F453042

General Info

Members Datasets Scaffolds Average Seq Length
485 228 970 234

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10010853|Ga0065704_100108532
Length 257
Sequence MKLRMIDFRSENPSSCTIMAGNSSKAPTDSLTVSWSDTVRFVRQLSHDLRNDLNAIELQSAYIGELTQDHELTNEIKRLREVVSGLNSSLQLISRAVGEITPNLVTYPAGEFLTDMRTQIERNFSKENNEITWDVQLQDGMLNIDPQLFQEVFVELFANAFQHDRGNGALVARARISXGRFLFSLHEPKAVFSXGTQNWGREPLRNIRQRHYGLGLNRVRAIIEAHGGELQAQYDPKAVTLVSTVTLPVSSRHSEHG

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
174 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.63
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 22.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10010853 3300005289 Bacteria 2801
2 JGI24746J21847_1006461 3300001977 Bacteria 1816
3 JGI24743J22301_10018472 3300001991 Unclassified 1318
4 JGI24035J26624_1000556 3300002126 Bacteria 3469
5 JGI24035J26624_1001447 3300002126 Bacteria 2243
6 JGI25404J52841_10012033 3300003659 Unclassified 1870
7 JGI25405J52794_10001275 3300003911 Bacteria 4092
8 Ga0065704_10004120 3300005289 Bacteria 4493
9 Ga0065704_10015689 3300005289 Unclassified 1673
10 Ga0065704_10022150 3300005289 Unclassified 1769
11 Ga0065704_10127197 3300005289 Bacteria 1679
12 Ga0065712_10001047 3300005290 Bacteria 17757
13 Ga0065712_10005119 3300005290 Bacteria 4323
14 Ga0065712_10013694 3300005290 Bacteria 2560
15 Ga0065712_10081057 3300005290 Bacteria 3043
16 Ga0065712_10107227 3300005290 Unclassified 1900
17 Ga0065712_10122367 3300005290 Unclassified 1652
18 Ga0065712_10127551 3300005290 Bacteria 1589
19 Ga0065715_10000543 3300005293 Bacteria 12759
20 Ga0065715_10000675 3300005293 Bacteria 11953
21 Ga0065715_10002721 3300005293 Bacteria 4861
22 Ga0065715_10006928 3300005293 Bacteria 2774
23 Ga0065715_10026713 3300005293 Bacteria 1493
24 Ga0065715_10117804 3300005293 Bacteria 2335
25 Ga0065715_10198296 3300005293 Bacteria 1375
26 Ga0065707_10003153 3300005295 Bacteria 6511
27 Ga0065707_10005460 3300005295 Bacteria 3116
28 Ga0065707_10021274 3300005295 Unclassified 1562
29 Ga0065707_10037064 3300005295 Unclassified 1279
30 Ga0065707_10116079 3300005295 Bacteria 2248
31 Ga0065707_10459160 3300005295 Unclassified 793
32 Ga0070658_10374137 3300005327 Unclassified 1221
33 Ga0070676_10044993 3300005328 Bacteria 2570
34 Ga0070676_10104065 3300005328 Bacteria 1758
35 Ga0070683_100027311 3300005329 Bacteria 5146
36 Ga0070683_100200108 3300005329 Bacteria 1897
37 Ga0070690_100021095 3300005330 Bacteria 3974
38 Ga0070690_100061274 3300005330 Bacteria 2423
39 Ga0070677_10035923 3300005333 Bacteria 1924
40 Ga0068869_100379984 3300005334 Unclassified 1157
41 Ga0070666_10112464 3300005335 Bacteria 1883
42 Ga0070666_10381543 3300005335 Unclassified 1012
43 Ga0070680_100039006 3300005336 Bacteria 3843
44 Ga0070682_100794716 3300005337 Bacteria 768
45 Ga0068868_100029767 3300005338 Bacteria 4183
46 Ga0068868_100036715 3300005338 Bacteria 3795
47 Ga0068868_100295945 3300005338 Bacteria 1374
48 Ga0070660_100035106 3300005339 Bacteria 3794
49 Ga0070660_100250655 3300005339 Unclassified 1444
50 Ga0070660_100301488 3300005339 Unclassified 1314
51 Ga0070689_100002035 3300005340 Bacteria 13117
52 Ga0070689_100008576 3300005340 Bacteria 7204
53 Ga0070689_100021285 3300005340 Bacteria 4825
54 Ga0070689_100192328 3300005340 Bacteria 1662
55 Ga0070687_100000405 3300005343 Bacteria 14536
56 Ga0070661_100020982 3300005344 Bacteria 4663
57 Ga0070668_100002347 3300005347 Bacteria 13915
58 Ga0070668_100025950 3300005347 Bacteria 4443
59 Ga0070668_100122864 3300005347 Bacteria 2077
60 Ga0070669_100009019 3300005353 Bacteria 7113
61 Ga0070669_100049209 3300005353 Bacteria 3077
62 Ga0070675_100009524 3300005354 Bacteria 7560
63 Ga0070675_100026959 3300005354 Bacteria 4613
64 Ga0070675_100038405 3300005354 Bacteria 3902
65 Ga0070675_100092040 3300005354 Bacteria 2541
66 Ga0070675_100098313 3300005354 Bacteria 2462
67 Ga0070675_100199228 3300005354 Bacteria 1737
68 Ga0070675_100214979 3300005354 Bacteria 1673
69 Ga0070671_100069215 3300005355 Bacteria 2943
70 Ga0070671_100130041 3300005355 Bacteria 2121
71 Ga0070671_100390803 3300005355 Bacteria 1189
72 Ga0070674_100131331 3300005356 Bacteria 1867
73 Ga0070673_100022752 3300005364 Bacteria 4567
74 Ga0070673_100090958 3300005364 Bacteria 2494
75 Ga0070673_100931354 3300005364 Bacteria 807
76 Ga0070688_100015877 3300005365 Bacteria 4293
77 Ga0070688_100022202 3300005365 Bacteria 3714
78 Ga0070688_100209871 3300005365 Unclassified 1367
79 Ga0070659_100023006 3300005366 Bacteria 4765
80 Ga0070659_100045385 3300005366 Bacteria 3442
81 Ga0070667_100012477 3300005367 Bacteria 7031
82 Ga0070709_10016438 3300005434 Bacteria 4224
83 Ga0070709_10065478 3300005434 Bacteria 2327
84 Ga0070714_100103023 3300005435 Bacteria 2517
85 Ga0070714_100143395 3300005435 Bacteria 2146
86 Ga0070713_100030688 3300005436 Unclassified 4271
87 Ga0070713_100033877 3300005436 Bacteria 4096
88 Ga0070713_100159721 3300005436 Unclassified 2011
89 Ga0070713_100381442 3300005436 Bacteria 1313
90 Ga0070710_10432366 3300005437 Unclassified 888
91 Ga0070711_100022973 3300005439 Bacteria 4049
92 Ga0070711_100085169 3300005439 Unclassified 2263
93 Ga0070705_100016730 3300005440 Bacteria 3816
94 Ga0070705_100236102 3300005440 Bacteria 1275
95 Ga0070700_100174925 3300005441 Bacteria 1489
96 Ga0070708_100040747 3300005445 Bacteria 4069
97 Ga0070708_100047145 3300005445 Unclassified 3806
98 Ga0070708_100091076 3300005445 Bacteria 2777
99 Ga0070708_100146889 3300005445 Bacteria 2191
100 Ga0070678_100021938 3300005456 Bacteria 4221
101 Ga0070678_100032408 3300005456 Bacteria 3617
102 Ga0070678_100040876 3300005456 Bacteria 3284
103 Ga0070662_100003163 3300005457 Bacteria 10232
104 Ga0070662_100555210 3300005457 Bacteria 963
105 Ga0070681_10021284 3300005458 Bacteria 6499
106 Ga0068867_100035626 3300005459 Bacteria 3611
107 Ga0070685_10013472 3300005466 Bacteria 4313
108 Ga0070685_10019421 3300005466 Bacteria 3665
109 Ga0070706_100001536 3300005467 Bacteria 24129
110 Ga0070706_100014482 3300005467 Bacteria 7285
111 Ga0070706_100049562 3300005467 Bacteria 3875
112 Ga0070706_100175670 3300005467 Unclassified 2000
113 Ga0070706_100324000 3300005467 Bacteria 1437
114 Ga0070706_100718681 3300005467 Unclassified 926
115 Ga0070707_100004217 3300005468 Bacteria 13474
116 Ga0070707_100034812 3300005468 Bacteria 4803
117 Ga0070707_100080456 3300005468 Unclassified 3145
118 Ga0070707_100147257 3300005468 Bacteria 2292
119 Ga0070707_100195562 3300005468 Bacteria 1972
120 Ga0070707_100203578 3300005468 Bacteria 1929
121 Ga0070707_100687539 3300005468 Bacteria 986
122 Ga0070698_100155235 3300005471 Bacteria 2234
123 Ga0070698_100249488 3300005471 Bacteria 1708
124 Ga0070699_100027724 3300005518 Bacteria 4884
125 Ga0070699_100216800 3300005518 Unclassified 1705
126 Ga0070679_100057031 3300005530 Bacteria 3892
127 Ga0070684_100000650 3300005535 Bacteria 23942
128 Ga0070684_100003759 3300005535 Bacteria 11455
129 Ga0070684_100508984 3300005535 Bacteria 1115
130 Ga0070697_100016079 3300005536 Bacteria 5884
131 Ga0070697_100033551 3300005536 Bacteria 4134
132 Ga0070697_100043015 3300005536 Bacteria 3656
133 Ga0070697_100116388 3300005536 Bacteria 2232
134 Ga0070697_100300468 3300005536 Bacteria 1380
135 Ga0070672_100044623 3300005543 Bacteria 3425
136 Ga0070686_100104401 3300005544 Bacteria 1919
137 Ga0070695_100029441 3300005545 Bacteria 3412
138 Ga0070696_100181922 3300005546 Unclassified 1560
139 Ga0070665_100306442 3300005548 Unclassified 1591
140 Ga0070665_100438443 3300005548 Unclassified 1316
141 Ga0070704_100030928 3300005549 Bacteria 3594
142 Ga0070704_100126604 3300005549 Bacteria 1972
143 Ga0070664_100163376 3300005564 Bacteria 1971
144 Ga0068856_100025340 3300005614 Bacteria 5782
145 Ga0068856_100327471 3300005614 Bacteria 1550
146 Ga0070702_100127778 3300005615 Bacteria 1601
147 Ga0068852_100256561 3300005616 Unclassified 1677
148 Ga0068852_101254018 3300005616 Bacteria 763
149 Ga0068859_100118802 3300005617 Bacteria 2709
150 Ga0068866_10009337 3300005718 Bacteria 4161
151 Ga0068863_100002599 3300005841 Bacteria 17914
152 Ga0068863_100700157 3300005841 Bacteria 1007
153 Ga0068858_100001603 3300005842 Bacteria 23098
154 Ga0068858_100158173 3300005842 Bacteria 2133
155 Ga0068860_100009005 3300005843 Bacteria 9939
156 Ga0068862_100003481 3300005844 Bacteria 13531
157 Ga0068862_100370036 3300005844 Bacteria 1334
158 Ga0081455_10002732 3300005937 Bacteria 20820
159 Ga0081455_10003590 3300005937 Bacteria 17803
160 Ga0081455_10003652 3300005937 Bacteria 17624
161 Ga0081455_10027901 3300005937 Bacteria 5166
162 Ga0081455_10192506 3300005937 Unclassified 1534
163 Ga0081455_10271652 3300005937 Unclassified 1229
164 Ga0081540_1000057 3300005983 Bacteria 121566
165 Ga0081540_1000750 3300005983 Bacteria 29859
166 Ga0081540_1106861 3300005983 Unclassified 1192
167 Ga0081539_10013169 3300005985 Bacteria 6264
168 Ga0081539_10104475 3300005985 Bacteria 1437
169 Ga0081539_10127053 3300005985 Bacteria 1258
170 Ga0070717_10026768 3300006028 Unclassified 4604
171 Ga0070717_10062106 3300006028 Bacteria 3098
172 Ga0070717_10150222 3300006028 Bacteria 2015
173 Ga0070717_10256085 3300006028 Bacteria 1547
174 Ga0070717_10580280 3300006028 Bacteria 1016
175 Ga0075432_10057987 3300006058 Unclassified 1375
176 Ga0070715_10044386 3300006163 Bacteria 1879
177 Ga0070715_10061054 3300006163 Unclassified 1654
178 Ga0070716_100054890 3300006173 Bacteria 2278
179 Ga0070716_100057493 3300006173 Bacteria 2235
180 Ga0070716_100157135 3300006173 Bacteria 1469
181 Ga0070712_100027191 3300006175 Bacteria 3817
182 Ga0070712_100171366 3300006175 Unclassified 1684
183 Ga0070712_100223199 3300006175 Bacteria 1493
184 Ga0070712_100243428 3300006175 Unclassified 1434
185 Ga0075431_100348109 3300006847 Unclassified 1490
186 Ga0075433_10435280 3300006852 Bacteria 1156
187 Ga0075433_10464771 3300006852 Unclassified 1115
188 Ga0068865_100011696 3300006881 Bacteria 5499
189 Ga0068865_100278844 3300006881 Unclassified 1330
190 Ga0097620_100118801 3300006931 Bacteria 2709
191 Ga0099794_10198691 3300007265 Unclassified 1026
192 Ga0099795_10035457 3300007788 Unclassified 1744
193 Ga0105240_10108718 3300009093 Bacteria 3359
194 Ga0111539_10137625 3300009094 Bacteria 2859
195 Ga0111539_10207215 3300009094 Bacteria 2285
196 Ga0105245_10021289 3300009098 Bacteria 5685
197 Ga0105245_10042877 3300009098 Bacteria 4036
198 Ga0105245_10151367 3300009098 Bacteria 2194
199 Ga0105247_10251667 3300009101 Unclassified 1208
200 Ga0114129_10009445 3300009147 Bacteria 13901
201 Ga0114129_10292763 3300009147 Bacteria 2172
202 Ga0105243_10014518 3300009148 Bacteria 5959
203 Ga0105242_10131405 3300009176 Unclassified 2162
204 Ga0105242_10146558 3300009176 Bacteria 2054
205 Ga0105248_10789809 3300009177 Unclassified 1071
206 Ga0105249_10005044 3300009553 Bacteria 11378
207 Ga0105249_10027098 3300009553 Bacteria 5169
208 Ga0105249_10354484 3300009553 Unclassified 1487
209 Ga0105249_10676930 3300009553 Unclassified 1091
210 Ga0099796_10060397 3300010159 Unclassified 1342
211 Ga0105239_10009026 3300010375 Bacteria 11288
212 Ga0105239_10055536 3300010375 Bacteria 4343
213 Ga0105239_10117554 3300010375 Bacteria 2951
214 Ga0105239_10446938 3300010375 Bacteria 1466
215 Ga0105239_10766087 3300010375 Unclassified 1105
216 Ga0105239_10790499 3300010375 Unclassified 1087
217 Ga0157371_10266301 3300013102 Unclassified 1236
218 Ga0157371_10292158 3300013102 Unclassified 1179
219 Ga0157370_10660437 3300013104 Unclassified 955
220 Ga0157369_10151504 3300013105 Bacteria 2450
221 Ga0157374_10019933 3300013296 Bacteria 5944
222 Ga0157374_10030491 3300013296 Bacteria 4897
223 Ga0157374_10038991 3300013296 Unclassified 4370
224 Ga0157374_10108552 3300013296 Bacteria 2667
225 Ga0157374_10123285 3300013296 Bacteria 2503
226 Ga0157374_10153034 3300013296 Bacteria 2243
227 Ga0157374_10689270 3300013296 Bacteria 1034
228 Ga0157378_10005312 3300013297 Bacteria 11311
229 Ga0157378_10073512 3300013297 Bacteria 3074
230 Ga0157378_10187697 3300013297 Bacteria 1948
231 Ga0157378_10389303 3300013297 Bacteria 1371
232 Ga0157378_10480319 3300013297 Unclassified 1238
233 Ga0163162_10006121 3300013306 Bacteria 11648
234 Ga0163162_10169963 3300013306 Bacteria 2305
235 Ga0163162_10409780 3300013306 Unclassified 1488
236 Ga0163162_10504149 3300013306 Unclassified 1341
237 Ga0163162_10522233 3300013306 Bacteria 1317
238 Ga0163162_10539702 3300013306 Bacteria 1295
239 Ga0163162_11351647 3300013306 Bacteria 810
240 Ga0157372_10024022 3300013307 Bacteria 6614
241 Ga0157372_10089309 3300013307 Bacteria 3501
242 Ga0157372_10122284 3300013307 Bacteria 2991
243 Ga0157375_10001187 3300013308 Bacteria 22478
244 Ga0157375_10122828 3300013308 Bacteria 2709
245 Ga0157375_10249195 3300013308 Bacteria 1937
246 Ga0163163_10080752 3300014325 Bacteria 3252
247 Ga0157377_10218040 3300014745 Unclassified 1220
248 Ga0157377_10259209 3300014745 Bacteria 1131
249 Ga0157377_10433101 3300014745 Bacteria 904
250 Ga0157379_10003846 3300014968 Bacteria 12799
251 Ga0157379_10264013 3300014968 Unclassified 1565
252 Ga0157376_10116872 3300014969 Bacteria 2357
253 Ga0157376_10235294 3300014969 Bacteria 1704
254 Ga0157376_10262940 3300014969 Bacteria 1617
255 Ga0163161_10122076 3300017792 Bacteria 1958
256 Ga0207666_1001182 3300025271 Bacteria 3079
257 Ga0207666_1002234 3300025271 Unclassified 2324
258 Ga0207666_1004425 3300025271 Bacteria 1763
259 Ga0207673_1000324 3300025290 Bacteria 4793
260 Ga0207673_1005888 3300025290 Bacteria 1506
261 Ga0207673_1014519 3300025290 Unclassified 1040
262 Ga0207697_10001518 3300025315 Bacteria 12598
263 Ga0207697_10002069 3300025315 Bacteria 10569
264 Ga0207697_10002337 3300025315 Bacteria 9877
265 Ga0207697_10013789 3300025315 Bacteria 3367
266 Ga0207697_10035720 3300025315 Unclassified 2035
267 Ga0207697_10066053 3300025315 Bacteria 1510
268 Ga0207682_10026835 3300025893 Bacteria 2292
269 Ga0207692_10110297 3300025898 Bacteria 1525
270 Ga0207688_10006225 3300025901 Bacteria 6492
271 Ga0207680_10163527 3300025903 Bacteria 1494
272 Ga0207699_10011242 3300025906 Bacteria 4513
273 Ga0207699_10031983 3300025906 Bacteria 2960
274 Ga0207645_10001068 3300025907 Bacteria 22670
275 Ga0207645_10009518 3300025907 Bacteria 6716
276 Ga0207684_10079158 3300025910 Bacteria 2796
277 Ga0207684_10177811 3300025910 Unclassified 1835
278 Ga0207684_10239968 3300025910 Bacteria 1564
279 Ga0207684_10243651 3300025910 Unclassified 1551
280 Ga0207684_10333708 3300025910 Bacteria 1306
281 Ga0207684_10721531 3300025910 Unclassified 846
282 Ga0207693_10002604 3300025915 Bacteria 15674
283 Ga0207693_10007928 3300025915 Bacteria 8723
284 Ga0207693_10013668 3300025915 Bacteria 6538
285 Ga0207693_10051962 3300025915 Bacteria 3214
286 Ga0207693_10101121 3300025915 Bacteria 2260
287 Ga0207693_10147430 3300025915 Unclassified 1850
288 Ga0207693_10464113 3300025915 Bacteria 989
289 Ga0207663_10076059 3300025916 Bacteria 2180
290 Ga0207663_10134156 3300025916 Bacteria 1715
291 Ga0207663_10412389 3300025916 Bacteria 1035
292 Ga0207660_10306690 3300025917 Unclassified 1265
293 Ga0207662_10000863 3300025918 Bacteria 13987
294 Ga0207657_10043717 3300025919 Bacteria 3944
295 Ga0207657_10064324 3300025919 Bacteria 3131
296 Ga0207649_10061250 3300025920 Bacteria 2368
297 Ga0207652_10270687 3300025921 Bacteria 1532
298 Ga0207646_10054587 3300025922 Bacteria 3573
299 Ga0207646_10107456 3300025922 Bacteria 2503
300 Ga0207646_10137227 3300025922 Unclassified 2202
301 Ga0207646_10151520 3300025922 Bacteria 2091
302 Ga0207659_10002671 3300025926 Bacteria 10629
303 Ga0207659_10077892 3300025926 Bacteria 2441
304 Ga0207659_10083269 3300025926 Bacteria 2371
305 Ga0207659_10346618 3300025926 Unclassified 1231
306 Ga0207687_10805927 3300025927 Bacteria 801
307 Ga0207644_10040463 3300025931 Bacteria 3294
308 Ga0207644_10046689 3300025931 Bacteria 3087
309 Ga0207644_10126022 3300025931 Bacteria 1955
310 Ga0207690_10027375 3300025932 Bacteria 3602
311 Ga0207690_10448793 3300025932 Unclassified 1036
312 Ga0207706_10003123 3300025933 Bacteria 15910
313 Ga0207706_10010080 3300025933 Bacteria 8654
314 Ga0207706_10058434 3300025933 Bacteria 3397
315 Ga0207686_10104183 3300025934 Bacteria 1900
316 Ga0207709_10132853 3300025935 Bacteria 1699
317 Ga0207670_10091313 3300025936 Bacteria 2153
318 Ga0207670_10245932 3300025936 Bacteria 1380
319 Ga0207670_10324020 3300025936 Unclassified 1213
320 Ga0207670_10395952 3300025936 Unclassified 1103
321 Ga0207669_10305770 3300025937 Bacteria 1210
322 Ga0207704_10103134 3300025938 Bacteria 1907
323 Ga0207665_10075390 3300025939 Bacteria 2310
324 Ga0207665_10080685 3300025939 Bacteria 2238
325 Ga0207665_10152479 3300025939 Bacteria 1656
326 Ga0207665_10498527 3300025939 Unclassified 940
327 Ga0207691_10009086 3300025940 Bacteria 9539
328 Ga0207691_10097704 3300025940 Bacteria 2624
329 Ga0207691_10358501 3300025940 Unclassified 1247
330 Ga0207689_10414132 3300025942 Unclassified 1124
331 Ga0207661_10135288 3300025944 Bacteria 2116
332 Ga0207661_10673649 3300025944 Bacteria 951
333 Ga0207679_10113015 3300025945 Bacteria 2147
334 Ga0207651_10028049 3300025960 Bacteria 3545
335 Ga0207712_10034705 3300025961 Bacteria 3420
336 Ga0207712_10072050 3300025961 Bacteria 2487
337 Ga0207712_10367902 3300025961 Unclassified 1200
338 Ga0207668_10001438 3300025972 Bacteria 14017
339 Ga0207640_10353221 3300025981 Bacteria 1182
340 Ga0207658_10024768 3300025986 Bacteria 4199
341 Ga0207658_10381460 3300025986 Bacteria 1235
342 Ga0207658_10461884 3300025986 Bacteria 1125
343 Ga0207658_10606084 3300025986 Unclassified 984
344 Ga0207677_10068012 3300026023 Bacteria 2498
345 Ga0207677_10084146 3300026023 Bacteria 2292
346 Ga0207703_10020775 3300026035 Bacteria 5137
347 Ga0207703_10071231 3300026035 Bacteria 2871
348 Ga0207703_10615471 3300026035 Bacteria 1028
349 Ga0207678_10031979 3300026067 Unclassified 4588
350 Ga0207678_10051296 3300026067 Bacteria 3562
351 Ga0207678_10596081 3300026067 Unclassified 968
352 Ga0207708_10030189 3300026075 Bacteria 4111
353 Ga0207708_10224595 3300026075 Bacteria 1506
354 Ga0207702_10019100 3300026078 Bacteria 5672
355 Ga0207702_10594321 3300026078 Bacteria 1085
356 Ga0207641_10011565 3300026088 Bacteria 7244
357 Ga0207648_10081779 3300026089 Bacteria 2817
358 Ga0207675_100019785 3300026118 Bacteria 6284
359 Ga0207675_100246375 3300026118 Bacteria 1728
360 Ga0207683_10009787 3300026121 Bacteria 8173
361 Ga0207683_10010581 3300026121 Bacteria 7868
362 Ga0207683_10013387 3300026121 Bacteria 6996
363 Ga0207683_10062101 3300026121 Bacteria 3290
364 Ga0209974_10025543 3300027876 Unclassified 1955
365 Ga0268266_10032430 3300028379 Bacteria 4438
366 Ga0268266_10147855 3300028379 Bacteria 2114
367 Ga0268266_10667442 3300028379 Bacteria 1001
368 Ga0268265_10005374 3300028380 Bacteria 8773
369 Ga0268264_10017629 3300028381 Bacteria 5847
370 Ga0268264_10095847 3300028381 Bacteria 2568
371 Ga0268264_10156926 3300028381 Bacteria 2046
372 Ga0307513_10028037 3300031456 Bacteria 6450
373 Ga0373934_0107179 3300035086 Unclassified 1132
374 Ga0373944_0106997 3300035089 Unclassified 951
375 Ga0373944_0123332 3300035089 Unclassified 895
376 Ga0373954_0052209 3300035118 Bacteria 1921
377 Ga0373956_0069174 3300035119 Unclassified 1609
378 Ga0373943_0008754 3300035170 Bacteria 4533
379 Ga0373943_0088262 3300035170 Bacteria 1602
380 Ga0373955_0370823 3300035172 Unclassified 868
381 Ga0373935_0019995 3300035692 Bacteria 4087
382 Ga0373935_0048030 3300035692 Unclassified 2701
383 Ga0373935_0053322 3300035692 Bacteria 2573
384 Ga0373927_0033871 3300035695 Bacteria 3324
385 Ga0373947_0033320 3300035725 Bacteria 3040
386 Ga0373947_0091301 3300035725 Unclassified 1900
387 Ga0373947_0333885 3300035725 Unclassified 1015
388 Ga0373947_0353347 3300035725 Bacteria 986
389 Ga0373947_0558480 3300035725 Unclassified 779
390 Ga0373937_0067554 3300036401 Bacteria 3294
391 Ga0373937_0072854 3300036401 Bacteria 3168
392 Ga0395900_0017363 3300037418 Bacteria 7346
393 Ga0395900_0096150 3300037418 Bacteria 3043
394 Ga0395900_0791875 3300037418 Unclassified 876
395 Ga0395898_0032784 3300037466 Bacteria 5187
396 Ga0395898_0260469 3300037466 Unclassified 1654
397 Ga0395905_0026895 3300037471 Bacteria 5426
398 Ga0395901_0019621 3300038443 Bacteria 6910
399 Ga0395901_0344577 3300038443 Unclassified 1539
400 Ga0439454_000788 3300042011 Bacteria 2742
401 Ga0439455_0000517 3300042012 Bacteria 5392
402 Ga0451576_0367299 3300045051 Bacteria 1507
403 Ga0466967_0092182 3300045976 Bacteria 2755
404 Ga0495592_0010806 3300046454 Bacteria 6884
405 Ga0495603_0129557 3300046455 Bacteria 1470
406 Ga0495629_0099207 3300046459 Bacteria 2032
407 Ga0495651_0498381 3300046462 Unclassified 780
408 Ga0495664_0065513 3300046477 Bacteria 2166
409 Ga0495664_0210750 3300046477 Bacteria 1177
410 Ga0495585_0023515 3300046492 Bacteria 3536
411 Ga0495618_0058144 3300046514 Unclassified 2448
412 Ga0495618_0307059 3300046514 Unclassified 985
413 Ga0495628_0048390 3300046516 Bacteria 3370
414 Ga0495630_0020212 3300046517 Bacteria 4907
415 Ga0495630_0309469 3300046517 Bacteria 1207
416 Ga0495652_0150970 3300046529 Unclassified 1815
417 Ga0495586_0026696 3300046535 Bacteria 3091
418 Ga0495587_0032931 3300046536 Bacteria 3130
419 Ga0495598_0049717 3300046537 Unclassified 1258
420 Ga0495645_0012952 3300046543 Bacteria 5886
421 Ga0495634_0084063 3300046642 Bacteria 2076
422 Ga0495599_0013467 3300046678 Bacteria 5052
423 Ga0495623_0068588 3300046679 Bacteria 2211
424 Ga0495646_0073012 3300046680 Unclassified 2016
425 Ga0495647_0029290 3300046681 Bacteria 2036
426 Ga0495658_0195932 3300046683 Unclassified 1258
427 Ga0495669_0003030 3300046684 Bacteria 6907
428 Ga0495669_0040789 3300046684 Unclassified 2060
429 Ga0495613_0067862 3300046689 Bacteria 2602
430 Ga0495581_0090326 3300047315 Bacteria 1777
431 Ga0495604_0044634 3300047317 Bacteria 3461
432 Ga0495604_0172404 3300047317 Bacteria 1520
433 Ga0495674_0022737 3300047319 Bacteria 5779
434 Ga0495674_0082132 3300047319 Bacteria 2763
435 Ga0495674_0426490 3300047319 Bacteria 1068
436 Ga0495675_0028572 3300047444 Unclassified 3555
437 Ga0495684_0042201 3300047471 Bacteria 3494
438 Ga0495602_0107399 3300048088 Bacteria 2275
439 Ga0495614_0082969 3300048089 Unclassified 1390
440 Ga0496100_0509135 3300048903 Unclassified 928
441 Ga0496101_0075552 3300048904 Bacteria 2480
442 Ga0496102_0009441 3300048905 Bacteria 8381
443 Ga0496102_0067200 3300048905 Bacteria 3287
444 Ga0496102_0310393 3300048905 Unclassified 1486
445 Ga0496103_0031908 3300048906 Bacteria 3213
446 Ga0496103_0283298 3300048906 Unclassified 1066
447 Ga0496104_0037792 3300048907 Bacteria 4514
448 Ga0496104_0102576 3300048907 Bacteria 2740
449 Ga0496104_0198174 3300048907 Bacteria 1920
450 Ga0496104_0453504 3300048907 Unclassified 1194
451 Ga0496105_0010129 3300048908 Bacteria 7404
452 Ga0496105_0108159 3300048908 Bacteria 2296
453 Ga0496106_0006594 3300048909 Bacteria 8594
454 Ga0496107_0088871 3300048910 Bacteria 2256
455 Ga0496107_0098504 3300048910 Bacteria 2141
456 Ga0496107_0112464 3300048910 Bacteria 2002
457 Ga0496108_0296590 3300048911 Bacteria 1408
458 Ga0496108_0353322 3300048911 Bacteria 1283
459 Ga0496109_0040115 3300048912 Bacteria 4240
460 Ga0496109_0080179 3300048912 Bacteria 3007
461 Ga0496109_0136157 3300048912 Bacteria 2295
462 Ga0496109_0265601 3300048912 Bacteria 1617
463 Ga0496110_0212003 3300048913 Bacteria 1761
464 Ga0496111_0083965 3300048914 Bacteria 2328
465 Ga0496112_0015230 3300048915 Bacteria 7168
466 Ga0496112_0073171 3300048915 Bacteria 3388
467 Ga0496112_0195856 3300048915 Bacteria 1981
468 Ga0496112_0519302 3300048915 Bacteria 1126
469 Ga0496113_0001378 3300048916 Bacteria 13483
470 Ga0496113_0220238 3300048916 Unclassified 1512
471 Ga0496114_0001364 3300048917 Bacteria 18520
472 Ga0496114_0222946 3300048917 Bacteria 1655
473 Ga0496114_0355079 3300048917 Unclassified 1297
474 Ga0496114_0379304 3300048917 Bacteria 1252
475 Ga0496115_0007704 3300048918 Bacteria 7941
476 Ga0496115_0053952 3300048918 Bacteria 3227
477 nmdc:mga05p37_10065_c1 3300050507 Bacteria 11224
478 nmdc:mga05p37_183892_c1 3300050507 Bacteria 2541
479 nmdc:mga05p37_785620_c1 3300050507 Unclassified 1044
480 nmdc:mga0n895_1438731_c1 3300050512 Bacteria 657
481 nmdc:mga0rr50_386900_c1 3300050513 Unclassified 1180
482 Ga0495601_0013419 3300053077 Bacteria 4927
483 Ga0495612_0038673 3300053078 Unclassified 1939
484 Ga0495595_0261333 3300053084 Unclassified 868
485 Ga0495619_0136677 3300053085 Bacteria 1686
486 Ga0065704_10010853
487 JGI24746J21847_1006461
488 JGI24743J22301_10018472
489 JGI24035J26624_1000556
490 JGI24035J26624_1001447
491 JGI25404J52841_10012033
492 JGI25405J52794_10001275
493 Ga0065704_10004120
494 Ga0065704_10015689
495 Ga0065704_10022150
496 Ga0065704_10127197
497 Ga0065712_10001047
498 Ga0065712_10005119
499 Ga0065712_10013694
500 Ga0065712_10081057
501 Ga0065712_10107227
502 Ga0065712_10122367
503 Ga0065712_10127551
504 Ga0065715_10000543
505 Ga0065715_10000675
506 Ga0065715_10002721
507 Ga0065715_10006928
508 Ga0065715_10026713
509 Ga0065715_10117804
510 Ga0065715_10198296
511 Ga0065707_10003153
512 Ga0065707_10005460
513 Ga0065707_10021274
514 Ga0065707_10037064
515 Ga0065707_10116079
516 Ga0065707_10459160
517 Ga0070658_10374137
518 Ga0070676_10044993
519 Ga0070676_10104065
520 Ga0070683_100027311
521 Ga0070683_100200108
522 Ga0070690_100021095
523 Ga0070690_100061274
524 Ga0070677_10035923
525 Ga0068869_100379984
526 Ga0070666_10112464
527 Ga0070666_10381543
528 Ga0070680_100039006
529 Ga0070682_100794716
530 Ga0068868_100029767
531 Ga0068868_100036715
532 Ga0068868_100295945
533 Ga0070660_100035106
534 Ga0070660_100250655
535 Ga0070660_100301488
536 Ga0070689_100002035
537 Ga0070689_100008576
538 Ga0070689_100021285
539 Ga0070689_100192328
540 Ga0070687_100000405
541 Ga0070661_100020982
542 Ga0070668_100002347
543 Ga0070668_100025950
544 Ga0070668_100122864
545 Ga0070669_100009019
546 Ga0070669_100049209
547 Ga0070675_100009524
548 Ga0070675_100026959
549 Ga0070675_100038405
550 Ga0070675_100092040
551 Ga0070675_100098313
552 Ga0070675_100199228
553 Ga0070675_100214979
554 Ga0070671_100069215
555 Ga0070671_100130041
556 Ga0070671_100390803
557 Ga0070674_100131331
558 Ga0070673_100022752
559 Ga0070673_100090958
560 Ga0070673_100931354
561 Ga0070688_100015877
562 Ga0070688_100022202
563 Ga0070688_100209871
564 Ga0070659_100023006
565 Ga0070659_100045385
566 Ga0070667_100012477
567 Ga0070709_10016438
568 Ga0070709_10065478
569 Ga0070714_100103023
570 Ga0070714_100143395
571 Ga0070713_100030688
572 Ga0070713_100033877
573 Ga0070713_100159721
574 Ga0070713_100381442
575 Ga0070710_10432366
576 Ga0070711_100022973
577 Ga0070711_100085169
578 Ga0070705_100016730
579 Ga0070705_100236102
580 Ga0070700_100174925
581 Ga0070708_100040747
582 Ga0070708_100047145
583 Ga0070708_100091076
584 Ga0070708_100146889
585 Ga0070678_100021938
586 Ga0070678_100032408
587 Ga0070678_100040876
588 Ga0070662_100003163
589 Ga0070662_100555210
590 Ga0070681_10021284
591 Ga0068867_100035626
592 Ga0070685_10013472
593 Ga0070685_10019421
594 Ga0070706_100001536
595 Ga0070706_100014482
596 Ga0070706_100049562
597 Ga0070706_100175670
598 Ga0070706_100324000
599 Ga0070706_100718681
600 Ga0070707_100004217
601 Ga0070707_100034812
602 Ga0070707_100080456
603 Ga0070707_100147257
604 Ga0070707_100195562
605 Ga0070707_100203578
606 Ga0070707_100687539
607 Ga0070698_100155235
608 Ga0070698_100249488
609 Ga0070699_100027724
610 Ga0070699_100216800
611 Ga0070679_100057031
612 Ga0070684_100000650
613 Ga0070684_100003759
614 Ga0070684_100508984
615 Ga0070697_100016079
616 Ga0070697_100033551
617 Ga0070697_100043015
618 Ga0070697_100116388
619 Ga0070697_100300468
620 Ga0070672_100044623
621 Ga0070686_100104401
622 Ga0070695_100029441
623 Ga0070696_100181922
624 Ga0070665_100306442
625 Ga0070665_100438443
626 Ga0070704_100030928
627 Ga0070704_100126604
628 Ga0070664_100163376
629 Ga0068856_100025340
630 Ga0068856_100327471
631 Ga0070702_100127778
632 Ga0068852_100256561
633 Ga0068852_101254018
634 Ga0068859_100118802
635 Ga0068866_10009337
636 Ga0068863_100002599
637 Ga0068863_100700157
638 Ga0068858_100001603
639 Ga0068858_100158173
640 Ga0068860_100009005
641 Ga0068862_100003481
642 Ga0068862_100370036
643 Ga0081455_10002732
644 Ga0081455_10003590
645 Ga0081455_10003652
646 Ga0081455_10027901
647 Ga0081455_10192506
648 Ga0081455_10271652
649 Ga0081540_1000057
650 Ga0081540_1000750
651 Ga0081540_1106861
652 Ga0081539_10013169
653 Ga0081539_10104475
654 Ga0081539_10127053
655 Ga0070717_10026768
656 Ga0070717_10062106
657 Ga0070717_10150222
658 Ga0070717_10256085
659 Ga0070717_10580280
660 Ga0075432_10057987
661 Ga0070715_10044386
662 Ga0070715_10061054
663 Ga0070716_100054890
664 Ga0070716_100057493
665 Ga0070716_100157135
666 Ga0070712_100027191
667 Ga0070712_100171366
668 Ga0070712_100223199
669 Ga0070712_100243428
670 Ga0075431_100348109
671 Ga0075433_10435280
672 Ga0075433_10464771
673 Ga0068865_100011696
674 Ga0068865_100278844
675 Ga0097620_100118801
676 Ga0099794_10198691
677 Ga0099795_10035457
678 Ga0105240_10108718
679 Ga0111539_10137625
680 Ga0111539_10207215
681 Ga0105245_10021289
682 Ga0105245_10042877
683 Ga0105245_10151367
684 Ga0105247_10251667
685 Ga0114129_10009445
686 Ga0114129_10292763
687 Ga0105243_10014518
688 Ga0105242_10131405
689 Ga0105242_10146558
690 Ga0105248_10789809
691 Ga0105249_10005044
692 Ga0105249_10027098
693 Ga0105249_10354484
694 Ga0105249_10676930
695 Ga0099796_10060397
696 Ga0105239_10009026
697 Ga0105239_10055536
698 Ga0105239_10117554
699 Ga0105239_10446938
700 Ga0105239_10766087
701 Ga0105239_10790499
702 Ga0157371_10266301
703 Ga0157371_10292158
704 Ga0157370_10660437
705 Ga0157369_10151504
706 Ga0157374_10019933
707 Ga0157374_10030491
708 Ga0157374_10038991
709 Ga0157374_10108552
710 Ga0157374_10123285
711 Ga0157374_10153034
712 Ga0157374_10689270
713 Ga0157378_10005312
714 Ga0157378_10073512
715 Ga0157378_10187697
716 Ga0157378_10389303
717 Ga0157378_10480319
718 Ga0163162_10006121
719 Ga0163162_10169963
720 Ga0163162_10409780
721 Ga0163162_10504149
722 Ga0163162_10522233
723 Ga0163162_10539702
724 Ga0163162_11351647
725 Ga0157372_10024022
726 Ga0157372_10089309
727 Ga0157372_10122284
728 Ga0157375_10001187
729 Ga0157375_10122828
730 Ga0157375_10249195
731 Ga0163163_10080752
732 Ga0157377_10218040
733 Ga0157377_10259209
734 Ga0157377_10433101
735 Ga0157379_10003846
736 Ga0157379_10264013
737 Ga0157376_10116872
738 Ga0157376_10235294
739 Ga0157376_10262940
740 Ga0163161_10122076
741 Ga0207666_1001182
742 Ga0207666_1002234
743 Ga0207666_1004425
744 Ga0207673_1000324
745 Ga0207673_1005888
746 Ga0207673_1014519
747 Ga0207697_10001518
748 Ga0207697_10002069
749 Ga0207697_10002337
750 Ga0207697_10013789
751 Ga0207697_10035720
752 Ga0207697_10066053
753 Ga0207682_10026835
754 Ga0207692_10110297
755 Ga0207688_10006225
756 Ga0207680_10163527
757 Ga0207699_10011242
758 Ga0207699_10031983
759 Ga0207645_10001068
760 Ga0207645_10009518
761 Ga0207684_10079158
762 Ga0207684_10177811
763 Ga0207684_10239968
764 Ga0207684_10243651
765 Ga0207684_10333708
766 Ga0207684_10721531
767 Ga0207693_10002604
768 Ga0207693_10007928
769 Ga0207693_10013668
770 Ga0207693_10051962
771 Ga0207693_10101121
772 Ga0207693_10147430
773 Ga0207693_10464113
774 Ga0207663_10076059
775 Ga0207663_10134156
776 Ga0207663_10412389
777 Ga0207660_10306690
778 Ga0207662_10000863
779 Ga0207657_10043717
780 Ga0207657_10064324
781 Ga0207649_10061250
782 Ga0207652_10270687
783 Ga0207646_10054587
784 Ga0207646_10107456
785 Ga0207646_10137227
786 Ga0207646_10151520
787 Ga0207659_10002671
788 Ga0207659_10077892
789 Ga0207659_10083269
790 Ga0207659_10346618
791 Ga0207687_10805927
792 Ga0207644_10040463
793 Ga0207644_10046689
794 Ga0207644_10126022
795 Ga0207690_10027375
796 Ga0207690_10448793
797 Ga0207706_10003123
798 Ga0207706_10010080
799 Ga0207706_10058434
800 Ga0207686_10104183
801 Ga0207709_10132853
802 Ga0207670_10091313
803 Ga0207670_10245932
804 Ga0207670_10324020
805 Ga0207670_10395952
806 Ga0207669_10305770
807 Ga0207704_10103134
808 Ga0207665_10075390
809 Ga0207665_10080685
810 Ga0207665_10152479
811 Ga0207665_10498527
812 Ga0207691_10009086
813 Ga0207691_10097704
814 Ga0207691_10358501
815 Ga0207689_10414132
816 Ga0207661_10135288
817 Ga0207661_10673649
818 Ga0207679_10113015
819 Ga0207651_10028049
820 Ga0207712_10034705
821 Ga0207712_10072050
822 Ga0207712_10367902
823 Ga0207668_10001438
824 Ga0207640_10353221
825 Ga0207658_10024768
826 Ga0207658_10381460
827 Ga0207658_10461884
828 Ga0207658_10606084
829 Ga0207677_10068012
830 Ga0207677_10084146
831 Ga0207703_10020775
832 Ga0207703_10071231
833 Ga0207703_10615471
834 Ga0207678_10031979
835 Ga0207678_10051296
836 Ga0207678_10596081
837 Ga0207708_10030189
838 Ga0207708_10224595
839 Ga0207702_10019100
840 Ga0207702_10594321
841 Ga0207641_10011565
842 Ga0207648_10081779
843 Ga0207675_100019785
844 Ga0207675_100246375
845 Ga0207683_10009787
846 Ga0207683_10010581
847 Ga0207683_10013387
848 Ga0207683_10062101
849 Ga0209974_10025543
850 Ga0268266_10032430
851 Ga0268266_10147855
852 Ga0268266_10667442
853 Ga0268265_10005374
854 Ga0268264_10017629
855 Ga0268264_10095847
856 Ga0268264_10156926
857 Ga0307513_10028037
858 Ga0373934_0107179
859 Ga0373944_0106997
860 Ga0373944_0123332
861 Ga0373954_0052209
862 Ga0373956_0069174
863 Ga0373943_0008754
864 Ga0373943_0088262
865 Ga0373955_0370823
866 Ga0373935_0019995
867 Ga0373935_0048030
868 Ga0373935_0053322
869 Ga0373927_0033871
870 Ga0373947_0033320
871 Ga0373947_0091301
872 Ga0373947_0333885
873 Ga0373947_0353347
874 Ga0373947_0558480
875 Ga0373937_0067554
876 Ga0373937_0072854
877 Ga0395900_0017363
878 Ga0395900_0096150
879 Ga0395900_0791875
880 Ga0395898_0032784
881 Ga0395898_0260469
882 Ga0395905_0026895
883 Ga0395901_0019621
884 Ga0395901_0344577
885 Ga0439454_000788
886 Ga0439455_0000517
887 Ga0451576_0367299
888 Ga0466967_0092182
889 Ga0495592_0010806
890 Ga0495603_0129557
891 Ga0495629_0099207
892 Ga0495651_0498381
893 Ga0495664_0065513
894 Ga0495664_0210750
895 Ga0495585_0023515
896 Ga0495618_0058144
897 Ga0495618_0307059
898 Ga0495628_0048390
899 Ga0495630_0020212
900 Ga0495630_0309469
901 Ga0495652_0150970
902 Ga0495586_0026696
903 Ga0495587_0032931
904 Ga0495598_0049717
905 Ga0495645_0012952
906 Ga0495634_0084063
907 Ga0495599_0013467
908 Ga0495623_0068588
909 Ga0495646_0073012
910 Ga0495647_0029290
911 Ga0495658_0195932
912 Ga0495669_0003030
913 Ga0495669_0040789
914 Ga0495613_0067862
915 Ga0495581_0090326
916 Ga0495604_0044634
917 Ga0495604_0172404
918 Ga0495674_0022737
919 Ga0495674_0082132
920 Ga0495674_0426490
921 Ga0495675_0028572
922 Ga0495684_0042201
923 Ga0495602_0107399
924 Ga0495614_0082969
925 Ga0496100_0509135
926 Ga0496101_0075552
927 Ga0496102_0009441
928 Ga0496102_0067200
929 Ga0496102_0310393
930 Ga0496103_0031908
931 Ga0496103_0283298
932 Ga0496104_0037792
933 Ga0496104_0102576
934 Ga0496104_0198174
935 Ga0496104_0453504
936 Ga0496105_0010129
937 Ga0496105_0108159
938 Ga0496106_0006594
939 Ga0496107_0088871
940 Ga0496107_0098504
941 Ga0496107_0112464
942 Ga0496108_0296590
943 Ga0496108_0353322
944 Ga0496109_0040115
945 Ga0496109_0080179
946 Ga0496109_0136157
947 Ga0496109_0265601
948 Ga0496110_0212003
949 Ga0496111_0083965
950 Ga0496112_0015230
951 Ga0496112_0073171
952 Ga0496112_0195856
953 Ga0496112_0519302
954 Ga0496113_0001378
955 Ga0496113_0220238
956 Ga0496114_0001364
957 Ga0496114_0222946
958 Ga0496114_0355079
959 Ga0496114_0379304
960 Ga0496115_0007704
961 Ga0496115_0053952
962 nmdc:mga05p37_10065_c1
963 nmdc:mga05p37_183892_c1
964 nmdc:mga05p37_785620_c1
965 nmdc:mga0n895_1438731_c1
966 nmdc:mga0rr50_386900_c1
967 Ga0495601_0013419
968 Ga0495612_0038673
969 Ga0495595_0261333
970 Ga0495619_0136677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mtx-assembly2.cif.gz_C structure of the ers1 dimerization and histidine phosphotransfer domain from arabidopsis thaliana 0.9095 17 77
7n0e-assembly1.cif.gz_A co-complex of the histidine kinase region of rets and the dimerization and histidine phosphotransfer domain of gacs 0.899 22 77
4mtx-assembly2.cif.gz_D structure of the ers1 dimerization and histidine phosphotransfer domain from arabidopsis thaliana 0.8661 19 79
4mtx-assembly1.cif.gz_B structure of the ers1 dimerization and histidine phosphotransfer domain from arabidopsis thaliana 0.8503 19 76
1zw0-assembly10.cif.gz_H-5 crystal structure of the yersinia type iii secretion protein ysce 0.8453 18 80
ID Description Score Start End Superfamily
af_P0AE82_188_302_1.10.287.130 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.9089 17 79 1.10.287.130
4mt8B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.8795 17 79 1.10.287.130
af_Q95PI2_414_485_1.10.287.130 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.8737 14 79 1.10.287.130
1zw0H00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.8453 18 80 1.20.5.420
4biyC01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.8398 17 83 1.10.287.130
ID Description Score Start End GO Terms
AF-A0A6I1F7R3-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8274 113 232 GO:0000160
GO:0005524
GO:0016301
AF-A0A7C6AA50-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8232 112 230 GO:0016301
AF-A0A359LVM6-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8185 17 234 GO:0000155
GO:0016020
AF-A0A350QB50-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8133 124 234 GO:0016772
AF-A0A436C1J5-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.8109 84 236 GO:0000155
GO:0005524

Map