F453076

General Info

Members Datasets Scaffolds Average Seq Length
485 235 970 182

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10333177|Ga0075364_103331772
Length 216
Sequence MAAVPGQEPAAEELPRGRFRQSIAARSFYNSQTVKIYTRTGDTGETGLFDGTRVLKSDARVATYGEVDELNAWLGLARSALAGQAELSEMIVEIQRDLFAVGARLADPSRKIAERVSKAGIGPADIVRLERWIDMLDSMLPPLRRFILAGGSHAGATLHLARTVCRRAERAMVALRAGDETAVESALIIYVNRLSDLLFVMARVANFRDDTPEIEW

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
150 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
153 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
154 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
155 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
210 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.57
Nodule 0
Rhizoplane 3.3
Rhizosphere 90.93
Stem 0
Stem Tuber 0
Unclassified 7.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10333177 3300006051 Bacteria 1034
2 MBSR1b_contig_12996511 2162886012 Bacteria 1131
3 Ga0065715_10099099 3300005293 Bacteria 3458
4 Ga0065707_10082648 3300005295 Bacteria 13063
5 Ga0070676_10106521 3300005328 Bacteria 1739
6 Ga0070676_10320359 3300005328 Bacteria 1057
7 Ga0070683_100061640 3300005329 Bacteria 3488
8 Ga0070690_100045308 3300005330 Bacteria 2793
9 Ga0070690_100283764 3300005330 Bacteria 1182
10 Ga0070690_100747863 3300005330 Bacteria 754
11 Ga0070670_100007430 3300005331 Bacteria 9307
12 Ga0070670_100022662 3300005331 Bacteria 5404
13 Ga0070670_100205301 3300005331 Bacteria 1712
14 Ga0070670_100467357 3300005331 Bacteria 1119
15 Ga0070677_10039618 3300005333 Bacteria 1850
16 Ga0068869_100193148 3300005334 Bacteria 1602
17 Ga0068869_100419670 3300005334 Bacteria 1104
18 Ga0070666_10021685 3300005335 Bacteria 4163
19 Ga0070680_100225276 3300005336 Bacteria 1583
20 Ga0068868_100065532 3300005338 Bacteria 2886
21 Ga0068868_100251986 3300005338 Bacteria 1486
22 Ga0068868_100845432 3300005338 Bacteria 829
23 Ga0070660_100542055 3300005339 Bacteria 970
24 Ga0070689_100009263 3300005340 Bacteria 6974
25 Ga0070689_100145670 3300005340 Bacteria 1907
26 Ga0070689_100407608 3300005340 Bacteria 1150
27 Ga0070691_10010724 3300005341 Bacteria 4183
28 Ga0070687_100013992 3300005343 Bacteria 3593
29 Ga0070661_100488172 3300005344 Bacteria 984
30 Ga0070692_10508299 3300005345 Bacteria 782
31 Ga0070668_100139151 3300005347 Bacteria 1955
32 Ga0070669_100001115 3300005353 Bacteria 19624
33 Ga0070669_100062158 3300005353 Bacteria 2745
34 Ga0070669_100143193 3300005353 Bacteria 1845
35 Ga0070675_100155574 3300005354 Bacteria 1963
36 Ga0070675_100264129 3300005354 Bacteria 1509
37 Ga0070675_100714147 3300005354 Bacteria 913
38 Ga0070675_100733341 3300005354 Bacteria 901
39 Ga0070671_100065235 3300005355 Bacteria 3033
40 Ga0070674_100080260 3300005356 Bacteria 2329
41 Ga0070674_100250383 3300005356 Bacteria 1391
42 Ga0070674_100263085 3300005356 Bacteria 1360
43 Ga0070674_100365281 3300005356 Bacteria 1170
44 Ga0070674_100709404 3300005356 Bacteria 861
45 Ga0070673_100008351 3300005364 Bacteria 6880
46 Ga0070673_100050789 3300005364 Bacteria 3244
47 Ga0070673_100132402 3300005364 Bacteria 2094
48 Ga0070673_100844766 3300005364 Bacteria 847
49 Ga0070673_101213243 3300005364 Bacteria 707
50 Ga0070688_100027307 3300005365 Bacteria 3399
51 Ga0070688_100475928 3300005365 Bacteria 938
52 Ga0070659_100102272 3300005366 Bacteria 2307
53 Ga0070667_100456351 3300005367 Unclassified 1168
54 Ga0070667_100548053 3300005367 Bacteria 1063
55 Ga0070701_10030801 3300005438 Bacteria 2657
56 Ga0070705_100232899 3300005440 Bacteria 1283
57 Ga0070700_100008251 3300005441 Bacteria 5670
58 Ga0070700_100081008 3300005441 Bacteria 2096
59 Ga0070700_100166144 3300005441 Bacteria 1524
60 Ga0070663_100243712 3300005455 Bacteria 1420
61 Ga0070663_100264563 3300005455 Bacteria 1365
62 Ga0070678_100145633 3300005456 Bacteria 1901
63 Ga0070678_100808211 3300005456 Bacteria 852
64 Ga0070662_100234469 3300005457 Bacteria 1469
65 Ga0070662_100314682 3300005457 Bacteria 1275
66 Ga0068867_100001573 3300005459 Bacteria 15866
67 Ga0068867_100030580 3300005459 Bacteria 3883
68 Ga0068867_100525843 3300005459 Bacteria 1021
69 Ga0070685_10286269 3300005466 Bacteria 1105
70 Ga0070707_101453995 3300005468 Unclassified 652
71 Ga0070698_100213904 3300005471 Bacteria 1862
72 Ga0070698_100257889 3300005471 Bacteria 1676
73 Ga0070699_100762859 3300005518 Bacteria 885
74 Ga0070684_100009549 3300005535 Bacteria 7645
75 Ga0070672_100051729 3300005543 Bacteria 3205
76 Ga0070672_100064563 3300005543 Bacteria 2893
77 Ga0070672_100339273 3300005543 Bacteria 1279
78 Ga0070686_100085747 3300005544 Bacteria 2095
79 Ga0070686_100127635 3300005544 Bacteria 1755
80 Ga0070695_100197086 3300005545 Bacteria 1437
81 Ga0070665_100771593 3300005548 Bacteria 974
82 Ga0070704_100138338 3300005549 Bacteria 1898
83 Ga0070664_100071789 3300005564 Bacteria 2967
84 Ga0070664_100126015 3300005564 Bacteria 2247
85 Ga0070664_100330316 3300005564 Bacteria 1383
86 Ga0068854_100094578 3300005578 Bacteria 2229
87 Ga0068854_100338133 3300005578 Bacteria 1229
88 Ga0068856_100145802 3300005614 Bacteria 2375
89 Ga0070702_100033883 3300005615 Bacteria 2811
90 Ga0068852_100206749 3300005616 Bacteria 1860
91 Ga0068859_100006126 3300005617 Bacteria 12221
92 Ga0068859_100216288 3300005617 Bacteria 2004
93 Ga0068859_100330614 3300005617 Bacteria 1618
94 Ga0068859_100841566 3300005617 Bacteria 1004
95 Ga0068864_100037607 3300005618 Bacteria 4132
96 Ga0068866_10064071 3300005718 Bacteria 1918
97 Ga0068861_100133758 3300005719 Bacteria 2016
98 Ga0068870_10011628 3300005840 Bacteria 4089
99 Ga0068863_100199355 3300005841 Bacteria 1925
100 Ga0068858_100097256 3300005842 Bacteria 2744
101 Ga0068858_100110637 3300005842 Bacteria 2565
102 Ga0068858_100383403 3300005842 Bacteria 1349
103 Ga0068860_100151199 3300005843 Bacteria 2235
104 Ga0068862_100003823 3300005844 Bacteria 12823
105 Ga0068862_100149987 3300005844 Bacteria 2075
106 Ga0068862_100448256 3300005844 Bacteria 1216
107 Ga0068862_101189242 3300005844 Bacteria 760
108 Ga0075365_10043769 3300006038 Bacteria 2931
109 Ga0075368_10003488 3300006042 Bacteria 5261
110 Ga0075368_10007139 3300006042 Bacteria 3935
111 Ga0075368_10257842 3300006042 Bacteria 746
112 Ga0075364_10045719 3300006051 Bacteria 2849
113 Ga0075364_10156626 3300006051 Bacteria 1536
114 Ga0075362_10000421 3300006177 Bacteria 12191
115 Ga0075367_10003356 3300006178 Bacteria 7615
116 Ga0075367_10003691 3300006178 Bacteria 7353
117 Ga0075366_10027854 3300006195 Bacteria 3316
118 Ga0075366_10043142 3300006195 Bacteria 2671
119 Ga0075366_10088303 3300006195 Bacteria 1856
120 Ga0097621_100651846 3300006237 Bacteria 966
121 Ga0075370_10007617 3300006353 Bacteria 5523
122 Ga0075428_100031530 3300006844 Bacteria 5857
123 Ga0075428_100114237 3300006844 Bacteria 2942
124 Ga0075428_100272037 3300006844 Bacteria 1823
125 Ga0075428_100515683 3300006844 Bacteria 1279
126 Ga0075430_100010520 3300006846 Bacteria 7834
127 Ga0075430_100086195 3300006846 Bacteria 2629
128 Ga0075431_100017370 3300006847 Bacteria 7313
129 Ga0075434_100162111 3300006871 Bacteria 2256
130 Ga0075434_100360829 3300006871 Unclassified 1474
131 Ga0075434_100512542 3300006871 Bacteria 1220
132 Ga0075429_100000156 3300006880 Bacteria 42804
133 Ga0075429_100012854 3300006880 Bacteria 7262
134 Ga0068865_100229876 3300006881 Bacteria 1454
135 Ga0097620_100006127 3300006931 Bacteria 12221
136 Ga0097620_100216312 3300006931 Bacteria 2004
137 Ga0097620_100330628 3300006931 Bacteria 1618
138 Ga0097620_100841665 3300006931 Bacteria 1004
139 Ga0075435_100131733 3300007076 Bacteria 2092
140 Ga0111539_10000209 3300009094 Bacteria 69503
141 Ga0111539_10000574 3300009094 Bacteria 47151
142 Ga0111539_10009255 3300009094 Bacteria 12449
143 Ga0111539_10009783 3300009094 Bacteria 12103
144 Ga0111539_10034973 3300009094 Bacteria 6085
145 Ga0111539_10321699 3300009094 Bacteria 1800
146 Ga0111539_10427503 3300009094 Bacteria 1542
147 Ga0111539_10503082 3300009094 Bacteria 1411
148 Ga0105245_10029640 3300009098 Bacteria 4837
149 Ga0105247_10068463 3300009101 Bacteria 2213
150 Ga0114129_10000077 3300009147 Bacteria 90951
151 Ga0114129_10016371 3300009147 Bacteria 10555
152 Ga0114129_10046823 3300009147 Bacteria 6077
153 Ga0114129_10242317 3300009147 Bacteria 2423
154 Ga0105243_10038428 3300009148 Bacteria 3727
155 Ga0105243_10070430 3300009148 Bacteria 2824
156 Ga0105242_10046119 3300009176 Bacteria 3535
157 Ga0105242_11516010 3300009176 Bacteria 702
158 Ga0105248_10041545 3300009177 Bacteria 5155
159 Ga0105248_10751312 3300009177 Bacteria 1100
160 Ga0105249_10001092 3300009553 Bacteria 24120
161 Ga0105249_10006855 3300009553 Bacteria 9935
162 Ga0105249_10064040 3300009553 Bacteria 3379
163 Ga0105249_10172157 3300009553 Bacteria 2101
164 Ga0105239_10447077 3300010375 Bacteria 1466
165 Ga0105246_10487894 3300011119 Bacteria 1044
166 Ga0163162_10239865 3300013306 Bacteria 1944
167 Ga0163162_10350538 3300013306 Bacteria 1609
168 Ga0157372_10572362 3300013307 Bacteria 1316
169 Ga0157375_10019382 3300013308 Bacteria 6186
170 Ga0163163_10002902 3300014325 Bacteria 14505
171 Ga0163163_10108804 3300014325 Bacteria 2799
172 Ga0163163_10820675 3300014325 Bacteria 993
173 Ga0157380_10018497 3300014326 Bacteria 5173
174 Ga0157380_10304238 3300014326 Bacteria 1470
175 Ga0157380_10491828 3300014326 Bacteria 1189
176 Ga0157377_10099941 3300014745 Bacteria 1727
177 Ga0157379_10020372 3300014968 Bacteria 5863
178 Ga0157379_10754920 3300014968 Bacteria 916
179 Ga0157376_10444781 3300014969 Unclassified 1263
180 Ga0207697_10154778 3300025315 Bacteria 998
181 Ga0207682_10024849 3300025893 Bacteria 2375
182 Ga0207642_10127177 3300025899 Bacteria 1324
183 Ga0207710_10472521 3300025900 Bacteria 649
184 Ga0207688_10018820 3300025901 Bacteria 3757
185 Ga0207645_10008760 3300025907 Bacteria 7038
186 Ga0207645_10250787 3300025907 Bacteria 1171
187 Ga0207643_10015810 3300025908 Bacteria 4111
188 Ga0207707_10430943 3300025912 Bacteria 1129
189 Ga0207660_10319445 3300025917 Bacteria 1240
190 Ga0207662_10009398 3300025918 Bacteria 5377
191 Ga0207657_10304395 3300025919 Bacteria 1262
192 Ga0207657_10622806 3300025919 Unclassified 841
193 Ga0207649_10076853 3300025920 Bacteria 2150
194 Ga0207649_10666893 3300025920 Unclassified 805
195 Ga0207681_10048956 3300025923 Bacteria 2855
196 Ga0207681_10096690 3300025923 Bacteria 2121
197 Ga0207650_10007401 3300025925 Bacteria 7476
198 Ga0207650_10014390 3300025925 Bacteria 5499
199 Ga0207650_10161567 3300025925 Bacteria 1775
200 Ga0207659_10190964 3300025926 Bacteria 1630
201 Ga0207659_10205209 3300025926 Bacteria 1576
202 Ga0207659_10549935 3300025926 Bacteria 981
203 Ga0207690_10130657 3300025932 Bacteria 1838
204 Ga0207690_10133759 3300025932 Bacteria 1818
205 Ga0207706_10178893 3300025933 Bacteria 1863
206 Ga0207706_10180130 3300025933 Bacteria 1856
207 Ga0207706_10253182 3300025933 Bacteria 1538
208 Ga0207686_10114187 3300025934 Bacteria 1827
209 Ga0207670_10030155 3300025936 Bacteria 3463
210 Ga0207670_10062032 3300025936 Bacteria 2553
211 Ga0207670_10072368 3300025936 Bacteria 2386
212 Ga0207669_10053531 3300025937 Bacteria 2432
213 Ga0207669_10850343 3300025937 Bacteria 759
214 Ga0207691_10010231 3300025940 Bacteria 9000
215 Ga0207691_10049610 3300025940 Bacteria 3846
216 Ga0207691_10092611 3300025940 Bacteria 2707
217 Ga0207691_10181334 3300025940 Bacteria 1840
218 Ga0207691_10377706 3300025940 Bacteria 1210
219 Ga0207691_10648166 3300025940 Bacteria 892
220 Ga0207711_10025890 3300025941 Bacteria 4920
221 Ga0207711_10089032 3300025941 Bacteria 2711
222 Ga0207689_10041392 3300025942 Bacteria 3812
223 Ga0207689_10175324 3300025942 Bacteria 1768
224 Ga0207661_10060032 3300025944 Bacteria 3066
225 Ga0207679_10138152 3300025945 Bacteria 1966
226 Ga0207679_10810514 3300025945 Bacteria 854
227 Ga0207651_10292455 3300025960 Bacteria 1351
228 Ga0207712_10043937 3300025961 Bacteria 3085
229 Ga0207712_10216154 3300025961 Bacteria 1530
230 Ga0207712_10369446 3300025961 Bacteria 1197
231 Ga0207703_10096859 3300026035 Bacteria 2492
232 Ga0207703_10622578 3300026035 Bacteria 1022
233 Ga0207703_10759195 3300026035 Bacteria 924
234 Ga0207678_10073992 3300026067 Bacteria 2919
235 Ga0207678_10301341 3300026067 Bacteria 1377
236 Ga0207708_10035891 3300026075 Bacteria 3772
237 Ga0207702_10150729 3300026078 Bacteria 2115
238 Ga0207641_10050860 3300026088 Bacteria 3508
239 Ga0207641_10379180 3300026088 Bacteria 1354
240 Ga0207648_10000280 3300026089 Bacteria 55313
241 Ga0207648_10003483 3300026089 Bacteria 16493
242 Ga0207648_10098591 3300026089 Bacteria 2559
243 Ga0207648_10389661 3300026089 Bacteria 1261
244 Ga0207676_10012689 3300026095 Bacteria 6045
245 Ga0207674_10064065 3300026116 Bacteria 3708
246 Ga0207675_100007184 3300026118 Bacteria 10523
247 Ga0207675_100129536 3300026118 Bacteria 2392
248 Ga0207675_100462870 3300026118 Bacteria 1258
249 Ga0207675_100915390 3300026118 Unclassified 893
250 Ga0207683_10160063 3300026121 Bacteria 2035
251 Ga0207683_10178240 3300026121 Bacteria 1926
252 Ga0207683_10226759 3300026121 Bacteria 1703
253 Ga0209813_10005965 3300027866 Bacteria 2990
254 Ga0207428_10000022 3300027907 Bacteria 273333
255 Ga0207428_10000135 3300027907 Bacteria 99170
256 Ga0207428_10000558 3300027907 Bacteria 44040
257 Ga0207428_10020513 3300027907 Bacteria 5612
258 Ga0207428_10029012 3300027907 Bacteria 4591
259 Ga0207428_10539966 3300027907 Bacteria 844
260 Ga0268265_10199895 3300028380 Bacteria 1733
261 Ga0268265_10298522 3300028380 Bacteria 1449
262 Ga0268265_10758497 3300028380 Bacteria 942
263 Ga0268265_11076037 3300028380 Bacteria 797
264 Ga0268264_10164744 3300028381 Bacteria 2000
265 Ga0268264_10166498 3300028381 Bacteria 1990
266 Ga0268264_10205986 3300028381 Bacteria 1802
267 Ga0307408_100013541 3300031548 Bacteria 5414
268 Ga0307408_100015172 3300031548 Bacteria 5127
269 Ga0307408_100015321 3300031548 Bacteria 5104
270 Ga0307408_100164774 3300031548 Bacteria 1764
271 Ga0307405_10046446 3300031731 Bacteria 2668
272 Ga0307405_10597039 3300031731 Unclassified 900
273 Ga0307405_11167532 3300031731 Bacteria 664
274 Ga0307413_10114249 3300031824 Bacteria 1814
275 Ga0307413_10224164 3300031824 Bacteria 1375
276 Ga0307410_10031710 3300031852 Unclassified 3395
277 Ga0307410_10766174 3300031852 Unclassified 818
278 Ga0307406_10045565 3300031901 Bacteria 2754
279 Ga0307406_10136864 3300031901 Bacteria 1728
280 Ga0307406_10372373 3300031901 Bacteria 1123
281 Ga0307407_10131143 3300031903 Bacteria 1604
282 Ga0307407_10161085 3300031903 Bacteria 1468
283 Ga0307407_10376819 3300031903 Unclassified 1012
284 Ga0307412_10054881 3300031911 Bacteria 2647
285 Ga0307412_10086717 3300031911 Bacteria 2179
286 Ga0307412_10089433 3300031911 Bacteria 2150
287 Ga0307412_10538332 3300031911 Bacteria 979
288 Ga0307409_100006227 3300031995 Bacteria 6986
289 Ga0307409_100425690 3300031995 Bacteria 1275
290 Ga0307409_100602729 3300031995 Bacteria 1086
291 Ga0307416_100069689 3300032002 Unclassified 2911
292 Ga0307416_100096635 3300032002 Bacteria 2555
293 Ga0307416_100136501 3300032002 Bacteria 2220
294 Ga0307416_100192014 3300032002 Bacteria 1927
295 Ga0307416_100224736 3300032002 Unclassified 1804
296 Ga0307416_100288396 3300032002 Bacteria 1623
297 Ga0307416_100445421 3300032002 Bacteria 1346
298 Ga0307414_10061956 3300032004 Bacteria 2652
299 Ga0307414_10566581 3300032004 Bacteria 1014
300 Ga0307411_10064822 3300032005 Bacteria 2447
301 Ga0307411_10083451 3300032005 Unclassified 2207
302 Ga0307411_10171361 3300032005 Unclassified 1637
303 Ga0307411_11048354 3300032005 Bacteria 732
304 Ga0307415_100206477 3300032126 Bacteria 1563
305 Ga0307415_100656567 3300032126 Unclassified 941
306 Ga0373923_0094572 3300035111 Bacteria 1311
307 Ga0373935_0067424 3300035692 Bacteria 2301
308 Ga0373925_1225186 3300037068 Bacteria 616
309 Ga0439453_0062834 3300041408 Unclassified 772
310 Ga0451807_0341067 3300041486 Bacteria 1082
311 Ga0451853_0324696 3300041512 Bacteria 1448
312 Ga0439433_0004627 3300041999 Bacteria 2956
313 Ga0439441_043418 3300042001 Bacteria 907
314 Ga0450920_043550 3300042122 Bacteria 897
315 Ga0450891_005769 3300042129 Bacteria 1143
316 Ga0439446_0122638 3300042156 Bacteria 838
317 Ga0439435_0027468 3300042436 Bacteria 1523
318 Ga0439464_0022432 3300042439 Bacteria 1739
319 Ga0439464_0037930 3300042439 Bacteria 1368
320 Ga0439460_0084198 3300042461 Bacteria 1002
321 Ga0439460_0173615 3300042461 Unclassified 726
322 Ga0453683_0247131 3300044673 Bacteria 1137
323 Ga0451576_0008147 3300045051 Bacteria 12340
324 Ga0466967_0151201 3300045976 Bacteria 2170
325 Ga0495629_0364776 3300046459 Bacteria 984
326 Ga0495585_0116924 3300046492 Unclassified 1414
327 Ga0495594_0064202 3300046499 Bacteria 2035
328 Ga0495644_0029240 3300046523 Unclassified 2083
329 Ga0495642_0189132 3300046528 Bacteria 897
330 Ga0495665_0400847 3300046531 Bacteria 696
331 Ga0495621_0015923 3300046539 Unclassified 2405
332 Ga0495621_0059710 3300046539 Unclassified 1382
333 Ga0495633_0039551 3300046558 Bacteria 2251
334 Ga0495659_0003430 3300046664 Bacteria 5062
335 Ga0495658_0182969 3300046683 Bacteria 1301
336 Ga0495669_0000990 3300046684 Bacteria 11874
337 Ga0495669_0158957 3300046684 Unclassified 1072
338 Ga0495613_0282292 3300046689 Bacteria 1153
339 Ga0495670_0008616 3300046691 Bacteria 5021
340 Ga0495670_0292844 3300046691 Bacteria 872
341 Ga0495636_0029398 3300047318 Bacteria 2243
342 Ga0495674_0170001 3300047319 Bacteria 1819
343 Ga0495680_0312139 3300047322 Bacteria 1102
344 Ga0496102_0017111 3300048905 Bacteria 6347
345 Ga0496102_1356681 3300048905 Unclassified 630
346 Ga0496103_0133504 3300048906 Bacteria 1586
347 Ga0496103_0440924 3300048906 Bacteria 835
348 Ga0496106_0014771 3300048909 Bacteria 5774
349 Ga0496106_0261421 3300048909 Bacteria 1385
350 Ga0496106_0890727 3300048909 Bacteria 703
351 Ga0496107_0082851 3300048910 Bacteria 2339
352 Ga0496108_0306231 3300048911 Bacteria 1384
353 Ga0496109_0377424 3300048912 Bacteria 1339
354 Ga0496109_0617238 3300048912 Bacteria 1021
355 Ga0496110_0032779 3300048913 Bacteria 4491
356 Ga0496111_0323561 3300048914 Bacteria 1142
357 Ga0496112_0027070 3300048915 Bacteria 5527
358 Ga0496112_0774751 3300048915 Bacteria 885
359 Ga0501296_033193 3300049519 Bacteria 703
360 Ga0501031_0179545 3300049568 Bacteria 1383
361 Ga0501031_0378316 3300049568 Bacteria 916
362 Ga0501033_0289328 3300049570 Unclassified 1155
363 Ga0501034_0002491 3300049571 Bacteria 22102
364 Ga0501036_0089177 3300049572 Bacteria 2606
365 Ga0501036_0230193 3300049572 Bacteria 1555
366 Ga0501036_0455073 3300049572 Unclassified 1066
367 Ga0501036_0653089 3300049572 Bacteria 871
368 Ga0501039_0036698 3300049575 Bacteria 3783
369 Ga0501039_0397505 3300049575 Unclassified 1082
370 Ga0501040_0818756 3300049576 Bacteria 674
371 Ga0501041_0190221 3300049577 Bacteria 1286
372 Ga0501041_0237767 3300049577 Unclassified 1144
373 Ga0501041_0778639 3300049577 Bacteria 613
374 Ga0501042_0206259 3300049578 Unclassified 1417
375 Ga0501042_0214625 3300049578 Bacteria 1388
376 Ga0501042_0218627 3300049578 Bacteria 1374
377 Ga0501042_0221743 3300049578 Bacteria 1364
378 Ga0501042_0336000 3300049578 Bacteria 1092
379 Ga0501043_0374174 3300049579 Bacteria 1079
380 Ga0501043_0811653 3300049579 Unclassified 676
381 Ga0501046_0019510 3300049580 Bacteria 5623
382 Ga0501047_0430550 3300049581 Bacteria 1150
383 Ga0501048_0098061 3300049582 Bacteria 2068
384 Ga0501048_0194905 3300049582 Bacteria 1436
385 Ga0501067_0461133 3300049583 Bacteria 710
386 Ga0501069_0020611 3300049585 Bacteria 3573
387 Ga0501071_0339389 3300049587 Bacteria 1142
388 Ga0501071_0384044 3300049587 Bacteria 1071
389 Ga0501071_0762787 3300049587 Unclassified 745
390 Ga0501072_0012860 3300049588 Bacteria 6402
391 Ga0501072_0024325 3300049588 Bacteria 4711
392 Ga0501072_0073892 3300049588 Bacteria 2695
393 Ga0501072_0423477 3300049588 Bacteria 1055
394 Ga0501073_0242400 3300049589 Bacteria 1245
395 Ga0501073_0314399 3300049589 Bacteria 1081
396 Ga0501074_0181734 3300049590 Bacteria 1500
397 Ga0501074_0306437 3300049590 Unclassified 1128
398 Ga0501074_0337802 3300049590 Bacteria 1069
399 Ga0501075_0003417 3300049591 Bacteria 10622
400 Ga0501075_0195271 3300049591 Bacteria 1543
401 Ga0501076_0031385 3300049592 Bacteria 4143
402 Ga0501076_0105063 3300049592 Bacteria 2279
403 Ga0501076_0214809 3300049592 Bacteria 1572
404 Ga0501076_0244918 3300049592 Bacteria 1467
405 Ga0501076_0257486 3300049592 Bacteria 1428
406 Ga0501076_0264191 3300049592 Bacteria 1409
407 Ga0501076_0291875 3300049592 Bacteria 1336
408 Ga0501076_0602726 3300049592 Bacteria 906
409 Ga0501076_0826753 3300049592 Bacteria 764
410 Ga0501260_006567 3300049689 Unclassified 1120
411 Ga0501225_0196817 3300049705 Bacteria 638
412 Ga0501079_0007892 3300049741 Bacteria 8066
413 Ga0501079_0129693 3300049741 Bacteria 1962
414 Ga0501079_0235141 3300049741 Bacteria 1432
415 Ga0501079_0480885 3300049741 Bacteria 976
416 Ga0501079_0584110 3300049741 Bacteria 879
417 Ga0501080_0132063 3300049742 Bacteria 2312
418 Ga0501080_0236649 3300049742 Bacteria 1668
419 Ga0501081_0146642 3300049743 Bacteria 1694
420 Ga0501081_0267108 3300049743 Unclassified 1251
421 Ga0501081_0329465 3300049743 Bacteria 1123
422 Ga0501081_0869308 3300049743 Bacteria 679
423 Ga0501083_0371370 3300049744 Bacteria 930
424 Ga0501045_0011015 3300049824 Bacteria 6338
425 Ga0501045_0113140 3300049824 Bacteria 2013
426 Ga0501045_0792681 3300049824 Unclassified 698
427 nmdc:mga03683_600_c1 3300050489 Bacteria 2291
428 nmdc:mga00v17_18443_c1 3300050491 Bacteria 3964
429 nmdc:mga00v17_42920_c1 3300050491 Bacteria 2721
430 nmdc:mga00v17_56751_c1 3300050491 Bacteria 2395
431 nmdc:mga0yw44_62653_c1 3300050492 Bacteria 2285
432 nmdc:mga0k408_28696_c1 3300050493 Bacteria 3164
433 nmdc:mga0k408_4679_c1 3300050493 Bacteria 7252
434 nmdc:mga0k408_60361_c1 3300050493 Bacteria 2203
435 nmdc:mga04h51_301800_c1 3300050495 Bacteria 653
436 nmdc:mga04h51_44577_c1 3300050495 Bacteria 1463
437 nmdc:mga05p37_123839_c1 3300050507 Bacteria 3176
438 nmdc:mga05p37_1796_c1 3300050507 Bacteria 25058
439 nmdc:mga05p37_2944_c1 3300050507 Bacteria 19766
440 nmdc:mga05p37_471750_c1 3300050507 Bacteria 1448
441 nmdc:mga05p37_71260_c1 3300050507 Bacteria 4275
442 nmdc:mga05p37_9122_c1 3300050507 Bacteria 11723
443 nmdc:mga09592_110756_c1 3300050508 Bacteria 2355
444 nmdc:mga09592_3401_c1 3300050508 Bacteria 12863
445 nmdc:mga09592_4431_c1 3300050508 Bacteria 11368
446 nmdc:mga09592_525156_c1 3300050508 Bacteria 1018
447 nmdc:mga0qj67_21504_c1 3300050509 Bacteria 4949
448 nmdc:mga0qj67_4824_c1 3300050509 Bacteria 9800
449 nmdc:mga0qj67_68737_c1 3300050509 Bacteria 2824
450 nmdc:mga0qj67_75091_c1 3300050509 Bacteria 2701
451 nmdc:mga0qj67_79503_c1 3300050509 Bacteria 2626
452 nmdc:mga06r32_106517_c1 3300050510 Bacteria 2754
453 nmdc:mga06r32_18851_c1 3300050510 Bacteria 6325
454 nmdc:mga06r32_242086_c1 3300050510 Bacteria 1791
455 nmdc:mga06r32_255685_c1 3300050510 Bacteria 1739
456 nmdc:mga06r32_458724_c1 3300050510 Bacteria 1254
457 nmdc:mga08y16_13896_c1 3300050511 Bacteria 8472
458 nmdc:mga08y16_1408480_c1 3300050511 Bacteria 660
459 nmdc:mga08y16_1673_c1 3300050511 Bacteria 22480
460 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
461 nmdc:mga08y16_3637_c1 3300050511 Bacteria 16019
462 nmdc:mga08y16_384588_c1 3300050511 Bacteria 1438
463 nmdc:mga08y16_69726_c1 3300050511 Bacteria 3665
464 nmdc:mga08y16_811665_c1 3300050511 Bacteria 928
465 nmdc:mga0n895_240730_c1 3300050512 Bacteria 1836
466 nmdc:mga0n895_477825_c1 3300050512 Bacteria 1257
467 nmdc:mga0rr50_33587_c1 3300050513 Bacteria 3666
468 nmdc:mga0rr50_898571_c1 3300050513 Bacteria 755
469 nmdc:mga0a205_66264_c1 3300050515 Bacteria 3489
470 nmdc:mga0a205_9299_c1 3300050515 Bacteria 8975
471 Ga0495595_0160245 3300053084 Bacteria 1110
472 Ga0495619_0273045 3300053085 Bacteria 1171
473 Ga0500628_013420 3300053129 Bacteria 1529
474 Ga0500616_0056071 3300053153 Unclassified 2058
475 Ga0501084_0112345 3300054114 Unclassified 2289
476 Ga0501084_0188429 3300054114 Bacteria 1741
477 Ga0501084_0223276 3300054114 Bacteria 1590
478 Ga0501084_0258119 3300054114 Bacteria 1471
479 Ga0501082_0013241 3300060353 Bacteria 7093
480 Ga0501082_0047166 3300060353 Bacteria 3713
481 Ga0501082_0131393 3300060353 Bacteria 2173
482 Ga0501082_0312857 3300060353 Bacteria 1368
483 Ga0530510_0017737 3300061734 Bacteria 5045
484 Ga0530510_0100293 3300061734 Bacteria 2117
485 Ga0530510_0360408 3300061734 Unclassified 1093
486 Ga0075364_10333177
487 MBSR1b_contig_12996511
488 Ga0065715_10099099
489 Ga0065707_10082648
490 Ga0070676_10106521
491 Ga0070676_10320359
492 Ga0070683_100061640
493 Ga0070690_100045308
494 Ga0070690_100283764
495 Ga0070690_100747863
496 Ga0070670_100007430
497 Ga0070670_100022662
498 Ga0070670_100205301
499 Ga0070670_100467357
500 Ga0070677_10039618
501 Ga0068869_100193148
502 Ga0068869_100419670
503 Ga0070666_10021685
504 Ga0070680_100225276
505 Ga0068868_100065532
506 Ga0068868_100251986
507 Ga0068868_100845432
508 Ga0070660_100542055
509 Ga0070689_100009263
510 Ga0070689_100145670
511 Ga0070689_100407608
512 Ga0070691_10010724
513 Ga0070687_100013992
514 Ga0070661_100488172
515 Ga0070692_10508299
516 Ga0070668_100139151
517 Ga0070669_100001115
518 Ga0070669_100062158
519 Ga0070669_100143193
520 Ga0070675_100155574
521 Ga0070675_100264129
522 Ga0070675_100714147
523 Ga0070675_100733341
524 Ga0070671_100065235
525 Ga0070674_100080260
526 Ga0070674_100250383
527 Ga0070674_100263085
528 Ga0070674_100365281
529 Ga0070674_100709404
530 Ga0070673_100008351
531 Ga0070673_100050789
532 Ga0070673_100132402
533 Ga0070673_100844766
534 Ga0070673_101213243
535 Ga0070688_100027307
536 Ga0070688_100475928
537 Ga0070659_100102272
538 Ga0070667_100456351
539 Ga0070667_100548053
540 Ga0070701_10030801
541 Ga0070705_100232899
542 Ga0070700_100008251
543 Ga0070700_100081008
544 Ga0070700_100166144
545 Ga0070663_100243712
546 Ga0070663_100264563
547 Ga0070678_100145633
548 Ga0070678_100808211
549 Ga0070662_100234469
550 Ga0070662_100314682
551 Ga0068867_100001573
552 Ga0068867_100030580
553 Ga0068867_100525843
554 Ga0070685_10286269
555 Ga0070707_101453995
556 Ga0070698_100213904
557 Ga0070698_100257889
558 Ga0070699_100762859
559 Ga0070684_100009549
560 Ga0070672_100051729
561 Ga0070672_100064563
562 Ga0070672_100339273
563 Ga0070686_100085747
564 Ga0070686_100127635
565 Ga0070695_100197086
566 Ga0070665_100771593
567 Ga0070704_100138338
568 Ga0070664_100071789
569 Ga0070664_100126015
570 Ga0070664_100330316
571 Ga0068854_100094578
572 Ga0068854_100338133
573 Ga0068856_100145802
574 Ga0070702_100033883
575 Ga0068852_100206749
576 Ga0068859_100006126
577 Ga0068859_100216288
578 Ga0068859_100330614
579 Ga0068859_100841566
580 Ga0068864_100037607
581 Ga0068866_10064071
582 Ga0068861_100133758
583 Ga0068870_10011628
584 Ga0068863_100199355
585 Ga0068858_100097256
586 Ga0068858_100110637
587 Ga0068858_100383403
588 Ga0068860_100151199
589 Ga0068862_100003823
590 Ga0068862_100149987
591 Ga0068862_100448256
592 Ga0068862_101189242
593 Ga0075365_10043769
594 Ga0075368_10003488
595 Ga0075368_10007139
596 Ga0075368_10257842
597 Ga0075364_10045719
598 Ga0075364_10156626
599 Ga0075362_10000421
600 Ga0075367_10003356
601 Ga0075367_10003691
602 Ga0075366_10027854
603 Ga0075366_10043142
604 Ga0075366_10088303
605 Ga0097621_100651846
606 Ga0075370_10007617
607 Ga0075428_100031530
608 Ga0075428_100114237
609 Ga0075428_100272037
610 Ga0075428_100515683
611 Ga0075430_100010520
612 Ga0075430_100086195
613 Ga0075431_100017370
614 Ga0075434_100162111
615 Ga0075434_100360829
616 Ga0075434_100512542
617 Ga0075429_100000156
618 Ga0075429_100012854
619 Ga0068865_100229876
620 Ga0097620_100006127
621 Ga0097620_100216312
622 Ga0097620_100330628
623 Ga0097620_100841665
624 Ga0075435_100131733
625 Ga0111539_10000209
626 Ga0111539_10000574
627 Ga0111539_10009255
628 Ga0111539_10009783
629 Ga0111539_10034973
630 Ga0111539_10321699
631 Ga0111539_10427503
632 Ga0111539_10503082
633 Ga0105245_10029640
634 Ga0105247_10068463
635 Ga0114129_10000077
636 Ga0114129_10016371
637 Ga0114129_10046823
638 Ga0114129_10242317
639 Ga0105243_10038428
640 Ga0105243_10070430
641 Ga0105242_10046119
642 Ga0105242_11516010
643 Ga0105248_10041545
644 Ga0105248_10751312
645 Ga0105249_10001092
646 Ga0105249_10006855
647 Ga0105249_10064040
648 Ga0105249_10172157
649 Ga0105239_10447077
650 Ga0105246_10487894
651 Ga0163162_10239865
652 Ga0163162_10350538
653 Ga0157372_10572362
654 Ga0157375_10019382
655 Ga0163163_10002902
656 Ga0163163_10108804
657 Ga0163163_10820675
658 Ga0157380_10018497
659 Ga0157380_10304238
660 Ga0157380_10491828
661 Ga0157377_10099941
662 Ga0157379_10020372
663 Ga0157379_10754920
664 Ga0157376_10444781
665 Ga0207697_10154778
666 Ga0207682_10024849
667 Ga0207642_10127177
668 Ga0207710_10472521
669 Ga0207688_10018820
670 Ga0207645_10008760
671 Ga0207645_10250787
672 Ga0207643_10015810
673 Ga0207707_10430943
674 Ga0207660_10319445
675 Ga0207662_10009398
676 Ga0207657_10304395
677 Ga0207657_10622806
678 Ga0207649_10076853
679 Ga0207649_10666893
680 Ga0207681_10048956
681 Ga0207681_10096690
682 Ga0207650_10007401
683 Ga0207650_10014390
684 Ga0207650_10161567
685 Ga0207659_10190964
686 Ga0207659_10205209
687 Ga0207659_10549935
688 Ga0207690_10130657
689 Ga0207690_10133759
690 Ga0207706_10178893
691 Ga0207706_10180130
692 Ga0207706_10253182
693 Ga0207686_10114187
694 Ga0207670_10030155
695 Ga0207670_10062032
696 Ga0207670_10072368
697 Ga0207669_10053531
698 Ga0207669_10850343
699 Ga0207691_10010231
700 Ga0207691_10049610
701 Ga0207691_10092611
702 Ga0207691_10181334
703 Ga0207691_10377706
704 Ga0207691_10648166
705 Ga0207711_10025890
706 Ga0207711_10089032
707 Ga0207689_10041392
708 Ga0207689_10175324
709 Ga0207661_10060032
710 Ga0207679_10138152
711 Ga0207679_10810514
712 Ga0207651_10292455
713 Ga0207712_10043937
714 Ga0207712_10216154
715 Ga0207712_10369446
716 Ga0207703_10096859
717 Ga0207703_10622578
718 Ga0207703_10759195
719 Ga0207678_10073992
720 Ga0207678_10301341
721 Ga0207708_10035891
722 Ga0207702_10150729
723 Ga0207641_10050860
724 Ga0207641_10379180
725 Ga0207648_10000280
726 Ga0207648_10003483
727 Ga0207648_10098591
728 Ga0207648_10389661
729 Ga0207676_10012689
730 Ga0207674_10064065
731 Ga0207675_100007184
732 Ga0207675_100129536
733 Ga0207675_100462870
734 Ga0207675_100915390
735 Ga0207683_10160063
736 Ga0207683_10178240
737 Ga0207683_10226759
738 Ga0209813_10005965
739 Ga0207428_10000022
740 Ga0207428_10000135
741 Ga0207428_10000558
742 Ga0207428_10020513
743 Ga0207428_10029012
744 Ga0207428_10539966
745 Ga0268265_10199895
746 Ga0268265_10298522
747 Ga0268265_10758497
748 Ga0268265_11076037
749 Ga0268264_10164744
750 Ga0268264_10166498
751 Ga0268264_10205986
752 Ga0307408_100013541
753 Ga0307408_100015172
754 Ga0307408_100015321
755 Ga0307408_100164774
756 Ga0307405_10046446
757 Ga0307405_10597039
758 Ga0307405_11167532
759 Ga0307413_10114249
760 Ga0307413_10224164
761 Ga0307410_10031710
762 Ga0307410_10766174
763 Ga0307406_10045565
764 Ga0307406_10136864
765 Ga0307406_10372373
766 Ga0307407_10131143
767 Ga0307407_10161085
768 Ga0307407_10376819
769 Ga0307412_10054881
770 Ga0307412_10086717
771 Ga0307412_10089433
772 Ga0307412_10538332
773 Ga0307409_100006227
774 Ga0307409_100425690
775 Ga0307409_100602729
776 Ga0307416_100069689
777 Ga0307416_100096635
778 Ga0307416_100136501
779 Ga0307416_100192014
780 Ga0307416_100224736
781 Ga0307416_100288396
782 Ga0307416_100445421
783 Ga0307414_10061956
784 Ga0307414_10566581
785 Ga0307411_10064822
786 Ga0307411_10083451
787 Ga0307411_10171361
788 Ga0307411_11048354
789 Ga0307415_100206477
790 Ga0307415_100656567
791 Ga0373923_0094572
792 Ga0373935_0067424
793 Ga0373925_1225186
794 Ga0439453_0062834
795 Ga0451807_0341067
796 Ga0451853_0324696
797 Ga0439433_0004627
798 Ga0439441_043418
799 Ga0450920_043550
800 Ga0450891_005769
801 Ga0439446_0122638
802 Ga0439435_0027468
803 Ga0439464_0022432
804 Ga0439464_0037930
805 Ga0439460_0084198
806 Ga0439460_0173615
807 Ga0453683_0247131
808 Ga0451576_0008147
809 Ga0466967_0151201
810 Ga0495629_0364776
811 Ga0495585_0116924
812 Ga0495594_0064202
813 Ga0495644_0029240
814 Ga0495642_0189132
815 Ga0495665_0400847
816 Ga0495621_0015923
817 Ga0495621_0059710
818 Ga0495633_0039551
819 Ga0495659_0003430
820 Ga0495658_0182969
821 Ga0495669_0000990
822 Ga0495669_0158957
823 Ga0495613_0282292
824 Ga0495670_0008616
825 Ga0495670_0292844
826 Ga0495636_0029398
827 Ga0495674_0170001
828 Ga0495680_0312139
829 Ga0496102_0017111
830 Ga0496102_1356681
831 Ga0496103_0133504
832 Ga0496103_0440924
833 Ga0496106_0014771
834 Ga0496106_0261421
835 Ga0496106_0890727
836 Ga0496107_0082851
837 Ga0496108_0306231
838 Ga0496109_0377424
839 Ga0496109_0617238
840 Ga0496110_0032779
841 Ga0496111_0323561
842 Ga0496112_0027070
843 Ga0496112_0774751
844 Ga0501296_033193
845 Ga0501031_0179545
846 Ga0501031_0378316
847 Ga0501033_0289328
848 Ga0501034_0002491
849 Ga0501036_0089177
850 Ga0501036_0230193
851 Ga0501036_0455073
852 Ga0501036_0653089
853 Ga0501039_0036698
854 Ga0501039_0397505
855 Ga0501040_0818756
856 Ga0501041_0190221
857 Ga0501041_0237767
858 Ga0501041_0778639
859 Ga0501042_0206259
860 Ga0501042_0214625
861 Ga0501042_0218627
862 Ga0501042_0221743
863 Ga0501042_0336000
864 Ga0501043_0374174
865 Ga0501043_0811653
866 Ga0501046_0019510
867 Ga0501047_0430550
868 Ga0501048_0098061
869 Ga0501048_0194905
870 Ga0501067_0461133
871 Ga0501069_0020611
872 Ga0501071_0339389
873 Ga0501071_0384044
874 Ga0501071_0762787
875 Ga0501072_0012860
876 Ga0501072_0024325
877 Ga0501072_0073892
878 Ga0501072_0423477
879 Ga0501073_0242400
880 Ga0501073_0314399
881 Ga0501074_0181734
882 Ga0501074_0306437
883 Ga0501074_0337802
884 Ga0501075_0003417
885 Ga0501075_0195271
886 Ga0501076_0031385
887 Ga0501076_0105063
888 Ga0501076_0214809
889 Ga0501076_0244918
890 Ga0501076_0257486
891 Ga0501076_0264191
892 Ga0501076_0291875
893 Ga0501076_0602726
894 Ga0501076_0826753
895 Ga0501260_006567
896 Ga0501225_0196817
897 Ga0501079_0007892
898 Ga0501079_0129693
899 Ga0501079_0235141
900 Ga0501079_0480885
901 Ga0501079_0584110
902 Ga0501080_0132063
903 Ga0501080_0236649
904 Ga0501081_0146642
905 Ga0501081_0267108
906 Ga0501081_0329465
907 Ga0501081_0869308
908 Ga0501083_0371370
909 Ga0501045_0011015
910 Ga0501045_0113140
911 Ga0501045_0792681
912 nmdc:mga03683_600_c1
913 nmdc:mga00v17_18443_c1
914 nmdc:mga00v17_42920_c1
915 nmdc:mga00v17_56751_c1
916 nmdc:mga0yw44_62653_c1
917 nmdc:mga0k408_28696_c1
918 nmdc:mga0k408_4679_c1
919 nmdc:mga0k408_60361_c1
920 nmdc:mga04h51_301800_c1
921 nmdc:mga04h51_44577_c1
922 nmdc:mga05p37_123839_c1
923 nmdc:mga05p37_1796_c1
924 nmdc:mga05p37_2944_c1
925 nmdc:mga05p37_471750_c1
926 nmdc:mga05p37_71260_c1
927 nmdc:mga05p37_9122_c1
928 nmdc:mga09592_110756_c1
929 nmdc:mga09592_3401_c1
930 nmdc:mga09592_4431_c1
931 nmdc:mga09592_525156_c1
932 nmdc:mga0qj67_21504_c1
933 nmdc:mga0qj67_4824_c1
934 nmdc:mga0qj67_68737_c1
935 nmdc:mga0qj67_75091_c1
936 nmdc:mga0qj67_79503_c1
937 nmdc:mga06r32_106517_c1
938 nmdc:mga06r32_18851_c1
939 nmdc:mga06r32_242086_c1
940 nmdc:mga06r32_255685_c1
941 nmdc:mga06r32_458724_c1
942 nmdc:mga08y16_13896_c1
943 nmdc:mga08y16_1408480_c1
944 nmdc:mga08y16_1673_c1
945 nmdc:mga08y16_21_c1
946 nmdc:mga08y16_3637_c1
947 nmdc:mga08y16_384588_c1
948 nmdc:mga08y16_69726_c1
949 nmdc:mga08y16_811665_c1
950 nmdc:mga0n895_240730_c1
951 nmdc:mga0n895_477825_c1
952 nmdc:mga0rr50_33587_c1
953 nmdc:mga0rr50_898571_c1
954 nmdc:mga0a205_66264_c1
955 nmdc:mga0a205_9299_c1
956 Ga0495595_0160245
957 Ga0495619_0273045
958 Ga0500628_013420
959 Ga0500616_0056071
960 Ga0501084_0112345
961 Ga0501084_0188429
962 Ga0501084_0223276
963 Ga0501084_0258119
964 Ga0501082_0013241
965 Ga0501082_0047166
966 Ga0501082_0131393
967 Ga0501082_0312857
968 Ga0530510_0017737
969 Ga0530510_0100293
970 Ga0530510_0360408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01923

Cob_adeno_trans

Cobalamin adenosyltransferase

36

205

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.9528 25 177
7ruu-assembly2.cif.gz_D structure of human atp:cobalamin adenosyltransferase r190c bound to adenosylcobalamin 0.9492 24 179
5im6-assembly1.cif.gz_A crystal structure of designed two-component self-assembling icosahedral cage i32-28 0.9415 22 179
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.9403 25 177
2idx-assembly1.cif.gz_A structure of human atp:cobalamin adenosyltransferase bound to atp. 0.9343 24 179
ID Description Score Start End Superfamily
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9549 13 179 1.20.1200.10
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9378 13 179 1.20.1200.10
1rtyC00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9361 26 179 1.20.1200.10
2idxA00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9343 24 179 1.20.1200.10
2ah6A00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9312 25 179 1.20.1200.10
ID Description Score Start End GO Terms
AF-A0A3N5NS88-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9811 94 179 GO:0005524
GO:0008817
GO:0009236
AF-A0A2V8FSL7-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9738 1 133 GO:0005524
GO:0008817
GO:0009236
AF-A0A3D4FZY9-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9684 1 179 GO:0005524
GO:0008817
GO:0009236
AF-A0A2V8FSL7-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9666 1 133 GO:0005524
GO:0008817
GO:0009236
AF-A0A661Z9Q5-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9656 86 179 GO:0005524
GO:0008817
GO:0009236

Map