria 7182
31 Ga0070669_100095425 3300005353 Unclassified 2236
32 Ga0070675_100000017 3300005354 Bacteria 180937
33 Ga0070675_100047876 3300005354 Bacteria 3504
34 Ga0070675_100799549 3300005354 Unclassified 862
35 Ga0070674_100035647 3300005356 Bacteria 3334
36 Ga0070673_100012483 3300005364 Bacteria 5833
37 Ga0070673_100262266 3300005364 Bacteria 1510
38 Ga0070673_100396401 3300005364 Bacteria 1233
39 Ga0070688_100000437 3300005365 Bacteria 21038
40 Ga0070688_100016828 3300005365 Bacteria 4186
41 Ga0070688_100153784 3300005365 Bacteria 1574
42 Ga0070659_100528267 3300005366 Unclassified 1008
43 Ga0070709_10501696 3300005434 Bacteria 922
44 Ga0070701_10012010 3300005438 Bacteria 3890
45 Ga0070701_10227790 3300005438 Bacteria 1115
46 Ga0070705_100016632 3300005440 Bacteria 3825
47 Ga0070705_100186415 3300005440 Bacteria 1410
48 Ga0070700_100000093 3300005441 Bacteria 60201
49 Ga0070700_100003434 3300005441 Bacteria 8168
50 Ga0070700_100142623 3300005441 Bacteria 1630
51 Ga0070700_100329599 3300005441 Bacteria 1124
52 Ga0070694_100009716 3300005444 Bacteria 5907
53 Ga0070694_100122393 3300005444 Bacteria 1868
54 Ga0070708_100392491 3300005445 Bacteria 1308
55 Ga0070663_100046166 3300005455 Bacteria 3081
56 Ga0070678_100040487 3300005456 Bacteria 3298
57 Ga0070678_100090152 3300005456 Bacteria 2349
58 Ga0070678_100187129 3300005456 Bacteria 1700
59 Ga0070678_100322708 3300005456 Unclassified 1319
60 Ga0070662_100125794 3300005457 Unclassified 1970
61 Ga0070681_10012390 3300005458 Bacteria 8457
62 Ga0068867_100005919 3300005459 Bacteria 8672
63 Ga0070685_10004804 3300005466 Bacteria 6842
64 Ga0070685_10011505 3300005466 Bacteria 4632
65 Ga0070685_10434174 3300005466 Unclassified 916
66 Ga0070706_100036336 3300005467 Bacteria 4549
67 Ga0070706_100134490 3300005467 Bacteria 2308
68 Ga0070706_100194753 3300005467 Bacteria 1894
69 Ga0070707_100008429 3300005468 Bacteria 9575
70 Ga0070707_100391834 3300005468 Bacteria 1349
71 Ga0070698_100002974 3300005471 Bacteria 18643
72 Ga0070698_100011845 3300005471 Bacteria 9252
73 Ga0070698_100030672 3300005471 Bacteria 5574
74 Ga0070698_100156298 3300005471 Bacteria 2226
75 Ga0070698_100172151 3300005471 Bacteria 2106
76 Ga0070699_100027788 3300005518 Bacteria 4878
77 Ga0070699_100043189 3300005518 Bacteria 3902
78 Ga0070699_100062134 3300005518 Bacteria 3237
79 Ga0070699_100180459 3300005518 Bacteria 1873
80 Ga0070679_100208887 3300005530 Bacteria 1916
81 Ga0070684_100025046 3300005535 Bacteria 5011
82 Ga0070684_100057334 3300005535 Bacteria 3401
83 Ga0070684_100080971 3300005535 Unclassified 2873
84 Ga0070684_100118662 3300005535 Bacteria 2378
85 Ga0070697_100013378 3300005536 Bacteria 6436
86 Ga0068853_100328621 3300005539 Unclassified 1419
87 Ga0070672_100015292 3300005543 Bacteria 5461
88 Ga0070686_100005262 3300005544 Bacteria 7149
89 Ga0070686_100018108 3300005544 Bacteria 4128
90 Ga0070686_100026899 3300005544 Bacteria 3476
91 Ga0070695_100097202 3300005545 Bacteria 1977
92 Ga0070695_100221606 3300005545 Unclassified 1363
93 Ga0070696_100188009 3300005546 Bacteria 1536
94 Ga0070696_100272639 3300005546 Bacteria 1287
95 Ga0070693_100123452 3300005547 Bacteria 1609
96 Ga0070704_100483719 3300005549 Bacteria 1071
97 Ga0068855_100422377 3300005563 Bacteria 1458
98 Ga0068854_100023598 3300005578 Bacteria 4204
99 Ga0068854_100132448 3300005578 Unclassified 1905
100 Ga0068856_100267817 3300005614 Bacteria 1724
101 Ga0070702_100104918 3300005615 Bacteria 1741
102 Ga0068852_100261537 3300005616 Unclassified 1662
103 Ga0068859_100010892 3300005617 Bacteria 9152
104 Ga0068859_100049689 3300005617 Bacteria 4212
105 Ga0068859_100285061 3300005617 Bacteria 1745
106 Ga0068859_100354065 3300005617 Bacteria 1563
107 Ga0068864_100298744 3300005618 Bacteria 1507
108 Ga0068861_100008361 3300005719 Bacteria 7119
109 Ga0068870_10394379 3300005840 Unclassified 899
110 Ga0068858_100022759 3300005842 Bacteria 5843
111 Ga0068858_100267610 3300005842 Unclassified 1625
112 Ga0068860_100238616 3300005843 Unclassified 1768
113 Ga0068862_100144619 3300005844 Unclassified 2112
114 Ga0068862_100520412 3300005844 Bacteria 1132
115 Ga0070717_10243789 3300006028 Bacteria 1586
116 Ga0075365_10017162 3300006038 Bacteria 4421
117 Ga0075365_10039453 3300006038 Bacteria 3075
118 Ga0075368_10033002 3300006042 Bacteria 2013
119 Ga0075363_100066942 3300006048 Bacteria 1945
120 Ga0075364_10004869 3300006051 Bacteria 7777
121 Ga0075364_10005908 3300006051 Bacteria 7152
122 Ga0075364_10029427 3300006051 Bacteria 3522
123 Ga0075362_10000540 3300006177 Bacteria 11030
124 Ga0075362_10009703 3300006177 Bacteria 3733
125 Ga0075367_10004419 3300006178 Bacteria 6867
126 Ga0075367_10053238 3300006178 Bacteria 2398
127 Ga0075367_10117507 3300006178 Bacteria 1637
128 Ga0075367_10118443 3300006178 Bacteria 1630
129 Ga0075367_10383747 3300006178 Unclassified 888
130 Ga0075369_10097159 3300006186 Bacteria 1319
131 Ga0075366_10002022 3300006195 Bacteria 10294
132 Ga0075366_10002099 3300006195 Bacteria 10134
133 Ga0075366_10050017 3300006195 Bacteria 2481
134 Ga0097621_100009912 3300006237 Bacteria 6940
135 Ga0075370_10012782 3300006353 Bacteria 4446
136 Ga0075370_10087532 3300006353 Bacteria 1795
137 Ga0068871_100006098 3300006358 Bacteria 8487
138 Ga0068871_100258614 3300006358 Bacteria 1518
139 Ga0075428_100017953 3300006844 Bacteria 7818
140 Ga0075428_100049932 3300006844 Bacteria 4589
141 Ga0075428_100071381 3300006844 Bacteria 3795
142 Ga0075428_100453172 3300006844 Unclassified 1374
143 Ga0075428_100514911 3300006844 Bacteria 1280
144 Ga0075430_100616594 3300006846 Unclassified 895
145 Ga0075430_100735114 3300006846 Bacteria 813
146 Ga0075431_100013319 3300006847 Bacteria 8311
147 Ga0075431_100071440 3300006847 Bacteria 3581
148 Ga0075433_10037480 3300006852 Bacteria 4183
149 Ga0075433_10042542 3300006852 Bacteria 3942
150 Ga0075433_10047644 3300006852 Bacteria 3728
151 Ga0075433_10101326 3300006852 Bacteria 2550
152 Ga0075433_10595456 3300006852 Bacteria 971
153 Ga0075433_10778201 3300006852 Unclassified 837
154 Ga0075434_100024686 3300006871 Bacteria 5879
155 Ga0075434_100105405 3300006871 Bacteria 2829
156 Ga0075434_100133844 3300006871 Bacteria 2499
157 Ga0075434_100394721 3300006871 Bacteria 1404
158 Ga0075434_100499636 3300006871 Bacteria 1237
159 Ga0075429_100008047 3300006880 Bacteria 9165
160 Ga0075429_100012573 3300006880 Bacteria 7341
161 Ga0075429_100059760 3300006880 Bacteria 3320
162 Ga0075429_100092135 3300006880 Unclassified 2643
163 Ga0075429_100177517 3300006880 Unclassified 1866
164 Ga0075429_100206065 3300006880 Bacteria 1723
165 Ga0068865_100008771 3300006881 Bacteria 6249
166 Ga0097620_100010892 3300006931 Bacteria 9152
167 Ga0097620_100049686 3300006931 Bacteria 4212
168 Ga0097620_100285069 3300006931 Bacteria 1745
169 Ga0097620_100354019 3300006931 Bacteria 1563
170 Ga0075435_100009191 3300007076 Bacteria 7136
171 Ga0075435_100027677 3300007076 Bacteria 4437
172 Ga0075435_100418997 3300007076 Bacteria 1153
173 Ga0105244_10037284 3300009036 Bacteria 2543
174 Ga0105240_10061201 3300009093 Bacteria 4692
175 Ga0111539_10003060 3300009094 Bacteria 22153
176 Ga0111539_10014458 3300009094 Bacteria 9850
177 Ga0111539_10045603 3300009094 Bacteria 5247
178 Ga0111539_10362381 3300009094 Bacteria 1687
179 Ga0111539_10372613 3300009094 Bacteria 1662
180 Ga0111539_10411049 3300009094 Bacteria 1576
181 Ga0111539_10815746 3300009094 Unclassified 1086
182 Ga0111539_11679136 3300009094 Bacteria 737
183 Ga0105245_10108215 3300009098 Bacteria 2581
184 Ga0114129_10006674 3300009147 Bacteria 16392
185 Ga0114129_10016383 3300009147 Bacteria 10550
186 Ga0114129_10314166 3300009147 Bacteria 2085
187 Ga0114129_10327402 3300009147 Bacteria 2035
188 Ga0114129_10366424 3300009147 Bacteria 1906
189 Ga0114129_10388922 3300009147 Bacteria 1840
190 Ga0114129_10426041 3300009147 Bacteria 1744
191 Ga0114129_10983289 3300009147 Bacteria 1064
192 Ga0105243_10009910 3300009148 Bacteria 7244
193 Ga0105243_10019546 3300009148 Bacteria 5136
194 Ga0105242_10914737 3300009176 Unclassified 878
195 Ga0105248_10140214 3300009177 Bacteria 2727
196 Ga0105248_10351764 3300009177 Bacteria 1659
197 Ga0105248_10470641 3300009177 Bacteria 1416
198 Ga0105249_10963326 3300009553 Bacteria 921
199 Ga0105239_10398658 3300010375 Bacteria 1557
200 Ga0105239_11482579 3300010375 Unclassified 784
201 Ga0157374_10046819 3300013296 Bacteria 4007
202 Ga0157378_10211449 3300013297 Bacteria 1839
203 Ga0157378_10336459 3300013297 Bacteria 1471
204 Ga0157378_10491078 3300013297 Bacteria 1225
205 Ga0163162_10054885 3300013306 Bacteria 4009
206 Ga0157375_10007654 3300013308 Bacteria 9449
207 Ga0157375_10258692 3300013308 Bacteria 1902
208 Ga0163163_10078747 3300014325 Bacteria 3293
209 Ga0157379_10373311 3300014968 Bacteria 1308
210 Ga0157376_10024822 3300014969 Bacteria 4714
211 Ga0213876_10073933 3300021384 Bacteria 1800
212 Ga0207697_10067501 3300025315 Bacteria 1495
213 Ga0207656_10120445 3300025321 Unclassified 1221
214 Ga0207653_10092472 3300025885 Bacteria 1061
215 Ga0207645_10010682 3300025907 Bacteria 6297
216 Ga0207645_10070391 3300025907 Unclassified 2237
217 Ga0207643_10320072 3300025908 Unclassified 968
218 Ga0207684_10107912 3300025910 Bacteria 2382
219 Ga0207707_10020033 3300025912 Bacteria 5836
220 Ga0207695_10303620 3300025913 Bacteria 1487
221 Ga0207660_10014590 3300025917 Bacteria 5170
222 Ga0207662_10002590 3300025918 Bacteria 9115
223 Ga0207662_10023066 3300025918 Bacteria 3573
224 Ga0207657_10010775 3300025919 Bacteria 9101
225 Ga0207649_10263849 3300025920 Bacteria 1246
226 Ga0207652_10152753 3300025921 Unclassified 2068
227 Ga0207646_10002938 3300025922 Bacteria 19758
228 Ga0207681_10006614 3300025923 Bacteria 7116
229 Ga0207650_10027775 3300025925 Unclassified 4053
230 Ga0207650_10071158 3300025925 Unclassified 2616
231 Ga0207659_10039614 3300025926 Bacteria 3288
232 Ga0207659_10696221 3300025926 Unclassified 870
233 Ga0207687_10144129 3300025927 Unclassified 1810
234 Ga0207690_10106889 3300025932 Bacteria 2009
235 Ga0207690_10273154 3300025932 Bacteria 1314
236 Ga0207690_10403236 3300025932 Unclassified 1091
237 Ga0207706_10071622 3300025933 Unclassified 3049
238 Ga0207706_10084186 3300025933 Bacteria 2796
239 Ga0207706_10341336 3300025933 Unclassified 1303
240 Ga0207686_10013858 3300025934 Bacteria 4472
241 Ga0207686_10258424 3300025934 Bacteria 1276
242 Ga0207670_10052345 3300025936 Bacteria 2745
243 Ga0207670_10106385 3300025936 Bacteria 2012
244 Ga0207670_10109432 3300025936 Bacteria 1988
245 Ga0207670_10333514 3300025936 Bacteria 1197
246 Ga0207670_10688437 3300025936 Bacteria 845
247 Ga0207669_10001218 3300025937 Bacteria 10942
248 Ga0207669_10068953 3300025937 Bacteria 2211
249 Ga0207704_10007895 3300025938 Bacteria 5054
250 Ga0207704_10048326 3300025938 Bacteria 2550
251 Ga0207704_10275682 3300025938 Unclassified 1276
252 Ga0207704_10386967 3300025938 Bacteria 1099
253 Ga0207691_10006506 3300025940 Bacteria 11279
254 Ga0207691_10032458 3300025940 Bacteria 4867
255 Ga0207691_10124962 3300025940 Bacteria 2277
256 Ga0207711_10070072 3300025941 Bacteria 3040
257 Ga0207689_10017182 3300025942 Bacteria 6124
258 Ga0207661_10001745 3300025944 Bacteria 14884
259 Ga0207661_10005508 3300025944 Bacteria 8929
260 Ga0207661_11001905 3300025944 Bacteria 769
261 Ga0207651_10066846 3300025960 Bacteria 2527
262 Ga0207651_10453940 3300025960 Bacteria 1100
263 Ga0207712_10237270 3300025961 Unclassified 1467
264 Ga0207712_10278223 3300025961 Bacteria 1365
265 Ga0207668_10011609 3300025972 Bacteria 5358
266 Ga0207640_10103133 3300025981 Unclassified 2005
267 Ga0207658_10247212 3300025986 Bacteria 1514
268 Ga0207677_10006548 3300026023 Bacteria 6395
269 Ga0207677_10069787 3300026023 Bacteria 2473
270 Ga0207678_10006988 3300026067 Bacteria 10020
271 Ga0207708_10000122 3300026075 Bacteria 60186
272 Ga0207708_10007213 3300026075 Bacteria 8217
273 Ga0207708_10010749 3300026075 Bacteria 6804
274 Ga0207641_10011424 3300026088 Bacteria 7289
275 Ga0207641_10559718 3300026088 Bacteria 1116
276 Ga0207648_10004342 3300026089 Bacteria 14590
277 Ga0207674_10289559 3300026116 Unclassified 1586
278 Ga0207675_100011234 3300026118 Bacteria 8388
279 Ga0207675_100046533 3300026118 Bacteria 4053
280 Ga0207683_10044445 3300026121 Bacteria 3883
281 Ga0207683_10059496 3300026121 Bacteria 3356
282 Ga0207683_10510540 3300026121 Bacteria 1110
283 Ga0207698_10283352 3300026142 Unclassified 1534
284 Ga0207698_10294480 3300026142 Unclassified 1508
285 Ga0207428_10000043 3300027907 Bacteria 198931
286 Ga0207428_10003562 3300027907 Bacteria 15046
287 Ga0207428_10004590 3300027907 Bacteria 13090
288 Ga0207428_10187423 3300027907 Bacteria 1560
289 Ga0268266_10366785 3300028379 Unclassified 1356
290 Ga0268264_10190157 3300028381 Unclassified 1871
291 Ga0265338_10006197 3300028800 Bacteria 15330
292 Ga0265338_10215693 3300028800 Bacteria 1437
293 Ga0265320_10031567 3300031240 Bacteria 2719
294 Ga0265320_10057846 3300031240 Bacteria 1858
295 Ga0265325_10027919 3300031241 Bacteria 3047
296 Ga0265339_10007411 3300031249 Bacteria 7091
297 Ga0307513_10160352 3300031456 Bacteria 2143
298 Ga0307408_100054016 3300031548 Bacteria 2904
299 Ga0307508_10143771 3300031616 Bacteria 1989
300 Ga0265314_10005749 3300031711 Bacteria 11127
301 Ga0265314_10012258 3300031711 Bacteria 7012
302 Ga0265314_10018821 3300031711 Bacteria 5366
303 Ga0265342_10000227 3300031712 Bacteria 63446
304 Ga0307516_10011544 3300031730 Bacteria 9587
305 Ga0307413_10011872 3300031824 Bacteria 4306
306 Ga0307406_10046876 3300031901 Bacteria 2721
307 Ga0307407_10035354 3300031903 Bacteria 2744
308 Ga0307407_10585309 3300031903 Bacteria 829
309 Ga0307416_100024770 3300032002 Bacteria 4387
310 Ga0307411_10004937 3300032005 Bacteria 6485
311 Ga0307415_100019544 3300032126 Bacteria 4115
312 Ga0307415_100324007 3300032126 Unclassified 1286
313 Ga0373950_0000011 3300034818 Bacteria 365678
314 Ga0373950_0000021 3300034818 Bacteria 209053
315 Ga0373934_0148374 3300035086 Bacteria 960
316 Ga0373956_0035009 3300035119 Bacteria 2213
317 Ga0373956_0158509 3300035119 Bacteria 1066
318 Ga0373956_0272215 3300035119 Bacteria 806
319 Ga0373933_0001072 3300035724 Bacteria 16487
320 Ga0373933_0072927 3300035724 Bacteria 2091
321 Ga0373947_0499588 3300035725 Bacteria 826
322 Ga0373937_0007204 3300036401 Bacteria 9624
323 Ga0373937_0471220 3300036401 Bacteria 1193
324 Ga0373925_0555092 3300037068 Bacteria 945
325 Ga0436365_1544740 3300039437 Bacteria 1971
326 Ga0436365_1910706 3300039437 Bacteria 907
327 Ga0451789_1031512 3300041443 Bacteria 901
328 Ga0451791_1366606 3300041451 Bacteria 920
329 Ga0451793_0048559 3300041452 Bacteria 817
330 Ga0451793_1487413 3300041452 Bacteria 1729
331 Ga0451797_1585387 3300041453 Bacteria 2119
332 Ga0451802_1886820 3300041460 Bacteria 1352
333 Ga0451807_0265998 3300041486 Bacteria 945
334 Ga0451807_0307229 3300041486 Bacteria 3458
335 Ga0451853_1150549 3300041512 Bacteria 6256
336 Ga0439433_0009629 3300041999 Bacteria 2108
337 Ga0439435_0000521 3300042436 Bacteria 6160
338 Ga0439435_0011880 3300042436 Bacteria 2097
339 Ga0439435_0037560 3300042436 Bacteria 1342
340 Ga0451577_0189775 3300042876 Bacteria 1854
341 Ga0466965_0027204 3300044683 Bacteria 2775
342 Ga0453684_0007820 3300044712 Bacteria 19492
343 Ga0453684_0038985 3300044712 Archaea 6482
344 Ga0453684_0066573 3300044712 Bacteria 4586
345 Ga0451576_0031549 3300045051 Bacteria 5647
346 Ga0451576_0047260 3300045051 Bacteria 4526
347 Ga0451576_0690663 3300045051 Bacteria 1072
348 Ga0451576_1590626 3300045051 Bacteria 678
349 Ga0495628_0001563 3300046516 Bacteria 20963
350 Ga0495628_0058395 3300046516 Bacteria 3032
351 Ga0495628_0320286 3300046516 Unclassified 1144
352 Ga0495630_0292400 3300046517 Bacteria 1245
353 Ga0495640_0205189 3300046533 Unclassified 1248
354 Ga0495667_0444361 3300046559 Unclassified 815
355 Ga0495634_0093884 3300046642 Bacteria 1945
356 Ga0495635_0242203 3300046663 Unclassified 1217
357 Ga0495600_0045175 3300046809 Bacteria 2874
358 Ga0495674_0242913 3300047319 Unclassified 1483
359 Ga0495674_0275417 3300047319 Bacteria 1380
360 Ga0495672_0000854 3300047320 Bacteria 32244
361 Ga0495680_0068206 3300047322 Unclassified 2718
362 Ga0495684_0049454 3300047471 Bacteria 3212
363 Ga0495684_0286852 3300047471 Unclassified 1186
364 Ga0495602_0459863 3300048088 Bacteria 897
365 Ga0496100_0024395 3300048903 Bacteria 3689
366 Ga0496101_0290372 3300048904 Bacteria 1279
367 Ga0496105_0233560 3300048908 Bacteria 1494
368 Ga0496106_0210658 3300048909 Unclassified 1548
369 Ga0496107_0020555 3300048910 Bacteria 4665
370 Ga0496109_0037707 3300048912 Bacteria 4368
371 Ga0496110_0159677 3300048913 Bacteria 2043
372 Ga0496111_0146523 3300048914 Bacteria 1751
373 Ga0496112_0308670 3300048915 Bacteria 1527
374 Ga0496114_0000144 3300048917 Bacteria 51829
375 Ga0496114_0033660 3300048917 Bacteria 4224
376 Ga0496115_0001324 3300048918 Bacteria 17654
377 Ga0501034_0455019 3300049571 Bacteria 1197
378 Ga0501036_0037780 3300049572 Bacteria 4084
379 Ga0501039_0068781 3300049575 Bacteria 2749
380 Ga0501039_0528239 3300049575 Bacteria 926
381 Ga0501040_0182201 3300049576 Bacteria 1489
382 Ga0501042_0487032 3300049578 Bacteria 895
383 Ga0501067_0000002 3300049583 Bacteria 176461
384 Ga0501067_0006257 3300049583 Bacteria 6604
385 Ga0501067_0030681 3300049583 Bacteria 2981
386 Ga0501067_0123110 3300049583 Bacteria 1443
387 Ga0501068_0056472 3300049584 Bacteria 2380
388 Ga0501069_0016493 3300049585 Bacteria 3969
389 Ga0501069_0113688 3300049585 Bacteria 1543
390 Ga0501070_0000004 3300049586 Bacteria 254956
391 Ga0501072_0000020 3300049588 Bacteria 156058
392 Ga0501072_0314186 3300049588 Bacteria 1245
393 Ga0501073_0000914 3300049589 Bacteria 21232
394 Ga0501073_0008532 3300049589 Bacteria 7598
395 Ga0501073_0010418 3300049589 Bacteria 6818
396 Ga0501073_0017283 3300049589 Bacteria 5225
397 Ga0501073_0068864 3300049589 Unclassified 2466
398 Ga0501075_0038230 3300049591 Bacteria 3587
399 Ga0501075_0678132 3300049591 Bacteria 785
400 Ga0501076_0021643 3300049592 Bacteria 4935
401 Ga0501076_0044186 3300049592 Bacteria 3513
402 Ga0501076_0105300 3300049592 Bacteria 2276
403 Ga0501079_0249991 3300049741 Bacteria 1386
404 Ga0501081_0030843 3300049743 Bacteria 3632
405 Ga0501081_0271634 3300049743 Unclassified 1240
406 Ga0501083_0003177 3300049744 Bacteria 11435
407 Ga0501045_0221999 3300049824 Bacteria 1407
408 nmdc:mga03683_33225_c1 3300050489 Bacteria 2080
409 nmdc:mga03n38_432122_c1 3300050490 Bacteria 730
410 nmdc:mga00v17_112418_c1 3300050491 Unclassified 1728
411 nmdc:mga00v17_19076_c1 3300050491 Bacteria 3909
412 nmdc:mga00v17_47356_c1 3300050491 Bacteria 2604
413 nmdc:mga0yw44_3851_c1 3300050492 Bacteria 6747
414 nmdc:mga0k408_350727_c1 3300050493 Bacteria 880
415 nmdc:mga0k408_465_c1 3300050493 Bacteria 22259
416 nmdc:mga0k408_47657_c1 3300050493 Bacteria 2477
417 nmdc:mga0k408_5771_c1 3300050493 Bacteria 6590
418 nmdc:mga0k408_64293_c1 3300050493 Bacteria 2135
419 nmdc:mga06z11_107037_c1 3300050494 Bacteria 1543
420 nmdc:mga06z11_13172_c1 3300050494 Bacteria 3622
421 nmdc:mga06z11_23342_c1 3300050494 Bacteria 2904
422 nmdc:mga06z11_9348_c1 3300050494 Bacteria 4128
423 nmdc:mga04h51_39216_c1 3300050495 Bacteria 1538
424 nmdc:mga04h51_77204_c1 3300050495 Bacteria 1175
425 nmdc:mga07m45_11151_c1 3300050496 Bacteria 4716
426 nmdc:mga07m45_57449_c1 3300050496 Bacteria 2200
427 nmdc:mga05p37_210345_c1 3300050507 Bacteria 2352
428 nmdc:mga05p37_217861_c1 3300050507 Bacteria 2305
429 nmdc:mga05p37_269461_c1 3300050507 Bacteria 2035
430 nmdc:mga05p37_28344_c1 3300050507 Bacteria 6829
431 nmdc:mga05p37_34191_c1 3300050507 Bacteria 6225
432 nmdc:mga05p37_352278_c1 3300050507 Bacteria 1733
433 nmdc:mga05p37_380757_c1 3300050507 Bacteria 1653
434 nmdc:mga05p37_677361_c1 3300050507 Bacteria 1150
435 nmdc:mga05p37_73060_c1 3300050507 Bacteria 4221
436 nmdc:mga05p37_950614_c1 3300050507 Bacteria 920
437 nmdc:mga05p37_955_c1 3300050507 Bacteria 32691
438 nmdc:mga09592_205514_c1 3300050508 Bacteria 1706
439 nmdc:mga09592_34440_c1 3300050508 Bacteria 4233
440 nmdc:mga09592_758704_c1 3300050508 Bacteria 823
441 nmdc:mga09592_768_c1 3300050508 Bacteria 24736
442 nmdc:mga09592_96145_c1 3300050508 Bacteria 2534
443 nmdc:mga0qj67_114379_c1 3300050509 Bacteria 2179
444 nmdc:mga0qj67_201566_c1 3300050509 Bacteria 1617
445 nmdc:mga06r32_37087_c1 3300050510 Bacteria 4611
446 nmdc:mga06r32_740562_c1 3300050510 Unclassified 946
447 nmdc:mga08y16_160079_c1 3300050511 Bacteria 2339
448 nmdc:mga08y16_330855_c1 3300050511 Bacteria 1567
449 nmdc:mga08y16_342060_c1 3300050511 Bacteria 1538
450 nmdc:mga08y16_4107_c1 3300050511 Bacteria 15189
451 nmdc:mga08y16_643205_c1 3300050511 Bacteria 1065
452 nmdc:mga08y16_734_c1 3300050511 Bacteria 31115
453 nmdc:mga0n895_366097_c1 3300050512 Bacteria 1459
454 nmdc:mga0n895_41264_c1 3300050512 Bacteria 4484
455 nmdc:mga0n895_44534_c1 3300050512 Bacteria 4327
456 nmdc:mga0n895_469361_c1 3300050512 Bacteria 1270
457 nmdc:mga0n895_542023_c1 3300050512 Bacteria 1170
458 nmdc:mga0n895_91860_c1 3300050512 Unclassified 3038
459 nmdc:mga0n895_92700_c1 3300050512 Bacteria 3024
460 nmdc:mga0rr50_133356_c1 3300050513 Bacteria 1991
461 nmdc:mga0rr50_5999_c1 3300050513 Bacteria 7332
462 nmdc:mga0rr50_93507_c1 3300050513 Bacteria 2346
463 nmdc:mga08x19_81960_c1 3300050514 Bacteria 2119
464 nmdc:mga0a205_226256_c1 3300050515 Bacteria 1755
465 nmdc:mga0a205_237581_c1 3300050515 Bacteria 1704
466 nmdc:mga0a205_24535_c1 3300050515 Bacteria 5736
467 nmdc:mga0a205_261110_c1 3300050515 Bacteria 1609
468 nmdc:mga0a205_26638_c2 3300050515 Bacteria 4707
469 Ga0495595_0152961 3300053084 Unclassified 1136
470 Ga0495619_0004515 3300053085 Bacteria 8890
471 Ga0500566_0169295 3300053094 Unclassified 1131
472 Ga0500641_0002076 3300053096 Bacteria 7106
473 Ga0500616_0063854 3300053153 Bacteria 1898
474 Ga0501084_0682340 3300054114 Bacteria 867
475 Ga0590071_000387 3300059421 Bacteria 12959
476 Ga0590071_001992 3300059421 Bacteria 5223
477 Ga0590074_001506 3300059423 Bacteria 3768
478 Ga0590075_000057 3300059424 Bacteria 28475
479 Ga0590075_000353 3300059424 Bacteria 12802
480 Ga0590077_000444 3300059426 Bacteria 11626
481 Ga0590077_000726 3300059426 Bacteria 8636
482 Ga0501082_0005148 3300060353 Bacteria 11383
483 Ga0501082_0113936 3300060353 Bacteria 2342
484 Ga0501082_0145106 3300060353 Unclassified 2060
485 Ga0530510_0135234 3300061734 Bacteria 1815

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100194753 Ga0070706_1001947532 199
2 3300005468 Ga0070707_100391834 Ga0070707_1003918342 199
3 3300005471 Ga0070698_100011845 Ga0070698_1000118455 199
4 3300005518 Ga0070699_100062134 Ga0070699_1000621342 199
5 3300045051 Ga0451576_1590626 Ga0451576_1590626_52_660 199
6 3300048908 Ga0496105_0233560 Ga0496105_0233560_394_1023 203
7 3300005343 Ga0070687_100138276 Ga0070687_1001382762 205
8 3300042436 Ga0439435_0037560 Ga0439435_0037560_10_687 205
9 3300050491 nmdc:mga00v17_112418_c1 nmdc:mga00v17_112418_c1_957_1613 205
10 3300009094 Ga0111539_10815746 Ga0111539_108157462 208
11 3300006178 Ga0075367_10117507 Ga0075367_101175073 214
12 3300006195 Ga0075366_10050017 Ga0075366_100500175 214
13 3300046516 Ga0495628_0001563 Ga0495628_0001563_14914_15597 214
14 3300009094 Ga0111539_10411049 Ga0111539_104110492 215
15 3300050515 nmdc:mga0a205_261110_c1 nmdc:mga0a205_261110_c1_533_1183 215
16 3300053094 Ga0500566_0169295 Ga0500566_0169295_456_1121 216
17 3300005445 Ga0070708_100392491 Ga0070708_1003924912 217
18 3300006852 Ga0075433_10778201 Ga0075433_107782011 217
19 3300049576 Ga0501040_0182201 Ga0501040_0182201_761_1420 217
20 3300049591 Ga0501075_0038230 Ga0501075_0038230_2496_3155 217
21 3300049592 Ga0501076_0021643 Ga0501076_0021643_1698_2357 217
22 3300060353 Ga0501082_0113936 Ga0501082_0113936_934_1593 217
23 3300005329 Ga0070683_100342393 Ga0070683_1003423932 218
24 3300005434 Ga0070709_10501696 Ga0070709_105016961 218
25 3300005547 Ga0070693_100123452 Ga0070693_1001234522 218
26 3300006028 Ga0070717_10243789 Ga0070717_102437892 218
27 3300028800 Ga0265338_10215693 Ga0265338_102156932 218
28 3300031240 Ga0265320_10031567 Ga0265320_100315672 218
29 3300031711 Ga0265314_10005749 Ga0265314_100057492 218
30 3300031712 Ga0265342_10000227 Ga0265342_1000022715 218
31 3300031903 Ga0307407_10585309 Ga0307407_105853091 218
32 3300035725 Ga0373947_0499588 Ga0373947_0499588_69_743 218
33 3300037068 Ga0373925_0555092 Ga0373925_0555092_214_888 218
34 3300050511 nmdc:mga08y16_342060_c1 nmdc:mga08y16_342060_c1_173_841 218
35 3300061734 Ga0530510_0135234 Ga0530510_0135234_856_1518 218
36 3300005339 Ga0070660_100010573 Ga0070660_1000105733 219
37 3300005344 Ga0070661_100340346 Ga0070661_1003403462 219
38 3300005438 Ga0070701_10227790 Ga0070701_102277902 219
39 3300005441 Ga0070700_100000093 Ga0070700_10000009314 219
40 3300005458 Ga0070681_10012390 Ga0070681_100123903 219
41 3300005530 Ga0070679_100208887 Ga0070679_1002088872 219
42 3300005549 Ga0070704_100483719 Ga0070704_1004837192 219
43 3300005844 Ga0068862_100520412 Ga0068862_1005204122 219
44 3300006871 Ga0075434_100394721 Ga0075434_1003947211 219
45 3300009094 Ga0111539_10362381 Ga0111539_103623812 219
46 3300009177 Ga0105248_10351764 Ga0105248_103517642 219
47 3300010375 Ga0105239_11482579 Ga0105239_114825791 219
48 3300025912 Ga0207707_10020033 Ga0207707_100200335 219
49 3300025919 Ga0207657_10010775 Ga0207657_100107756 219
50 3300025920 Ga0207649_10263849 Ga0207649_102638492 219
51 3300025921 Ga0207652_10152753 Ga0207652_101527532 219
52 3300025941 Ga0207711_10070072 Ga0207711_100700723 219
53 3300026075 Ga0207708_10000122 Ga0207708_1000012214 219
54 3300032126 Ga0307415_100324007 Ga0307415_1003240072 219
55 3300035119 Ga0373956_0272215 Ga0373956_0272215_11_670 219
56 3300044712 Ga0453684_0038985 Ga0453684_0038985_737_1408 219
57 3300044712 Ga0453684_0066573 Ga0453684_0066573_3716_4381 219
58 3300047322 Ga0495680_0068206 Ga0495680_0068206_1332_2021 219
59 3300047471 Ga0495684_0286852 Ga0495684_0286852_67_756 219
60 3300048088 Ga0495602_0459863 Ga0495602_0459863_169_828 219
61 3300048915 Ga0496112_0308670 Ga0496112_0308670_383_1042 219
62 3300050508 nmdc:mga09592_758704_c1 nmdc:mga09592_758704_c1_13_681 219
63 3300050511 nmdc:mga08y16_643205_c1 nmdc:mga08y16_643205_c1_36_701 219
64 3300050513 nmdc:mga0rr50_93507_c1 nmdc:mga0rr50_93507_c1_1598_2287 219
65 3300005329 Ga0070683_100006893 Ga0070683_1000068937 220
66 3300005354 Ga0070675_100799549 Ga0070675_1007995491 220
67 3300005441 Ga0070700_100142623 Ga0070700_1001426232 220
68 3300005518 Ga0070699_100180459 Ga0070699_1001804592 220
69 3300005535 Ga0070684_100057334 Ga0070684_1000573344 220
70 3300005563 Ga0068855_100422377 Ga0068855_1004223772 220
71 3300005618 Ga0068864_100298744 Ga0068864_1002987441 220
72 3300006178 Ga0075367_10383747 Ga0075367_103837472 220
73 3300006844 Ga0075428_100071381 Ga0075428_1000713812 220
74 3300006846 Ga0075430_100616594 Ga0075430_1006165941 220
75 3300006846 Ga0075430_100735114 Ga0075430_1007351141 220
76 3300006847 Ga0075431_100071440 Ga0075431_1000714403 220
77 3300006871 Ga0075434_100133844 Ga0075434_1001338442 220
78 3300006880 Ga0075429_100008047 Ga0075429_1000080475 220
79 3300006880 Ga0075429_100177517 Ga0075429_1001775172 220
80 3300007076 Ga0075435_100009191 Ga0075435_1000091915 220
81 3300009093 Ga0105240_10061201 Ga0105240_100612012 220
82 3300009094 Ga0111539_10045603 Ga0111539_100456033 220
83 3300009094 Ga0111539_10372613 Ga0111539_103726132 220
84 3300009147 Ga0114129_10006674 Ga0114129_100066749 220
85 3300009147 Ga0114129_10388922 Ga0114129_103889221 220
86 3300009177 Ga0105248_10470641 Ga0105248_104706412 220
87 3300025315 Ga0207697_10067501 Ga0207697_100675012 220
88 3300025913 Ga0207695_10303620 Ga0207695_103036202 220
89 3300025932 Ga0207690_10273154 Ga0207690_102731542 220
90 3300025944 Ga0207661_10005508 Ga0207661_100055087 220
91 3300027907 Ga0207428_10003562 Ga0207428_100035624 220
92 3300027907 Ga0207428_10187423 Ga0207428_101874232 220
93 3300031548 Ga0307408_100054016 Ga0307408_1000540163 220
94 3300032002 Ga0307416_100024770 Ga0307416_1000247704 220
95 3300041999 Ga0439433_0009629 Ga0439433_0009629_264_932 220
96 3300042436 Ga0439435_0011880 Ga0439435_0011880_79_747 220
97 3300049571 Ga0501034_0455019 Ga0501034_0455019_220_888 220
98 3300049575 Ga0501039_0068781 Ga0501039_0068781_801_1463 220
99 3300049578 Ga0501042_0487032 Ga0501042_0487032_100_762 220
100 3300049591 Ga0501075_0678132 Ga0501075_0678132_86_754 220
101 3300049592 Ga0501076_0044186 Ga0501076_0044186_2735_3397 220
102 3300049743 Ga0501081_0271634 Ga0501081_0271634_292_960 220
103 3300050491 nmdc:mga00v17_47356_c1 nmdc:mga00v17_47356_c1_407_1075 220
104 3300050507 nmdc:mga05p37_210345_c1 nmdc:mga05p37_210345_c1_1472_2152 220
105 3300050507 nmdc:mga05p37_34191_c1 nmdc:mga05p37_34191_c1_1686_2354 220
106 3300050507 nmdc:mga05p37_73060_c1 nmdc:mga05p37_73060_c1_792_1454 220
107 3300050508 nmdc:mga09592_96145_c1 nmdc:mga09592_96145_c1_75_743 220
108 3300050509 nmdc:mga0qj67_114379_c1 nmdc:mga0qj67_114379_c1_1293_1961 220
109 3300050509 nmdc:mga0qj67_201566_c1 nmdc:mga0qj67_201566_c1_105_773 220
110 3300050511 nmdc:mga08y16_160079_c1 nmdc:mga08y16_160079_c1_1169_1837 220
111 3300050511 nmdc:mga08y16_330855_c1 nmdc:mga08y16_330855_c1_577_1245 220
112 3300050512 nmdc:mga0n895_366097_c1 nmdc:mga0n895_366097_c1_776_1438 220
113 3300050512 nmdc:mga0n895_44534_c1 nmdc:mga0n895_44534_c1_1358_2026 220
114 3300050513 nmdc:mga0rr50_5999_c1 nmdc:mga0rr50_5999_c1_5393_6061 220
115 3300054114 Ga0501084_0682340 Ga0501084_0682340_56_724 220
116 3300059421 Ga0590071_000387 Ga0590071_000387_3130_3798 220
117 3300059424 Ga0590075_000353 Ga0590075_000353_6812_7480 220
118 3300059426 Ga0590077_000726 Ga0590077_000726_4732_5400 220
119 3300060353 Ga0501082_0145106 Ga0501082_0145106_1118_1780 220
120 3300005354 Ga0070675_100000017 Ga0070675_1000000175 221
121 3300005535 Ga0070684_100118662 Ga0070684_1001186622 221
122 3300006852 Ga0075433_10101326 Ga0075433_101013261 221
123 3300009036 Ga0105244_10037284 Ga0105244_100372843 221
124 3300025944 Ga0207661_11001905 Ga0207661_110019051 221
125 3300031241 Ga0265325_10027919 Ga0265325_100279192 221
126 3300036401 Ga0373937_0471220 Ga0373937_0471220_18_689 221
127 3300041512 Ga0451853_1150549 Ga0451853_1150549_1867_2535 221
128 3300044712 Ga0453684_0007820 Ga0453684_0007820_3286_3960 221
129 3300046559 Ga0495667_0444361 Ga0495667_0444361_108_779 221
130 3300046663 Ga0495635_0242203 Ga0495635_0242203_121_792 221
131 3300047319 Ga0495674_0275417 Ga0495674_0275417_585_1256 221
132 3300050493 nmdc:mga0k408_350727_c1 nmdc:mga0k408_350727_c1_100_765 221
133 3300050494 nmdc:mga06z11_23342_c1 nmdc:mga06z11_23342_c1_2146_2811 221
134 3300050510 nmdc:mga06r32_740562_c1 nmdc:mga06r32_740562_c1_45_716 221
135 3300005471 Ga0070698_100156298 Ga0070698_1001562982 222
136 3300005545 Ga0070695_100221606 Ga0070695_1002216061 222
137 3300005546 Ga0070696_100188009 Ga0070696_1001880092 222
138 3300006852 Ga0075433_10595456 Ga0075433_105954562 222
139 3300006871 Ga0075434_100105405 Ga0075434_1001054053 222
140 3300009094 Ga0111539_11679136 Ga0111539_116791361 222
141 3300009147 Ga0114129_10327402 Ga0114129_103274022 222
142 3300009147 Ga0114129_10426041 Ga0114129_104260412 222
143 3300041452 Ga0451793_0048559 Ga0451793_0048559_41_709 222
144 3300042436 Ga0439435_0000521 Ga0439435_0000521_1774_2451 222
145 3300049575 Ga0501039_0528239 Ga0501039_0528239_21_743 222
146 3300049585 Ga0501069_0016493 Ga0501069_0016493_1753_2430 222
147 3300049586 Ga0501070_0000004 Ga0501070_0000004_103295_103972 222
148 3300049588 Ga0501072_0314186 Ga0501072_0314186_60_737 222
149 3300049589 Ga0501073_0008532 Ga0501073_0008532_2645_3322 222
150 3300049743 Ga0501081_0030843 Ga0501081_0030843_2909_3586 222
151 3300049744 Ga0501083_0003177 Ga0501083_0003177_2844_3521 222
152 3300050507 nmdc:mga05p37_269461_c1 nmdc:mga05p37_269461_c1_797_1477 222
153 3300050507 nmdc:mga05p37_352278_c1 nmdc:mga05p37_352278_c1_636_1307 222
154 3300050507 nmdc:mga05p37_950614_c1 nmdc:mga05p37_950614_c1_84_755 222
155 3300050512 nmdc:mga0n895_92700_c1 nmdc:mga0n895_92700_c1_1183_1854 222
156 3300050514 nmdc:mga08x19_81960_c1 nmdc:mga08x19_81960_c1_879_1550 222
157 3300060353 Ga0501082_0005148 Ga0501082_0005148_7869_8546 222
158 3300003323 rootH1_10165552 rootH1_101655522 223
159 3300005328 Ga0070676_10002038 Ga0070676_100020382 223
160 3300005328 Ga0070676_10074002 Ga0070676_100740023 223
161 3300005329 Ga0070683_100005544 Ga0070683_1000055444 223
162 3300005330 Ga0070690_100001352 Ga0070690_1000013528 223
163 3300005330 Ga0070690_100065837 Ga0070690_1000658371 223
164 3300005334 Ga0068869_100036729 Ga0068869_1000367294 223
165 3300005334 Ga0068869_100061240 Ga0068869_1000612401 223
166 3300005335 Ga0070666_10354108 Ga0070666_103541081 223
167 3300005336 Ga0070680_100022696 Ga0070680_1000226963 223
168 3300005337 Ga0070682_100208629 Ga0070682_1002086291 223
169 3300005338 Ga0068868_100055528 Ga0068868_1000555283 223
170 3300005338 Ga0068868_100099105 Ga0068868_1000991053 223
171 3300005338 Ga0068868_100119036 Ga0068868_1001190362 223
172 3300005340 Ga0070689_100010591 Ga0070689_1000105914 223
173 3300005340 Ga0070689_100011368 Ga0070689_1000113681 223
174 3300005340 Ga0070689_100014670 Ga0070689_1000146704 223
175 3300005340 Ga0070689_100072087 Ga0070689_1000720873 223
176 3300005340 Ga0070689_100255324 Ga0070689_1002553243 223
177 3300005341 Ga0070691_10014588 Ga0070691_100145882 223
178 3300005341 Ga0070691_10072791 Ga0070691_100727912 223
179 3300005343 Ga0070687_100059042 Ga0070687_1000590422 223
180 3300005343 Ga0070687_100075591 Ga0070687_1000755913 223
181 3300005345 Ga0070692_10149187 Ga0070692_101491872 223
182 3300005347 Ga0070668_100009593 Ga0070668_1000095933 223
183 3300005353 Ga0070669_100095425 Ga0070669_1000954252 223
184 3300005354 Ga0070675_100047876 Ga0070675_1000478763 223
185 3300005356 Ga0070674_100035647 Ga0070674_1000356475 223
186 3300005364 Ga0070673_100012483 Ga0070673_1000124834 223
187 3300005364 Ga0070673_100262266 Ga0070673_1002622662 223
188 3300005364 Ga0070673_100396401 Ga0070673_1003964012 223
189 3300005365 Ga0070688_100000437 Ga0070688_10000043725 223
190 3300005365 Ga0070688_100016828 Ga0070688_1000168286 223
191 3300005365 Ga0070688_100153784 Ga0070688_1001537842 223
192 3300005366 Ga0070659_100528267 Ga0070659_1005282672 223
193 3300005438 Ga0070701_10012010 Ga0070701_100120104 223
194 3300005440 Ga0070705_100016632 Ga0070705_1000166324 223
195 3300005440 Ga0070705_100186415 Ga0070705_1001864152 223
196 3300005441 Ga0070700_100003434 Ga0070700_1000034345 223
197 3300005441 Ga0070700_100329599 Ga0070700_1003295992 223
198 3300005444 Ga0070694_100009716 Ga0070694_1000097163 223
199 3300005444 Ga0070694_100122393 Ga0070694_1001223933 223
200 3300005455 Ga0070663_100046166 Ga0070663_1000461661 223
201 3300005456 Ga0070678_100040487 Ga0070678_1000404871 223
202 3300005456 Ga0070678_100090152 Ga0070678_1000901522 223
203 3300005456 Ga0070678_100187129 Ga0070678_1001871292 223
204 3300005456 Ga0070678_100322708 Ga0070678_1003227082 223
205 3300005457 Ga0070662_100125794 Ga0070662_1001257942 223
206 3300005459 Ga0068867_100005919 Ga0068867_1000059192 223
207 3300005466 Ga0070685_10004804 Ga0070685_100048043 223
208 3300005466 Ga0070685_10011505 Ga0070685_100115053 223
209 3300005466 Ga0070685_10434174 Ga0070685_104341742 223
210 3300005467 Ga0070706_100036336 Ga0070706_1000363362 223
211 3300005467 Ga0070706_100134490 Ga0070706_1001344903 223
212 3300005468 Ga0070707_100008429 Ga0070707_1000084295 223
213 3300005471 Ga0070698_100002974 Ga0070698_10000297415 223
214 3300005471 Ga0070698_100030672 Ga0070698_1000306724 223
215 3300005471 Ga0070698_100172151 Ga0070698_1001721512 223
216 3300005518 Ga0070699_100027788 Ga0070699_1000277883 223
217 3300005518 Ga0070699_100043189 Ga0070699_1000431892 223
218 3300005535 Ga0070684_100025046 Ga0070684_1000250465 223
219 3300005535 Ga0070684_100080971 Ga0070684_1000809714 223
220 3300005536 Ga0070697_100013378 Ga0070697_1000133782 223
221 3300005539 Ga0068853_100328621 Ga0068853_1003286212 223
222 3300005543 Ga0070672_100015292 Ga0070672_1000152924 223
223 3300005544 Ga0070686_100005262 Ga0070686_1000052625 223
224 3300005544 Ga0070686_100018108 Ga0070686_1000181083 223
225 3300005544 Ga0070686_100026899 Ga0070686_1000268992 223
226 3300005545 Ga0070695_100097202 Ga0070695_1000972023 223
227 3300005546 Ga0070696_100272639 Ga0070696_1002726392 223
228 3300005578 Ga0068854_100023598 Ga0068854_1000235983 223
229 3300005578 Ga0068854_100132448 Ga0068854_1001324482 223
230 3300005614 Ga0068856_100267817 Ga0068856_1002678172 223
231 3300005615 Ga0070702_100104918 Ga0070702_1001049181 223
232 3300005616 Ga0068852_100261537 Ga0068852_1002615372 223
233 3300005617 Ga0068859_100010892 Ga0068859_1000108922 223
234 3300005617 Ga0068859_100049689 Ga0068859_1000496894 223
235 3300005617 Ga0068859_100285061 Ga0068859_1002850611 223
236 3300005617 Ga0068859_100354065 Ga0068859_1003540652 223
237 3300005719 Ga0068861_100008361 Ga0068861_1000083614 223
238 3300005840 Ga0068870_10394379 Ga0068870_103943791 223
239 3300005842 Ga0068858_100022759 Ga0068858_1000227592 223
240 3300005842 Ga0068858_100267610 Ga0068858_1002676102 223
241 3300005843 Ga0068860_100238616 Ga0068860_1002386162 223
242 3300005844 Ga0068862_100144619 Ga0068862_1001446192 223
243 3300006038 Ga0075365_10017162 Ga0075365_100171623 223
244 3300006038 Ga0075365_10039453 Ga0075365_100394532 223
245 3300006042 Ga0075368_10033002 Ga0075368_100330021 223
246 3300006048 Ga0075363_100066942 Ga0075363_1000669423 223
247 3300006051 Ga0075364_10004869 Ga0075364_100048693 223
248 3300006051 Ga0075364_10005908 Ga0075364_100059082 223
249 3300006051 Ga0075364_10029427 Ga0075364_100294273 223
250 3300006177 Ga0075362_10000540 Ga0075362_100005402 223
251 3300006177 Ga0075362_10009703 Ga0075362_100097033 223
252 3300006178 Ga0075367_10004419 Ga0075367_100044193 223
253 3300006178 Ga0075367_10053238 Ga0075367_100532384 223
254 3300006178 Ga0075367_10118443 Ga0075367_101184432 223
255 3300006186 Ga0075369_10097159 Ga0075369_100971592 223
256 3300006195 Ga0075366_10002022 Ga0075366_100020222 223
257 3300006195 Ga0075366_10002099 Ga0075366_100020994 223
258 3300006237 Ga0097621_100009912 Ga0097621_1000099126 223
259 3300006353 Ga0075370_10012782 Ga0075370_100127825 223
260 3300006353 Ga0075370_10087532 Ga0075370_100875322 223
261 3300006358 Ga0068871_100006098 Ga0068871_1000060981 223
262 3300006358 Ga0068871_100258614 Ga0068871_1002586141 223
263 3300006844 Ga0075428_100017953 Ga0075428_1000179538 223
264 3300006844 Ga0075428_100049932 Ga0075428_1000499322 223
265 3300006844 Ga0075428_100453172 Ga0075428_1004531722 223
266 3300006844 Ga0075428_100514911 Ga0075428_1005149112 223
267 3300006847 Ga0075431_100013319 Ga0075431_1000133195 223
268 3300006852 Ga0075433_10037480 Ga0075433_100374803 223
269 3300006852 Ga0075433_10042542 Ga0075433_100425425 223
270 3300006852 Ga0075433_10047644 Ga0075433_100476443 223
271 3300006871 Ga0075434_100024686 Ga0075434_1000246863 223
272 3300006871 Ga0075434_100499636 Ga0075434_1004996362 223
273 3300006880 Ga0075429_100012573 Ga0075429_1000125733 223
274 3300006880 Ga0075429_100059760 Ga0075429_1000597602 223
275 3300006880 Ga0075429_100092135 Ga0075429_1000921353 223
276 3300006880 Ga0075429_100206065 Ga0075429_1002060652 223
277 3300006881 Ga0068865_100008771 Ga0068865_1000087713 223
278 3300006931 Ga0097620_100010892 Ga0097620_10001089210 223
279 3300006931 Ga0097620_100049686 Ga0097620_1000496864 223
280 3300006931 Ga0097620_100285069 Ga0097620_1002850691 223
281 3300006931 Ga0097620_100354019 Ga0097620_1003540192 223
282 3300007076 Ga0075435_100027677 Ga0075435_1000276772 223
283 3300007076 Ga0075435_100418997 Ga0075435_1004189972 223
284 3300009094 Ga0111539_10003060 Ga0111539_100030606 223
285 3300009094 Ga0111539_10014458 Ga0111539_100144585 223
286 3300009098 Ga0105245_10108215 Ga0105245_101082152 223
287 3300009147 Ga0114129_10016383 Ga0114129_100163834 223
288 3300009147 Ga0114129_10314166 Ga0114129_103141662 223
289 3300009147 Ga0114129_10366424 Ga0114129_103664242 223
290 3300009147 Ga0114129_10983289 Ga0114129_109832892 223
291 3300009148 Ga0105243_10009910 Ga0105243_100099104 223
292 3300009148 Ga0105243_10019546 Ga0105243_100195462 223
293 3300009176 Ga0105242_10914737 Ga0105242_109147371 223
294 3300009177 Ga0105248_10140214 Ga0105248_101402142 223
295 3300009553 Ga0105249_10963326 Ga0105249_109633262 223
296 3300010375 Ga0105239_10398658 Ga0105239_103986581 223
297 3300013296 Ga0157374_10046819 Ga0157374_100468193 223
298 3300013297 Ga0157378_10211449 Ga0157378_102114492 223
299 3300013297 Ga0157378_10336459 Ga0157378_103364591 223
300 3300013297 Ga0157378_10491078 Ga0157378_104910782 223
301 3300013306 Ga0163162_10054885 Ga0163162_100548852 223
302 3300013308 Ga0157375_10007654 Ga0157375_100076546 223
303 3300013308 Ga0157375_10258692 Ga0157375_102586922 223
304 3300014325 Ga0163163_10078747 Ga0163163_100787473 223
305 3300014968 Ga0157379_10373311 Ga0157379_103733111 223
306 3300014969 Ga0157376_10024822 Ga0157376_100248223 223
307 3300021384 Ga0213876_10073933 Ga0213876_100739333 223
308 3300025321 Ga0207656_10120445 Ga0207656_101204452 223
309 3300025885 Ga0207653_10092472 Ga0207653_100924722 223
310 3300025907 Ga0207645_10010682 Ga0207645_100106822 223
311 3300025907 Ga0207645_10070391 Ga0207645_100703913 223
312 3300025908 Ga0207643_10320072 Ga0207643_103200721 223
313 3300025910 Ga0207684_10107912 Ga0207684_101079122 223
314 3300025917 Ga0207660_10014590 Ga0207660_100145902 223
315 3300025918 Ga0207662_10002590 Ga0207662_100025905 223
316 3300025918 Ga0207662_10023066 Ga0207662_100230663 223
317 3300025922 Ga0207646_10002938 Ga0207646_1000293814 223
318 3300025923 Ga0207681_10006614 Ga0207681_100066146 223
319 3300025925 Ga0207650_10027775 Ga0207650_100277757 223
320 3300025925 Ga0207650_10071158 Ga0207650_100711583 223
321 3300025926 Ga0207659_10039614 Ga0207659_100396143 223
322 3300025926 Ga0207659_10696221 Ga0207659_106962212 223
323 3300025927 Ga0207687_10144129 Ga0207687_101441292 223
324 3300025932 Ga0207690_10106889 Ga0207690_101068892 223
325 3300025932 Ga0207690_10403236 Ga0207690_104032362 223
326 3300025933 Ga0207706_10071622 Ga0207706_100716223 223
327 3300025933 Ga0207706_10084186 Ga0207706_100841863 223
328 3300025933 Ga0207706_10341336 Ga0207706_103413362 223
329 3300025934 Ga0207686_10013858 Ga0207686_100138583 223
330 3300025934 Ga0207686_10258424 Ga0207686_102584242 223
331 3300025936 Ga0207670_10052345 Ga0207670_100523453 223
332 3300025936 Ga0207670_10106385 Ga0207670_101063851 223
333 3300025936 Ga0207670_10109432 Ga0207670_101094323 223
334 3300025936 Ga0207670_10333514 Ga0207670_103335142 223
335 3300025936 Ga0207670_10688437 Ga0207670_106884371 223
336 3300025937 Ga0207669_10001218 Ga0207669_100012189 223
337 3300025937 Ga0207669_10068953 Ga0207669_100689532 223
338 3300025938 Ga0207704_10007895 Ga0207704_100078956 223
339 3300025938 Ga0207704_10048326 Ga0207704_100483264 223
340 3300025938 Ga0207704_10275682 Ga0207704_102756822 223
341 3300025938 Ga0207704_10386967 Ga0207704_103869672 223
342 3300025940 Ga0207691_10006506 Ga0207691_100065067 223
343 3300025940 Ga0207691_10032458 Ga0207691_100324585 223
344 3300025940 Ga0207691_10124962 Ga0207691_101249624 223
345 3300025942 Ga0207689_10017182 Ga0207689_100171824 223
346 3300025944 Ga0207661_10001745 Ga0207661_100017457 223
347 3300025960 Ga0207651_10066846 Ga0207651_100668464 223
348 3300025960 Ga0207651_10453940 Ga0207651_104539402 223
349 3300025961 Ga0207712_10237270 Ga0207712_102372702 223
350 3300025961 Ga0207712_10278223 Ga0207712_102782232 223
351 3300025972 Ga0207668_10011609 Ga0207668_100116095 223
352 3300025981 Ga0207640_10103133 Ga0207640_101031332 223
353 3300025986 Ga0207658_10247212 Ga0207658_102472122 223
354 3300026023 Ga0207677_10006548 Ga0207677_100065486 223
355 3300026023 Ga0207677_10069787 Ga0207677_100697872 223
356 3300026067 Ga0207678_10006988 Ga0207678_100069887 223
357 3300026075 Ga0207708_10007213 Ga0207708_100072133 223
358 3300026075 Ga0207708_10010749 Ga0207708_100107492 223
359 3300026088 Ga0207641_10011424 Ga0207641_100114245 223
360 3300026088 Ga0207641_10559718 Ga0207641_105597182 223
361 3300026089 Ga0207648_10004342 Ga0207648_100043424 223
362 3300026116 Ga0207674_10289559 Ga0207674_102895591 223
363 3300026118 Ga0207675_100011234 Ga0207675_1000112345 223
364 3300026118 Ga0207675_100046533 Ga0207675_1000465332 223
365 3300026121 Ga0207683_10044445 Ga0207683_100444452 223
366 3300026121 Ga0207683_10059496 Ga0207683_100594962 223
367 3300026121 Ga0207683_10510540 Ga0207683_105105401 223
368 3300026142 Ga0207698_10283352 Ga0207698_102833522 223
369 3300026142 Ga0207698_10294480 Ga0207698_102944802 223
370 3300027907 Ga0207428_10000043 Ga0207428_10000043168 223
371 3300027907 Ga0207428_10004590 Ga0207428_100045909 223
372 3300028379 Ga0268266_10366785 Ga0268266_103667852 223
373 3300028381 Ga0268264_10190157 Ga0268264_101901572 223
374 3300028800 Ga0265338_10006197 Ga0265338_100061977 223
375 3300031240 Ga0265320_10057846 Ga0265320_100578462 223
376 3300031249 Ga0265339_10007411 Ga0265339_100074115 223
377 3300031456 Ga0307513_10160352 Ga0307513_101603521 223
378 3300031616 Ga0307508_10143771 Ga0307508_101437713 223
379 3300031711 Ga0265314_10012258 Ga0265314_100122584 223
380 3300031711 Ga0265314_10018821 Ga0265314_100188212 223
381 3300031730 Ga0307516_10011544 Ga0307516_100115448 223
382 3300031824 Ga0307413_10011872 Ga0307413_100118724 223
383 3300031901 Ga0307406_10046876 Ga0307406_100468765 223
384 3300031903 Ga0307407_10035354 Ga0307407_100353543 223
385 3300032005 Ga0307411_10004937 Ga0307411_100049375 223
386 3300032126 Ga0307415_100019544 Ga0307415_1000195443 223
387 3300034818 Ga0373950_0000011 Ga0373950_0000011_110690_111364 223
388 3300034818 Ga0373950_0000021 Ga0373950_0000021_198120_198794 223
389 3300035086 Ga0373934_0148374 Ga0373934_0148374_137_814 223
390 3300035119 Ga0373956_0035009 Ga0373956_0035009_1427_2101 223
391 3300035119 Ga0373956_0158509 Ga0373956_0158509_28_702 223
392 3300035724 Ga0373933_0001072 Ga0373933_0001072_8110_8784 223
393 3300035724 Ga0373933_0072927 Ga0373933_0072927_582_1256 223
394 3300036401 Ga0373937_0007204 Ga0373937_0007204_586_1260 223
395 3300039437 Ga0436365_1544740 Ga0436365_1544740_289_987 223
396 3300039437 Ga0436365_1910706 Ga0436365_1910706_162_851 223
397 3300041443 Ga0451789_1031512 Ga0451789_1031512_97_768 223
398 3300041451 Ga0451791_1366606 Ga0451791_1366606_116_790 223
399 3300041452 Ga0451793_1487413 Ga0451793_1487413_476_1147 223
400 3300041453 Ga0451797_1585387 Ga0451797_1585387_470_1141 223
401 3300041460 Ga0451802_1886820 Ga0451802_1886820_339_1010 223
402 3300041486 Ga0451807_0265998 Ga0451807_0265998_93_764 223
403 3300041486 Ga0451807_0307229 Ga0451807_0307229_1115_1786 223
404 3300042876 Ga0451577_0189775 Ga0451577_0189775_571_1290 223
405 3300044683 Ga0466965_0027204 Ga0466965_0027204_1628_2299 223
406 3300045051 Ga0451576_0031549 Ga0451576_0031549_2302_3003 223
407 3300045051 Ga0451576_0047260 Ga0451576_0047260_3679_4398 223
408 3300045051 Ga0451576_0690663 Ga0451576_0690663_163_852 223
409 3300046516 Ga0495628_0058395 Ga0495628_0058395_1350_2069 223
410 3300046516 Ga0495628_0320286 Ga0495628_0320286_441_1127 223
411 3300046517 Ga0495630_0292400 Ga0495630_0292400_418_1116 223
412 3300046533 Ga0495640_0205189 Ga0495640_0205189_44_730 223
413 3300046642 Ga0495634_0093884 Ga0495634_0093884_800_1519 223
414 3300046809 Ga0495600_0045175 Ga0495600_0045175_1455_2141 223
415 3300047319 Ga0495674_0242913 Ga0495674_0242913_44_730 223
416 3300047320 Ga0495672_0000854 Ga0495672_0000854_2848_3525 223
417 3300047471 Ga0495684_0049454 Ga0495684_0049454_1908_2672 223
418 3300048903 Ga0496100_0024395 Ga0496100_0024395_445_1134 223
419 3300048904 Ga0496101_0290372 Ga0496101_0290372_162_851 223
420 3300048909 Ga0496106_0210658 Ga0496106_0210658_270_956 223
421 3300048910 Ga0496107_0020555 Ga0496107_0020555_860_1546 223
422 3300048912 Ga0496109_0037707 Ga0496109_0037707_3212_3898 223
423 3300048913 Ga0496110_0159677 Ga0496110_0159677_43_729 223
424 3300048914 Ga0496111_0146523 Ga0496111_0146523_645_1331 223
425 3300048917 Ga0496114_0000144 Ga0496114_0000144_253_942 223
426 3300048917 Ga0496114_0033660 Ga0496114_0033660_975_1655 223
427 3300048918 Ga0496115_0001324 Ga0496115_0001324_12181_12870 223
428 3300049572 Ga0501036_0037780 Ga0501036_0037780_2241_2915 223
429 3300049583 Ga0501067_0000002 Ga0501067_0000002_4492_5166 223
430 3300049583 Ga0501067_0006257 Ga0501067_0006257_5448_6149 223
431 3300049583 Ga0501067_0030681 Ga0501067_0030681_1086_1763 223
432 3300049583 Ga0501067_0123110 Ga0501067_0123110_278_949 223
433 3300049584 Ga0501068_0056472 Ga0501068_0056472_185_877 223
434 3300049585 Ga0501069_0113688 Ga0501069_0113688_59_760 223
435 3300049588 Ga0501072_0000020 Ga0501072_0000020_152817_153491 223
436 3300049589 Ga0501073_0000914 Ga0501073_0000914_7195_7890 223
437 3300049589 Ga0501073_0010418 Ga0501073_0010418_546_1220 223
438 3300049589 Ga0501073_0017283 Ga0501073_0017283_4373_5074 223
439 3300049589 Ga0501073_0068864 Ga0501073_0068864_616_1305 223
440 3300049592 Ga0501076_0105300 Ga0501076_0105300_1287_1964 223
441 3300049741 Ga0501079_0249991 Ga0501079_0249991_491_1183 223
442 3300049824 Ga0501045_0221999 Ga0501045_0221999_174_866 223
443 3300050489 nmdc:mga03683_33225_c1 nmdc:mga03683_33225_c1_1068_1751 223
444 3300050490 nmdc:mga03n38_432122_c1 nmdc:mga03n38_432122_c1_35_712 223
445 3300050491 nmdc:mga00v17_19076_c1 nmdc:mga00v17_19076_c1_1778_2455 223
446 3300050492 nmdc:mga0yw44_3851_c1 nmdc:mga0yw44_3851_c1_2094_2777 223
447 3300050493 nmdc:mga0k408_465_c1 nmdc:mga0k408_465_c1_13751_14434 223
448 3300050493 nmdc:mga0k408_47657_c1 nmdc:mga0k408_47657_c1_31_708 223
449 3300050493 nmdc:mga0k408_5771_c1 nmdc:mga0k408_5771_c1_2589_3266 223
450 3300050493 nmdc:mga0k408_64293_c1 nmdc:mga0k408_64293_c1_1092_1784 223
451 3300050494 nmdc:mga06z11_107037_c1 nmdc:mga06z11_107037_c1_150_827 223
452 3300050494 nmdc:mga06z11_13172_c1 nmdc:mga06z11_13172_c1_2469_3152 223
453 3300050494 nmdc:mga06z11_9348_c1 nmdc:mga06z11_9348_c1_3126_3803 223
454 3300050495 nmdc:mga04h51_39216_c1 nmdc:mga04h51_39216_c1_90_767 223
455 3300050495 nmdc:mga04h51_77204_c1 nmdc:mga04h51_77204_c1_121_798 223
456 3300050496 nmdc:mga07m45_11151_c1 nmdc:mga07m45_11151_c1_1620_2297 223
457 3300050496 nmdc:mga07m45_57449_c1 nmdc:mga07m45_57449_c1_577_1260 223
458 3300050507 nmdc:mga05p37_217861_c1 nmdc:mga05p37_217861_c1_1560_2249 223
459 3300050507 nmdc:mga05p37_28344_c1 nmdc:mga05p37_28344_c1_1441_2124 223
460 3300050507 nmdc:mga05p37_380757_c1 nmdc:mga05p37_380757_c1_195_878 223
461 3300050507 nmdc:mga05p37_677361_c1 nmdc:mga05p37_677361_c1_238_915 223
462 3300050507 nmdc:mga05p37_955_c1 nmdc:mga05p37_955_c1_26945_27631 223
463 3300050508 nmdc:mga09592_205514_c1 nmdc:mga09592_205514_c1_646_1332 223
464 3300050508 nmdc:mga09592_34440_c1 nmdc:mga09592_34440_c1_1172_1858 223
465 3300050508 nmdc:mga09592_768_c1 nmdc:mga09592_768_c1_942_1625 223
466 3300050510 nmdc:mga06r32_37087_c1 nmdc:mga06r32_37087_c1_2199_2885 223
467 3300050511 nmdc:mga08y16_4107_c1 nmdc:mga08y16_4107_c1_7674_8363 223
468 3300050511 nmdc:mga08y16_734_c1 nmdc:mga08y16_734_c1_22734_23417 223
469 3300050512 nmdc:mga0n895_41264_c1 nmdc:mga0n895_41264_c1_189_866 223
470 3300050512 nmdc:mga0n895_469361_c1 nmdc:mga0n895_469361_c1_444_1118 223
471 3300050512 nmdc:mga0n895_542023_c1 nmdc:mga0n895_542023_c1_154_840 223
472 3300050512 nmdc:mga0n895_91860_c1 nmdc:mga0n895_91860_c1_811_1488 223
473 3300050513 nmdc:mga0rr50_133356_c1 nmdc:mga0rr50_133356_c1_89_778 223
474 3300050515 nmdc:mga0a205_226256_c1 nmdc:mga0a205_226256_c1_928_1605 223
475 3300050515 nmdc:mga0a205_237581_c1 nmdc:mga0a205_237581_c1_435_1109 223
476 3300050515 nmdc:mga0a205_24535_c1 nmdc:mga0a205_24535_c1_548_1225 223
477 3300050515 nmdc:mga0a205_26638_c2 nmdc:mga0a205_26638_c2_2498_3184 223
478 3300053084 Ga0495595_0152961 Ga0495595_0152961_266_952 223
479 3300053085 Ga0495619_0004515 Ga0495619_0004515_8074_8760 223
480 3300053096 Ga0500641_0002076 Ga0500641_0002076_790_1473 223
481 3300053153 Ga0500616_0063854 Ga0500616_0063854_1053_1730 223
482 3300059421 Ga0590071_001992 Ga0590071_001992_4234_4917 223
483 3300059423 Ga0590074_001506 Ga0590074_001506_111_794 223
484 3300059424 Ga0590075_000057 Ga0590075_000057_13501_14184 223
485 3300059426 Ga0590077_000444 Ga0590077_000444_10081_10764 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

31

226

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.9336 3 202
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.9318 3 202
1ebb-assembly1.cif.gz_A bacillus stearothermophilus yhfr 0.9179 3 202
6s2q-assembly2.cif.gz_D mycobacterial hydrolase 1 0.9098 1 199
4pz9-assembly1.cif.gz_A the native structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c 0.9078 1 198
ID Description Score Start End Superfamily
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9474 4 202 3.40.50.1240
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9337 4 202 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9336 3 202 3.40.50.1240
1ebbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9179 3 202 3.40.50.1240
af_F4KI56_14_225_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9163 2 206 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A497AI05-F1-model_v4 Histidine phosphatase family protein 0.9682 1 207 GO:0005737
GO:0016791
AF-A0A350MUW0-F1-model_v4 Alpha-ribazole phosphatase 0.959 2 206 GO:0005737
GO:0016791
AF-A0A354FBG7-F1-model_v4 Alpha-ribazole phosphatase 0.959 9 137 GO:0004331
GO:0005829
GO:0043456
GO:0045820
AF-A0A4Q3KHS8-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 0.9575 1 165 GO:0006096
GO:0016868
AF-A0A3M1G1M7-F1-model_v4 Alpha-ribazole phosphatase (EC 3.1.3.73) 0.9565 2 186 GO:0009236
GO:0043755

Feature Viewer

pLDDT pTM Quality
88.87 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map