F453100

General Info

Members Datasets Scaffolds Average Seq Length
485 341 970 137

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_11793241|Ga0163163_117932411
Length 159
Sequence LCAALCGVRGRAAFAADQKIEVITMKANQFSRSLRLALTGAVLTCGATAAFADIRNYEFKLVEPTVKAGPDKTIAVRLVDKTKGKPVPDAVIFATRLDMAPDGMPEMATRLDPLPGTEPGTYRFKATFGMAGRWQLSLGAKVQGETGTVENKLVIQADK

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
181 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
184 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
188 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
218 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
249 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
250 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
251 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
280 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
281 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
285 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
286 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
293 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
294 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
295 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
299 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
300 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
301 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
302 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
303 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
304 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
305 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
306 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
307 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
308 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
309 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
310 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
311 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
312 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
313 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
314 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
315 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
316 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
317 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
318 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
319 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
320 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
321 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
322 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
323 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
324 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
325 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
326 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
327 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
328 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
329 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
330 2643221651 Afipia sp. Root123D2 Isolate Unclassified
331 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
332 2791355199
333 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
334 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
335 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
336 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
337 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
338 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
339 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
340 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
341 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 0
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.05
Nodule 1.86
Rhizoplane 5.57
Rhizosphere 68.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_11793241 3300014325 Bacteria 674
2 rootH2_10154545 3300003320 Bacteria 1496
3 rootH1_10375641 3300003323 Bacteria 1268
4 JGI25404J52841_10007637 3300003659 Bacteria 2291
5 Ga0070658_10198273 3300005327 Bacteria 1693
6 Ga0070670_100361819 3300005331 Bacteria 1276
7 Ga0068869_100051433 3300005334 Bacteria 2989
8 Ga0068869_100173846 3300005334 Bacteria 1684
9 Ga0070680_100094247 3300005336 Bacteria 2481
10 Ga0068868_100152875 3300005338 Bacteria 1901
11 Ga0068868_100538970 3300005338 Bacteria 1027
12 Ga0068868_101171139 3300005338 Bacteria 710
13 Ga0070660_100083427 3300005339 Bacteria 2510
14 Ga0070689_100153380 3300005340 Bacteria 1859
15 Ga0070689_101348183 3300005340 Bacteria 643
16 Ga0070668_100043904 3300005347 Bacteria 3428
17 Ga0070668_100368026 3300005347 Bacteria 1220
18 Ga0070669_101213635 3300005353 Bacteria 652
19 Ga0070675_100679848 3300005354 Bacteria 937
20 Ga0070671_100176358 3300005355 Bacteria 1809
21 Ga0070671_100611448 3300005355 Bacteria 942
22 Ga0070671_101471059 3300005355 Bacteria 602
23 Ga0070674_100457505 3300005356 Bacteria 1055
24 Ga0070688_100250459 3300005365 Bacteria 1261
25 Ga0070659_100191246 3300005366 Bacteria 1682
26 Ga0070659_100209691 3300005366 Bacteria 1606
27 Ga0070667_100794335 3300005367 Bacteria 878
28 Ga0070709_10232801 3300005434 Bacteria 1319
29 Ga0070709_10246466 3300005434 Bacteria 1285
30 Ga0070714_101111924 3300005435 Bacteria 770
31 Ga0070710_10510031 3300005437 Bacteria 825
32 Ga0070701_10270505 3300005438 Bacteria 1034
33 Ga0070711_100105313 3300005439 Bacteria 2060
34 Ga0070711_100184481 3300005439 Bacteria 1599
35 Ga0070694_100747089 3300005444 Bacteria 799
36 Ga0070663_100305136 3300005455 Bacteria 1275
37 Ga0070663_100546876 3300005455 Bacteria 967
38 Ga0070678_100032558 3300005456 Bacteria 3609
39 Ga0070678_101152883 3300005456 Bacteria 717
40 Ga0070662_100697507 3300005457 Bacteria 859
41 Ga0070662_101215529 3300005457 Bacteria 648
42 Ga0070681_10271144 3300005458 Bacteria 1608
43 Ga0068867_100698732 3300005459 Bacteria 895
44 Ga0070685_10345948 3300005466 Bacteria 1015
45 Ga0070685_10792137 3300005466 Bacteria 698
46 Ga0070684_100180233 3300005535 Bacteria 1921
47 Ga0068853_100043633 3300005539 Bacteria 3836
48 Ga0068853_100119371 3300005539 Bacteria 2350
49 Ga0068853_100871086 3300005539 Bacteria 864
50 Ga0070693_100146644 3300005547 Bacteria 1491
51 Ga0070665_100012712 3300005548 Bacteria 8478
52 Ga0070665_100042999 3300005548 Bacteria 4542
53 Ga0070665_100635555 3300005548 Bacteria 1080
54 Ga0068855_100080916 3300005563 Bacteria 3766
55 Ga0068855_100084873 3300005563 Bacteria 3665
56 Ga0068857_100093983 3300005577 Bacteria 2685
57 Ga0068854_100287052 3300005578 Bacteria 1327
58 Ga0068856_100312048 3300005614 Bacteria 1590
59 Ga0068856_100459668 3300005614 Bacteria 1294
60 Ga0070702_100086603 3300005615 Bacteria 1890
61 Ga0068852_100262585 3300005616 Bacteria 1658
62 Ga0068859_100091057 3300005617 Bacteria 3100
63 Ga0068864_100031215 3300005618 Bacteria 4520
64 Ga0068864_101734017 3300005618 Bacteria 629
65 Ga0068861_100458797 3300005719 Bacteria 1143
66 Ga0068863_100090099 3300005841 Bacteria 2908
67 Ga0068863_100782266 3300005841 Bacteria 951
68 Ga0068858_100090778 3300005842 Bacteria 2843
69 Ga0068858_100577381 3300005842 Bacteria 1089
70 Ga0068860_100000692 3300005843 Bacteria 38767
71 Ga0068860_100143205 3300005843 Bacteria 2298
72 Ga0068860_101483690 3300005843 Bacteria 700
73 Ga0081455_10005510 3300005937 Bacteria 13875
74 Ga0081455_10021425 3300005937 Bacteria 6063
75 Ga0081455_10341210 3300005937 Bacteria 1060
76 Ga0081455_10452120 3300005937 Bacteria 877
77 Ga0081455_10472109 3300005937 Bacteria 851
78 Ga0081540_1005727 3300005983 Bacteria 9215
79 Ga0081540_1006775 3300005983 Bacteria 8284
80 Ga0081540_1014506 3300005983 Bacteria 5041
81 Ga0081540_1240399 3300005983 Bacteria 635
82 Ga0075365_10027336 3300006038 Bacteria 3629
83 Ga0075368_10028999 3300006042 Bacteria 2139
84 Ga0075363_100054091 3300006048 Bacteria 2147
85 Ga0075364_10049194 3300006051 Bacteria 2749
86 Ga0075364_10061757 3300006051 Bacteria 2458
87 Ga0075362_10005627 3300006177 Bacteria 4602
88 Ga0075362_10160883 3300006177 Bacteria 1081
89 Ga0075367_10085893 3300006178 Bacteria 1909
90 Ga0075367_10101807 3300006178 Bacteria 1757
91 Ga0075369_10130034 3300006186 Bacteria 1143
92 Ga0075366_10043846 3300006195 Bacteria 2650
93 Ga0075366_10496127 3300006195 Bacteria 755
94 Ga0097621_100024534 3300006237 Bacteria 4711
95 Ga0075370_10058878 3300006353 Bacteria 2185
96 Ga0075370_10100011 3300006353 Bacteria 1678
97 Ga0075370_10682923 3300006353 Bacteria 624
98 Ga0068871_100261867 3300006358 Bacteria 1509
99 Ga0068871_101151871 3300006358 Bacteria 726
100 Ga0075428_100005652 3300006844 Bacteria 13897
101 Ga0075433_10975024 3300006852 Bacteria 739
102 Ga0075434_100129028 3300006871 Bacteria 2546
103 Ga0075434_100660407 3300006871 Bacteria 1064
104 Ga0075429_100269590 3300006880 Bacteria 1491
105 Ga0068865_100447191 3300006881 Bacteria 1068
106 Ga0097620_100091054 3300006931 Bacteria 3100
107 Ga0099795_10144534 3300007788 Bacteria 970
108 Ga0105240_10103407 3300009093 Bacteria 3461
109 Ga0105240_10849801 3300009093 Bacteria 985
110 Ga0105245_10078901 3300009098 Bacteria 3005
111 Ga0105247_10020831 3300009101 Bacteria 3944
112 Ga0105247_10046147 3300009101 Bacteria 2674
113 Ga0105247_10422317 3300009101 Bacteria 955
114 Ga0114129_10349783 3300009147 Bacteria 1958
115 Ga0114129_10422651 3300009147 Bacteria 1752
116 Ga0105241_10054020 3300009174 Bacteria 3074
117 Ga0105248_10043835 3300009177 Bacteria 5017
118 Ga0105237_10055083 3300009545 Bacteria 3983
119 Ga0105237_10202185 3300009545 Bacteria 1987
120 Ga0105238_10139969 3300009551 Bacteria 2397
121 Ga0105249_10575933 3300009553 Bacteria 1178
122 Ga0105239_10198845 3300010375 Bacteria 2245
123 Ga0105239_10866144 3300010375 Bacteria 1036
124 Ga0105246_10254006 3300011119 Bacteria 1397
125 Ga0105246_11797541 3300011119 Bacteria 585
126 Ga0157325_1003832 3300012485 Bacteria 853
127 Ga0157371_10190143 3300013102 Bacteria 1470
128 Ga0157374_10609940 3300013296 Bacteria 1102
129 Ga0157378_10337642 3300013297 Bacteria 1468
130 Ga0157378_10791872 3300013297 Bacteria 973
131 Ga0163162_10088497 3300013306 Bacteria 3176
132 Ga0157372_10436292 3300013307 Bacteria 1527
133 Ga0157372_10603852 3300013307 Bacteria 1279
134 Ga0157375_10230728 3300013308 Bacteria 2010
135 Ga0163163_10009592 3300014325 Bacteria 8650
136 Ga0163163_10076534 3300014325 Bacteria 3341
137 Ga0157377_10026466 3300014745 Bacteria 3104
138 Ga0157379_10072130 3300014968 Bacteria 3089
139 Ga0157379_10200510 3300014968 Bacteria 1805
140 Ga0157376_10226629 3300014969 Bacteria 1734
141 Ga0209758_1022102 3300025297 Bacteria 2935
142 Ga0207656_10005262 3300025321 Bacteria 4561
143 Ga0207692_10397440 3300025898 Bacteria 859
144 Ga0207642_10212847 3300025899 Bacteria 1075
145 Ga0207710_10009051 3300025900 Bacteria 4192
146 Ga0207710_10200039 3300025900 Bacteria 986
147 Ga0207688_10031516 3300025901 Bacteria 2927
148 Ga0207699_10233317 3300025906 Bacteria 1261
149 Ga0207699_11400921 3300025906 Bacteria 517
150 Ga0207645_10038487 3300025907 Bacteria 3067
151 Ga0207643_10017049 3300025908 Bacteria 3966
152 Ga0207684_10903090 3300025910 Bacteria 742
153 Ga0207654_10160436 3300025911 Bacteria 1452
154 Ga0207671_10073249 3300025914 Bacteria 2558
155 Ga0207671_10439597 3300025914 Bacteria 1038
156 Ga0207663_10176885 3300025916 Bacteria 1520
157 Ga0207660_10004459 3300025917 Bacteria 9125
158 Ga0207657_10007619 3300025919 Bacteria 11079
159 Ga0207657_10149777 3300025919 Bacteria 1901
160 Ga0207649_10111896 3300025920 Bacteria 1826
161 Ga0207652_10003482 3300025921 Bacteria 12972
162 Ga0207681_10974506 3300025923 Bacteria 711
163 Ga0207694_10022471 3300025924 Bacteria 4785
164 Ga0207650_10285798 3300025925 Bacteria 1344
165 Ga0207687_10041629 3300025927 Bacteria 3156
166 Ga0207664_10235259 3300025929 Bacteria 1593
167 Ga0207644_10141787 3300025931 Bacteria 1851
168 Ga0207644_10343493 3300025931 Bacteria 1211
169 Ga0207690_10137496 3300025932 Bacteria 1796
170 Ga0207706_10083882 3300025933 Bacteria 2801
171 Ga0207670_10487167 3300025936 Bacteria 999
172 Ga0207704_10515940 3300025938 Bacteria 966
173 Ga0207711_10031970 3300025941 Bacteria 4447
174 Ga0207689_10029272 3300025942 Bacteria 4601
175 Ga0207689_10068486 3300025942 Bacteria 2917
176 Ga0207679_10987896 3300025945 Bacteria 771
177 Ga0207667_10048945 3300025949 Bacteria 4467
178 Ga0207667_10063119 3300025949 Bacteria 3871
179 Ga0207667_10180807 3300025949 Bacteria 2166
180 Ga0207712_11031338 3300025961 Bacteria 731
181 Ga0207668_10119855 3300025972 Bacteria 1990
182 Ga0207668_10622362 3300025972 Bacteria 942
183 Ga0207668_10786468 3300025972 Bacteria 841
184 Ga0207640_10009340 3300025981 Bacteria 5487
185 Ga0207640_10172765 3300025981 Bacteria 1612
186 Ga0207658_10163709 3300025986 Bacteria 1825
187 Ga0207677_10019033 3300026023 Bacteria 4136
188 Ga0207703_10022068 3300026035 Bacteria 4988
189 Ga0207703_10327450 3300026035 Bacteria 1404
190 Ga0207639_10046189 3300026041 Bacteria 3285
191 Ga0207678_10248888 3300026067 Bacteria 1522
192 Ga0207678_10309397 3300026067 Bacteria 1358
193 Ga0207678_10525199 3300026067 Bacteria 1033
194 Ga0207702_10207193 3300026078 Bacteria 1821
195 Ga0207641_10474418 3300026088 Bacteria 1212
196 Ga0207641_10542566 3300026088 Bacteria 1133
197 Ga0207641_10563080 3300026088 Bacteria 1112
198 Ga0207648_10156816 3300026089 Bacteria 2009
199 Ga0207676_10032138 3300026095 Bacteria 3952
200 Ga0207676_10596240 3300026095 Bacteria 1061
201 Ga0207674_10058334 3300026116 Bacteria 3911
202 Ga0207683_10085934 3300026121 Bacteria 2796
203 Ga0207683_10232112 3300026121 Bacteria 1683
204 Ga0207698_10303542 3300026142 Bacteria 1487
205 Ga0209588_1002024 3300027671 Bacteria 5465
206 Ga0209813_10098507 3300027866 Bacteria 992
207 Ga0268266_10011198 3300028379 Bacteria 7805
208 Ga0268266_10070103 3300028379 Bacteria 3038
209 Ga0268266_10726197 3300028379 Bacteria 958
210 Ga0268265_10124222 3300028380 Bacteria 2133
211 Ga0268264_10000157 3300028381 Bacteria 155163
212 Ga0268264_10076356 3300028381 Bacteria 2850
213 Ga0307511_10215919 3300030521 Bacteria 971
214 Ga0265330_10037162 3300031235 Bacteria 2169
215 Ga0265330_10119854 3300031235 Bacteria 1121
216 Ga0265332_10005741 3300031238 Bacteria 5701
217 Ga0265328_10115674 3300031239 Bacteria 998
218 Ga0265325_10004053 3300031241 Bacteria 9349
219 Ga0265340_10063773 3300031247 Bacteria 1757
220 Ga0265339_10025786 3300031249 Bacteria 3370
221 Ga0265316_10059230 3300031344 Bacteria 2979
222 Ga0265316_10805774 3300031344 Bacteria 658
223 Ga0307509_10004247 3300031507 Bacteria 20883
224 Ga0307509_10263989 3300031507 Bacteria 1494
225 Ga0307509_10437652 3300031507 Bacteria 1004
226 Ga0307509_10918560 3300031507 Bacteria 540
227 Ga0307408_100981996 3300031548 Bacteria 777
228 Ga0265313_10033593 3300031595 Bacteria 2605
229 Ga0307508_10284905 3300031616 Bacteria 1246
230 Ga0307508_10435890 3300031616 Bacteria 902
231 Ga0265314_10710368 3300031711 Bacteria 507
232 Ga0265342_10272187 3300031712 Bacteria 898
233 Ga0307516_10002706 3300031730 Bacteria 23380
234 Ga0307516_10048675 3300031730 Bacteria 4171
235 Ga0307516_10079925 3300031730 Bacteria 3114
236 Ga0307516_10570601 3300031730 Bacteria 785
237 Ga0307410_11588761 3300031852 Bacteria 578
238 Ga0307416_100972470 3300032002 Bacteria 951
239 Ga0307507_10199127 3300033179 Bacteria 1390
240 Ga0307507_10485242 3300033179 Bacteria 671
241 Ga0307510_10021031 3300033180 Bacteria 7611
242 Ga0373938_0052460 3300034957 Bacteria 935
243 Ga0373934_0078522 3300035086 Bacteria 1324
244 Ga0373934_0244999 3300035086 Bacteria 741
245 Ga0373923_0092124 3300035111 Bacteria 1327
246 Ga0373932_0104552 3300035112 Bacteria 926
247 Ga0373936_0194555 3300035113 Bacteria 893
248 Ga0373956_0001802 3300035119 Bacteria 8828
249 Ga0373957_0000750 3300035120 Bacteria 8441
250 Ga0373955_0000951 3300035172 Bacteria 12364
251 Ga0373924_0036623 3300035410 Bacteria 1995
252 Ga0373931_0760668 3300035691 Bacteria 644
253 Ga0373935_1007705 3300035692 Bacteria 619
254 Ga0373927_0038210 3300035695 Bacteria 3117
255 Ga0373933_0003596 3300035724 Bacteria 8603
256 Ga0373933_0500257 3300035724 Bacteria 796
257 Ga0373947_0426925 3300035725 Bacteria 896
258 Ga0373937_0007317 3300036401 Bacteria 9555
259 Ga0395899_0058061 3300037312 Bacteria 2855
260 Ga0395900_0182118 3300037418 Bacteria 2134
261 Ga0395898_0069130 3300037466 Bacteria 3417
262 Ga0395905_0437993 3300037471 Bacteria 1204
263 Ga0395901_0009946 3300038443 Bacteria 9641
264 Ga0451789_1122218 3300041443 Bacteria 637
265 Ga0451800_0412276 3300041459 Bacteria 591
266 Ga0451804_0114829 3300041463 Bacteria 579
267 Ga0439445_0063509 3300042004 Bacteria 1013
268 Ga0439458_0026088 3300042157 Bacteria 1373
269 Ga0495617_019333 3300046452 Bacteria 2303
270 Ga0495592_0045556 3300046454 Bacteria 3272
271 Ga0495603_0149621 3300046455 Bacteria 1356
272 Ga0495603_0197536 3300046455 Bacteria 1162
273 Ga0495603_0479288 3300046455 Bacteria 712
274 Ga0495590_0068761 3300046457 Bacteria 1241
275 Ga0495590_0081381 3300046457 Bacteria 1141
276 Ga0495591_103549 3300046458 Bacteria 704
277 Ga0495629_0000611 3300046459 Bacteria 29086
278 Ga0495638_0069500 3300046460 Bacteria 2158
279 Ga0495651_0258913 3300046462 Bacteria 1184
280 Ga0495653_0044259 3300046463 Bacteria 3455
281 Ga0495653_0646879 3300046463 Bacteria 646
282 Ga0495650_0079683 3300046471 Bacteria 1266
283 Ga0495580_0886457 3300046472 Bacteria 574
284 Ga0495605_0065283 3300046474 Bacteria 1731
285 Ga0495584_0094523 3300046491 Bacteria 1509
286 Ga0495584_0438114 3300046491 Bacteria 664
287 Ga0495584_0681857 3300046491 Bacteria 524
288 Ga0495585_0053360 3300046492 Bacteria 2237
289 Ga0495585_0266816 3300046492 Bacteria 850
290 Ga0495594_0110079 3300046499 Bacteria 1553
291 Ga0495583_0136983 3300046506 Bacteria 1021
292 Ga0495606_0060377 3300046507 Bacteria 2428
293 Ga0495608_0053728 3300046511 Bacteria 2664
294 Ga0495610_0069732 3300046512 Bacteria 1644
295 Ga0495610_0198155 3300046512 Bacteria 824
296 Ga0495618_0036924 3300046514 Bacteria 3067
297 Ga0495620_0051063 3300046515 Bacteria 1761
298 Ga0495628_0047432 3300046516 Bacteria 3408
299 Ga0495632_0028255 3300046519 Bacteria 2928
300 Ga0495632_0099789 3300046519 Bacteria 1369
301 Ga0495637_0075265 3300046520 Bacteria 1355
302 Ga0495643_0131875 3300046522 Bacteria 1254
303 Ga0495648_0132967 3300046524 Bacteria 1320
304 Ga0495663_0023730 3300046525 Bacteria 1779
305 Ga0495666_0040053 3300046526 Bacteria 2273
306 Ga0495666_0178487 3300046526 Bacteria 981
307 Ga0495642_0040162 3300046528 Bacteria 1900
308 Ga0495652_0003071 3300046529 Bacteria 16736
309 Ga0495654_0105347 3300046530 Bacteria 1293
310 Ga0495640_0127090 3300046533 Bacteria 1652
311 Ga0495587_0071333 3300046536 Bacteria 2020
312 Ga0495609_0198826 3300046538 Bacteria 838
313 Ga0495597_0103528 3300046542 Bacteria 1198
314 Ga0495645_0014404 3300046543 Bacteria 5611
315 Ga0495645_0842472 3300046543 Bacteria 548
316 Ga0495622_0145535 3300046557 Bacteria 1074
317 Ga0495667_0002624 3300046559 Bacteria 11997
318 Ga0495656_0231107 3300046615 Bacteria 928
319 Ga0495668_0016908 3300046616 Bacteria 4236
320 Ga0495634_0034309 3300046642 Bacteria 3483
321 Ga0495611_0024054 3300046648 Bacteria 2647
322 Ga0495625_0032322 3300046660 Bacteria 3882
323 Ga0495625_0228032 3300046660 Bacteria 1218
324 Ga0495625_0339200 3300046660 Bacteria 953
325 Ga0495625_0729875 3300046660 Bacteria 582
326 Ga0495625_0793965 3300046660 Bacteria 551
327 Ga0495635_0054151 3300046663 Bacteria 2763
328 Ga0495659_0038280 3300046664 Bacteria 1702
329 Ga0495588_0017611 3300046674 Bacteria 3474
330 Ga0495657_0003445 3300046675 Bacteria 12909
331 Ga0495599_0015766 3300046678 Bacteria 4690
332 Ga0495623_0031923 3300046679 Bacteria 3385
333 Ga0495646_0040648 3300046680 Bacteria 2862
334 Ga0495647_0062290 3300046681 Bacteria 1475
335 Ga0495669_0085704 3300046684 Bacteria 1450
336 Ga0495669_0549708 3300046684 Bacteria 562
337 Ga0495624_0237750 3300046690 Bacteria 1103
338 Ga0495670_0330853 3300046691 Bacteria 818
339 Ga0495671_0117985 3300046692 Bacteria 1295
340 Ga0495649_0138211 3300046694 Bacteria 1283
341 Ga0495649_0184013 3300046694 Bacteria 1089
342 Ga0495589_0143277 3300046794 Bacteria 1143
343 Ga0495600_0000654 3300046809 Bacteria 17979
344 Ga0495660_0124074 3300046810 Bacteria 1303
345 Ga0495581_0219389 3300047315 Bacteria 1112
346 Ga0495604_0036356 3300047317 Bacteria 3882
347 Ga0495674_0071302 3300047319 Bacteria 3000
348 Ga0495680_0007602 3300047322 Bacteria 9906
349 Ga0495675_0000555 3300047444 Bacteria 24048
350 Ga0495677_0019348 3300047445 Bacteria 2470
351 Ga0495679_047690 3300047446 Bacteria 1299
352 Ga0495685_288408 3300047447 Bacteria 517
353 Ga0495681_0116754 3300047470 Bacteria 1150
354 Ga0495684_0000609 3300047471 Bacteria 28733
355 Ga0495686_0126750 3300047472 Bacteria 1517
356 Ga0495686_0283833 3300047472 Bacteria 919
357 Ga0495593_0005190 3300047673 Bacteria 7700
358 Ga0495602_0133221 3300048088 Bacteria 1978
359 Ga0496100_0088207 3300048903 Bacteria 2111
360 Ga0496101_0187512 3300048904 Bacteria 1595
361 Ga0496102_0101673 3300048905 Bacteria 2671
362 Ga0496102_0176930 3300048905 Bacteria 2009
363 Ga0496102_0917045 3300048905 Bacteria 798
364 Ga0496102_1375856 3300048905 Bacteria 625
365 Ga0496103_0094099 3300048906 Bacteria 1893
366 Ga0496103_0118996 3300048906 Bacteria 1682
367 Ga0496104_0171244 3300048907 Bacteria 2082
368 Ga0496105_0208198 3300048908 Bacteria 1595
369 Ga0496105_0602782 3300048908 Bacteria 852
370 Ga0496106_0001214 3300048909 Bacteria 19272
371 Ga0496106_0013724 3300048909 Bacteria 5983
372 Ga0496107_0066826 3300048910 Bacteria 2607
373 Ga0496107_0525147 3300048910 Bacteria 877
374 Ga0496108_0366083 3300048911 Bacteria 1258
375 Ga0496109_0165980 3300048912 Bacteria 2070
376 Ga0496111_0127586 3300048914 Bacteria 1881
377 Ga0496111_0162322 3300048914 Bacteria 1659
378 Ga0496111_0500742 3300048914 Bacteria 894
379 Ga0496112_0234211 3300048915 Bacteria 1790
380 Ga0496112_0266073 3300048915 Bacteria 1663
381 Ga0496113_0067109 3300048916 Bacteria 2719
382 Ga0496115_0182265 3300048918 Bacteria 1736
383 Ga0496117_0176470 3300048920 Bacteria 1234
384 Ga0496118_0009704 3300048921 Bacteria 9666
385 Ga0496118_0142694 3300048921 Bacteria 1515
386 Ga0496119_0334505 3300048922 Bacteria 738
387 Ga0496119_0475342 3300048922 Bacteria 585
388 Ga0496120_0151778 3300048923 Bacteria 1164
389 Ga0496121_0000370 3300048924 Bacteria 92397
390 Ga0496121_0031492 3300048924 Bacteria 4844
391 Ga0496122_0202313 3300048925 Bacteria 1160
392 Ga0496124_0000235 3300048927 Bacteria 107983
393 Ga0496125_0000207 3300048928 Bacteria 122897
394 Ga0496125_0107088 3300048928 Bacteria 2038
395 Ga0496125_0218527 3300048928 Bacteria 1230
396 Ga0496125_0245353 3300048928 Bacteria 1134
397 Ga0496126_0009846 3300048929 Bacteria 10116
398 Ga0496126_0012293 3300048929 Bacteria 8784
399 Ga0496126_0129670 3300048929 Bacteria 2180
400 Ga0496126_0133873 3300048929 Bacteria 2140
401 Ga0496126_0328840 3300048929 Bacteria 1255
402 Ga0496126_0567775 3300048929 Bacteria 898
403 Ga0495682_0126597 3300049460 Bacteria 914
404 nmdc:mga03683_163968_c1 3300050489 Bacteria 1008
405 nmdc:mga03683_4449_c1 3300050489 Bacteria 4651
406 nmdc:mga03n38_52723_c1 3300050490 Bacteria 1822
407 nmdc:mga03n38_99984_c1 3300050490 Bacteria 1397
408 nmdc:mga00v17_455142_c1 3300050491 Bacteria 831
409 nmdc:mga0yw44_130962_c1 3300050492 Bacteria 1624
410 nmdc:mga0k408_83992_c1 3300050493 Bacteria 1868
411 nmdc:mga06z11_144160_c1 3300050494 Bacteria 1349
412 nmdc:mga06z11_291043_c1 3300050494 Bacteria 969
413 nmdc:mga06z11_80507_c1 3300050494 Bacteria 1746
414 nmdc:mga04h51_37507_c1 3300050495 Bacteria 1565
415 nmdc:mga05p37_60656_c1 3300050507 Bacteria 4656
416 nmdc:mga09592_122365_c1 3300050508 Bacteria 2235
417 nmdc:mga0n895_290200_c1 3300050512 Bacteria 1658
418 nmdc:mga0n895_56978_c1 3300050512 Bacteria 3851
419 nmdc:mga0sz30_138067_c1 3300050516 Bacteria 1076
420 nmdc:mga0sz30_20363_c1 3300050516 Bacteria 2675
421 Ga0495601_0397007 3300053077 Bacteria 894
422 Ga0495612_0317883 3300053078 Bacteria 700
423 Ga0500635_0014760 3300053080 Bacteria 2295
424 Ga0495655_0072884 3300053083 Bacteria 964
425 Ga0495595_0018092 3300053084 Bacteria 3040
426 Ga0495595_0327532 3300053084 Bacteria 772
427 Ga0495619_0001710 3300053085 Bacteria 14541
428 Ga0495619_0609826 3300053085 Bacteria 746
429 Ga0500578_0480799 3300053086 Bacteria 702
430 Ga0500644_0453263 3300053088 Bacteria 562
431 Ga0500581_252876 3300053089 Bacteria 738
432 Ga0500647_0456435 3300053091 Bacteria 504
433 Ga0500583_0517051 3300053092 Bacteria 559
434 Ga0500651_0339395 3300053093 Bacteria 854
435 Ga0500566_0317866 3300053094 Bacteria 726
436 Ga0500554_003437 3300053102 Bacteria 3243
437 Ga0500557_110708 3300053105 Bacteria 912
438 Ga0500562_129573 3300053108 Bacteria 687
439 Ga0500569_057887 3300053109 Bacteria 1189
440 Ga0500595_021355 3300053119 Bacteria 2311
441 Ga0500621_114741 3300053126 Bacteria 1049
442 Ga0500642_0077704 3300053130 Bacteria 1520
443 Ga0500655_023095 3300053133 Bacteria 1173
444 Ga0500655_050626 3300053133 Bacteria 827
445 Ga0500658_0300759 3300053134 Bacteria 737
446 Ga0500559_0000298 3300053136 Bacteria 38374
447 Ga0500559_0010872 3300053136 Bacteria 3901
448 Ga0500573_0010783 3300053140 Bacteria 5106
449 Ga0500588_0083317 3300053146 Bacteria 1074
450 Ga0500589_040918 3300053147 Bacteria 2163
451 Ga0500589_115378 3300053147 Bacteria 1146
452 Ga0500590_038242 3300053148 Bacteria 2477
453 Ga0500590_244374 3300053148 Bacteria 719
454 Ga0500603_000155 3300053150 Bacteria 16912
455 Ga0500604_0105307 3300053151 Bacteria 933
456 Ga0500634_0398922 3300053161 Bacteria 509
457 Ga0500638_075749 3300053162 Bacteria 1603
458 Ga0500638_096065 3300053162 Bacteria 1389
459 Ga0500638_109479 3300053162 Bacteria 1278
460 Ga0500638_325995 3300053162 Bacteria 581
461 Ga0500636_0087107 3300053177 Bacteria 1792
462 Ga0500637_0045427 3300053178 Bacteria 2490
463 Ga0500637_0174317 3300053178 Bacteria 1235
464 Ga0500637_0461904 3300053178 Bacteria 640
465 Ga0500637_0577695 3300053178 Bacteria 537
466 Ga0500645_076019 3300053730 Bacteria 960
467 Ga0500645_108110 3300053730 Bacteria 781
468 Ga0500596_007474 3300053735 Bacteria 1790
469 Ga0500601_000758 3300053737 Bacteria 4168
470 Ga0500587_069718 3300053739 Bacteria 551
471 2513692619 2513237101 Bacteria 7952346
472 2513723214 2513237104 Bacteria 10034502
473 2644291703 2643221651 Bacteria 4798932
474 2745077062 2744054633 Bacteria 8678936
475 2793082145
476 2879111279 2879110137 Bacteria 8907982
477 2889039752 2889033259 Bacteria 9099371
478 2903753111 2903748898 Bacteria 9972761
479 2903753116 2903748898 Bacteria 9972761
480 2906648750 2906643746 Bacteria 8722424
481 2922391053 2922386360 Bacteria 7017218
482 8006965834 8006964411 Bacteria 8966052
483 8006986479 8006984368 Bacteria 9651211
484 8056673778 8056673599 Bacteria 7871253
485 8056689422 8056681323 Bacteria 8472857
486 Ga0163163_11793241
487 rootH2_10154545
488 rootH1_10375641
489 JGI25404J52841_10007637
490 Ga0070658_10198273
491 Ga0070670_100361819
492 Ga0068869_100051433
493 Ga0068869_100173846
494 Ga0070680_100094247
495 Ga0068868_100152875
496 Ga0068868_100538970
497 Ga0068868_101171139
498 Ga0070660_100083427
499 Ga0070689_100153380
500 Ga0070689_101348183
501 Ga0070668_100043904
502 Ga0070668_100368026
503 Ga0070669_101213635
504 Ga0070675_100679848
505 Ga0070671_100176358
506 Ga0070671_100611448
507 Ga0070671_101471059
508 Ga0070674_100457505
509 Ga0070688_100250459
510 Ga0070659_100191246
511 Ga0070659_100209691
512 Ga0070667_100794335
513 Ga0070709_10232801
514 Ga0070709_10246466
515 Ga0070714_101111924
516 Ga0070710_10510031
517 Ga0070701_10270505
518 Ga0070711_100105313
519 Ga0070711_100184481
520 Ga0070694_100747089
521 Ga0070663_100305136
522 Ga0070663_100546876
523 Ga0070678_100032558
524 Ga0070678_101152883
525 Ga0070662_100697507
526 Ga0070662_101215529
527 Ga0070681_10271144
528 Ga0068867_100698732
529 Ga0070685_10345948
530 Ga0070685_10792137
531 Ga0070684_100180233
532 Ga0068853_100043633
533 Ga0068853_100119371
534 Ga0068853_100871086
535 Ga0070693_100146644
536 Ga0070665_100012712
537 Ga0070665_100042999
538 Ga0070665_100635555
539 Ga0068855_100080916
540 Ga0068855_100084873
541 Ga0068857_100093983
542 Ga0068854_100287052
543 Ga0068856_100312048
544 Ga0068856_100459668
545 Ga0070702_100086603
546 Ga0068852_100262585
547 Ga0068859_100091057
548 Ga0068864_100031215
549 Ga0068864_101734017
550 Ga0068861_100458797
551 Ga0068863_100090099
552 Ga0068863_100782266
553 Ga0068858_100090778
554 Ga0068858_100577381
555 Ga0068860_100000692
556 Ga0068860_100143205
557 Ga0068860_101483690
558 Ga0081455_10005510
559 Ga0081455_10021425
560 Ga0081455_10341210
561 Ga0081455_10452120
562 Ga0081455_10472109
563 Ga0081540_1005727
564 Ga0081540_1006775
565 Ga0081540_1014506
566 Ga0081540_1240399
567 Ga0075365_10027336
568 Ga0075368_10028999
569 Ga0075363_100054091
570 Ga0075364_10049194
571 Ga0075364_10061757
572 Ga0075362_10005627
573 Ga0075362_10160883
574 Ga0075367_10085893
575 Ga0075367_10101807
576 Ga0075369_10130034
577 Ga0075366_10043846
578 Ga0075366_10496127
579 Ga0097621_100024534
580 Ga0075370_10058878
581 Ga0075370_10100011
582 Ga0075370_10682923
583 Ga0068871_100261867
584 Ga0068871_101151871
585 Ga0075428_100005652
586 Ga0075433_10975024
587 Ga0075434_100129028
588 Ga0075434_100660407
589 Ga0075429_100269590
590 Ga0068865_100447191
591 Ga0097620_100091054
592 Ga0099795_10144534
593 Ga0105240_10103407
594 Ga0105240_10849801
595 Ga0105245_10078901
596 Ga0105247_10020831
597 Ga0105247_10046147
598 Ga0105247_10422317
599 Ga0114129_10349783
600 Ga0114129_10422651
601 Ga0105241_10054020
602 Ga0105248_10043835
603 Ga0105237_10055083
604 Ga0105237_10202185
605 Ga0105238_10139969
606 Ga0105249_10575933
607 Ga0105239_10198845
608 Ga0105239_10866144
609 Ga0105246_10254006
610 Ga0105246_11797541
611 Ga0157325_1003832
612 Ga0157371_10190143
613 Ga0157374_10609940
614 Ga0157378_10337642
615 Ga0157378_10791872
616 Ga0163162_10088497
617 Ga0157372_10436292
618 Ga0157372_10603852
619 Ga0157375_10230728
620 Ga0163163_10009592
621 Ga0163163_10076534
622 Ga0157377_10026466
623 Ga0157379_10072130
624 Ga0157379_10200510
625 Ga0157376_10226629
626 Ga0209758_1022102
627 Ga0207656_10005262
628 Ga0207692_10397440
629 Ga0207642_10212847
630 Ga0207710_10009051
631 Ga0207710_10200039
632 Ga0207688_10031516
633 Ga0207699_10233317
634 Ga0207699_11400921
635 Ga0207645_10038487
636 Ga0207643_10017049
637 Ga0207684_10903090
638 Ga0207654_10160436
639 Ga0207671_10073249
640 Ga0207671_10439597
641 Ga0207663_10176885
642 Ga0207660_10004459
643 Ga0207657_10007619
644 Ga0207657_10149777
645 Ga0207649_10111896
646 Ga0207652_10003482
647 Ga0207681_10974506
648 Ga0207694_10022471
649 Ga0207650_10285798
650 Ga0207687_10041629
651 Ga0207664_10235259
652 Ga0207644_10141787
653 Ga0207644_10343493
654 Ga0207690_10137496
655 Ga0207706_10083882
656 Ga0207670_10487167
657 Ga0207704_10515940
658 Ga0207711_10031970
659 Ga0207689_10029272
660 Ga0207689_10068486
661 Ga0207679_10987896
662 Ga0207667_10048945
663 Ga0207667_10063119
664 Ga0207667_10180807
665 Ga0207712_11031338
666 Ga0207668_10119855
667 Ga0207668_10622362
668 Ga0207668_10786468
669 Ga0207640_10009340
670 Ga0207640_10172765
671 Ga0207658_10163709
672 Ga0207677_10019033
673 Ga0207703_10022068
674 Ga0207703_10327450
675 Ga0207639_10046189
676 Ga0207678_10248888
677 Ga0207678_10309397
678 Ga0207678_10525199
679 Ga0207702_10207193
680 Ga0207641_10474418
681 Ga0207641_10542566
682 Ga0207641_10563080
683 Ga0207648_10156816
684 Ga0207676_10032138
685 Ga0207676_10596240
686 Ga0207674_10058334
687 Ga0207683_10085934
688 Ga0207683_10232112
689 Ga0207698_10303542
690 Ga0209588_1002024
691 Ga0209813_10098507
692 Ga0268266_10011198
693 Ga0268266_10070103
694 Ga0268266_10726197
695 Ga0268265_10124222
696 Ga0268264_10000157
697 Ga0268264_10076356
698 Ga0307511_10215919
699 Ga0265330_10037162
700 Ga0265330_10119854
701 Ga0265332_10005741
702 Ga0265328_10115674
703 Ga0265325_10004053
704 Ga0265340_10063773
705 Ga0265339_10025786
706 Ga0265316_10059230
707 Ga0265316_10805774
708 Ga0307509_10004247
709 Ga0307509_10263989
710 Ga0307509_10437652
711 Ga0307509_10918560
712 Ga0307408_100981996
713 Ga0265313_10033593
714 Ga0307508_10284905
715 Ga0307508_10435890
716 Ga0265314_10710368
717 Ga0265342_10272187
718 Ga0307516_10002706
719 Ga0307516_10048675
720 Ga0307516_10079925
721 Ga0307516_10570601
722 Ga0307410_11588761
723 Ga0307416_100972470
724 Ga0307507_10199127
725 Ga0307507_10485242
726 Ga0307510_10021031
727 Ga0373938_0052460
728 Ga0373934_0078522
729 Ga0373934_0244999
730 Ga0373923_0092124
731 Ga0373932_0104552
732 Ga0373936_0194555
733 Ga0373956_0001802
734 Ga0373957_0000750
735 Ga0373955_0000951
736 Ga0373924_0036623
737 Ga0373931_0760668
738 Ga0373935_1007705
739 Ga0373927_0038210
740 Ga0373933_0003596
741 Ga0373933_0500257
742 Ga0373947_0426925
743 Ga0373937_0007317
744 Ga0395899_0058061
745 Ga0395900_0182118
746 Ga0395898_0069130
747 Ga0395905_0437993
748 Ga0395901_0009946
749 Ga0451789_1122218
750 Ga0451800_0412276
751 Ga0451804_0114829
752 Ga0439445_0063509
753 Ga0439458_0026088
754 Ga0495617_019333
755 Ga0495592_0045556
756 Ga0495603_0149621
757 Ga0495603_0197536
758 Ga0495603_0479288
759 Ga0495590_0068761
760 Ga0495590_0081381
761 Ga0495591_103549
762 Ga0495629_0000611
763 Ga0495638_0069500
764 Ga0495651_0258913
765 Ga0495653_0044259
766 Ga0495653_0646879
767 Ga0495650_0079683
768 Ga0495580_0886457
769 Ga0495605_0065283
770 Ga0495584_0094523
771 Ga0495584_0438114
772 Ga0495584_0681857
773 Ga0495585_0053360
774 Ga0495585_0266816
775 Ga0495594_0110079
776 Ga0495583_0136983
777 Ga0495606_0060377
778 Ga0495608_0053728
779 Ga0495610_0069732
780 Ga0495610_0198155
781 Ga0495618_0036924
782 Ga0495620_0051063
783 Ga0495628_0047432
784 Ga0495632_0028255
785 Ga0495632_0099789
786 Ga0495637_0075265
787 Ga0495643_0131875
788 Ga0495648_0132967
789 Ga0495663_0023730
790 Ga0495666_0040053
791 Ga0495666_0178487
792 Ga0495642_0040162
793 Ga0495652_0003071
794 Ga0495654_0105347
795 Ga0495640_0127090
796 Ga0495587_0071333
797 Ga0495609_0198826
798 Ga0495597_0103528
799 Ga0495645_0014404
800 Ga0495645_0842472
801 Ga0495622_0145535
802 Ga0495667_0002624
803 Ga0495656_0231107
804 Ga0495668_0016908
805 Ga0495634_0034309
806 Ga0495611_0024054
807 Ga0495625_0032322
808 Ga0495625_0228032
809 Ga0495625_0339200
810 Ga0495625_0729875
811 Ga0495625_0793965
812 Ga0495635_0054151
813 Ga0495659_0038280
814 Ga0495588_0017611
815 Ga0495657_0003445
816 Ga0495599_0015766
817 Ga0495623_0031923
818 Ga0495646_0040648
819 Ga0495647_0062290
820 Ga0495669_0085704
821 Ga0495669_0549708
822 Ga0495624_0237750
823 Ga0495670_0330853
824 Ga0495671_0117985
825 Ga0495649_0138211
826 Ga0495649_0184013
827 Ga0495589_0143277
828 Ga0495600_0000654
829 Ga0495660_0124074
830 Ga0495581_0219389
831 Ga0495604_0036356
832 Ga0495674_0071302
833 Ga0495680_0007602
834 Ga0495675_0000555
835 Ga0495677_0019348
836 Ga0495679_047690
837 Ga0495685_288408
838 Ga0495681_0116754
839 Ga0495684_0000609
840 Ga0495686_0126750
841 Ga0495686_0283833
842 Ga0495593_0005190
843 Ga0495602_0133221
844 Ga0496100_0088207
845 Ga0496101_0187512
846 Ga0496102_0101673
847 Ga0496102_0176930
848 Ga0496102_0917045
849 Ga0496102_1375856
850 Ga0496103_0094099
851 Ga0496103_0118996
852 Ga0496104_0171244
853 Ga0496105_0208198
854 Ga0496105_0602782
855 Ga0496106_0001214
856 Ga0496106_0013724
857 Ga0496107_0066826
858 Ga0496107_0525147
859 Ga0496108_0366083
860 Ga0496109_0165980
861 Ga0496111_0127586
862 Ga0496111_0162322
863 Ga0496111_0500742
864 Ga0496112_0234211
865 Ga0496112_0266073
866 Ga0496113_0067109
867 Ga0496115_0182265
868 Ga0496117_0176470
869 Ga0496118_0009704
870 Ga0496118_0142694
871 Ga0496119_0334505
872 Ga0496119_0475342
873 Ga0496120_0151778
874 Ga0496121_0000370
875 Ga0496121_0031492
876 Ga0496122_0202313
877 Ga0496124_0000235
878 Ga0496125_0000207
879 Ga0496125_0107088
880 Ga0496125_0218527
881 Ga0496125_0245353
882 Ga0496126_0009846
883 Ga0496126_0012293
884 Ga0496126_0129670
885 Ga0496126_0133873
886 Ga0496126_0328840
887 Ga0496126_0567775
888 Ga0495682_0126597
889 nmdc:mga03683_163968_c1
890 nmdc:mga03683_4449_c1
891 nmdc:mga03n38_52723_c1
892 nmdc:mga03n38_99984_c1
893 nmdc:mga00v17_455142_c1
894 nmdc:mga0yw44_130962_c1
895 nmdc:mga0k408_83992_c1
896 nmdc:mga06z11_144160_c1
897 nmdc:mga06z11_291043_c1
898 nmdc:mga06z11_80507_c1
899 nmdc:mga04h51_37507_c1
900 nmdc:mga05p37_60656_c1
901 nmdc:mga09592_122365_c1
902 nmdc:mga0n895_290200_c1
903 nmdc:mga0n895_56978_c1
904 nmdc:mga0sz30_138067_c1
905 nmdc:mga0sz30_20363_c1
906 Ga0495601_0397007
907 Ga0495612_0317883
908 Ga0500635_0014760
909 Ga0495655_0072884
910 Ga0495595_0018092
911 Ga0495595_0327532
912 Ga0495619_0001710
913 Ga0495619_0609826
914 Ga0500578_0480799
915 Ga0500644_0453263
916 Ga0500581_252876
917 Ga0500647_0456435
918 Ga0500583_0517051
919 Ga0500651_0339395
920 Ga0500566_0317866
921 Ga0500554_003437
922 Ga0500557_110708
923 Ga0500562_129573
924 Ga0500569_057887
925 Ga0500595_021355
926 Ga0500621_114741
927 Ga0500642_0077704
928 Ga0500655_023095
929 Ga0500655_050626
930 Ga0500658_0300759
931 Ga0500559_0000298
932 Ga0500559_0010872
933 Ga0500573_0010783
934 Ga0500588_0083317
935 Ga0500589_040918
936 Ga0500589_115378
937 Ga0500590_038242
938 Ga0500590_244374
939 Ga0500603_000155
940 Ga0500604_0105307
941 Ga0500634_0398922
942 Ga0500638_075749
943 Ga0500638_096065
944 Ga0500638_109479
945 Ga0500638_325995
946 Ga0500636_0087107
947 Ga0500637_0045427
948 Ga0500637_0174317
949 Ga0500637_0461904
950 Ga0500637_0577695
951 Ga0500645_076019
952 Ga0500645_108110
953 Ga0500596_007474
954 Ga0500601_000758
955 Ga0500587_069718
956 2513692619
957 2513723214
958 2644291703
959 2745077062
960 2793082145
961 2879111279
962 2889039752
963 2903753111
964 2903753116
965 2906648750
966 2922391053
967 8006965834
968 8006986479
969 8056673778
970 8056689422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13115

YtkA

YtkA-like

51

139

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hxl-assembly1.cif.gz_A crystal structure of the sheath tail protein (dsy3957) from desulfitobacterium hafniense, northeast structural genomics consortium target dhr18 0.8057 109 132
2ia7-assembly1.cif.gz_A crystal structure of putative tail lysozyme (np_952040.1) from geobacter sulfurreducens at 1.44 a resolution 0.7797 109 135
3uc2-assembly3.cif.gz_C crystal structure of a duf4426 family protein (pa0388) from pseudomonas aeruginosa pao1 at 2.09 a resolution 0.6641 49 135
5d7h-assembly1.cif.gz_A x-ray crystal structure of l,d transpeptidase 2 from mycobacterium tuberculosis 0.6556 33 133
4qrb-assembly1.cif.gz_A structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation 0.6499 33 133
ID Description Score Start End Superfamily
3hxlA05 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2; 0.8057 109 132 3.30.360.90
2ia7A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7797 109 135 3.10.450.40
af_Q54HG9_6_676_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7569 33 133 1.50.10.20
af_A0A0G2K294_491_599_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.6777 32 135 2.60.40.60
3q12A02 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;Pantoate-beta-alanine ligase, C-terminal domain 0.6684 65 135 3.30.1300.10
ID Description Score Start End GO Terms
AF-A0A2R4WX71-F1-model_v4 YtkA-like domain-containing protein 0.9661 30 135
AF-A0A840ZN34-F1-model_v4 YtkA-like domain-containing protein 0.9626 31 135
AF-A0A1Q3NR00-F1-model_v4 deleted 0.9604 26 135
AF-A0A3G8MCR1-F1-model_v4 Heavy metal RND transporter 0.954 28 135
AF-A0A1B2EXP7-F1-model_v4 Heavy metal RND transporter 0.9538 30 135

Map