F452962

General Info

Members Datasets Scaffolds Average Seq Length
484 244 968 151

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10061266|Ga0307406_100612664
Length 174
Sequence VPAARDREGPVATGPSAMLRPVRISAKVDYAVRAAIELAAADAERPTKGDTIARAQGIPIKFLENILADMRHAGLVASRRGADGGYWLAHPAQEISVADVIRAVEGPLASVRGGRPEDVDYAGNAEPLQRVWIAVRGSLRSVVEGVTLADLAAGELPRHVQQLADDPETWVTRR

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
120 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
121 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
122 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
123 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
137 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
138 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
139 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
140 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
143 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
146 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
147 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
151 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
230 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 2643221561 Nocardioides sp. Root151 Isolate Unclassified
236 2643221615 Nocardioides sp. Root224 Isolate Unclassified
237 2643221641 Nocardioides sp. Root122 Isolate Unclassified
238 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
239 2643221696 Nocardioides sp. Root140 Isolate Unclassified
240 2739367898 Nocardioides sp. CF479 Isolate Unclassified
241 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
242 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
243 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
244 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0.21
Isolates 2.07

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 15.91
Nodule 0.21
Rhizoplane 10.33
Rhizosphere 69.42
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10061266 3300031901 Bacteria 2430
2 Ga0070658_10854782 3300005327 Bacteria 791
3 Ga0070658_11241248 3300005327 Bacteria 648
4 Ga0070683_100734486 3300005329 Bacteria 946
5 Ga0070682_100061423 3300005337 Bacteria 2378
6 Ga0068868_100957228 3300005338 Bacteria 781
7 Ga0070660_101046917 3300005339 Bacteria 690
8 Ga0070661_100415798 3300005344 Bacteria 1065
9 Ga0070671_101026916 3300005355 Bacteria 723
10 Ga0070673_100319221 3300005364 Bacteria 1372
11 Ga0070659_100115340 3300005366 Bacteria 2171
12 Ga0070667_100108459 3300005367 Bacteria 2405
13 Ga0070714_100861326 3300005435 Bacteria 879
14 Ga0070701_10420754 3300005438 Bacteria 851
15 Ga0070711_100914180 3300005439 Bacteria 749
16 Ga0070705_100197691 3300005440 Bacteria 1376
17 Ga0070700_100612433 3300005441 Bacteria 855
18 Ga0070663_100057758 3300005455 Bacteria 2785
19 Ga0070663_100330834 3300005455 Bacteria 1228
20 Ga0070678_100043960 3300005456 Bacteria 3186
21 Ga0070698_100562299 3300005471 Bacteria 1080
22 Ga0070679_100265422 3300005530 Bacteria 1672
23 Ga0070672_101071624 3300005543 Bacteria 716
24 Ga0070696_100011731 3300005546 Bacteria 5873
25 Ga0070693_100043545 3300005547 Bacteria 2535
26 Ga0070665_100060800 3300005548 Bacteria 3787
27 Ga0070664_100071817 3300005564 Bacteria 2967
28 Ga0070664_100303868 3300005564 Bacteria 1442
29 Ga0070664_100733023 3300005564 Bacteria 922
30 Ga0070664_101089901 3300005564 Bacteria 752
31 Ga0068856_100745757 3300005614 Bacteria 999
32 Ga0068861_100181035 3300005719 Bacteria 1754
33 Ga0068870_10194829 3300005840 Bacteria 1225
34 Ga0068863_101153224 3300005841 Bacteria 780
35 Ga0068860_100001322 3300005843 Bacteria 26883
36 Ga0068860_100764222 3300005843 Bacteria 979
37 Ga0081455_10291212 3300005937 Bacteria 1175
38 Ga0081539_10019051 3300005985 Bacteria 4721
39 Ga0081539_10184118 3300005985 Bacteria 977
40 Ga0070717_10046623 3300006028 Bacteria 3547
41 Ga0075365_10008963 3300006038 Bacteria 5719
42 Ga0075365_10019477 3300006038 Bacteria 4189
43 Ga0075365_10032240 3300006038 Bacteria 3366
44 Ga0075365_10048578 3300006038 Bacteria 2794
45 Ga0075365_10049222 3300006038 Bacteria 2776
46 Ga0075365_10051203 3300006038 Bacteria 2726
47 Ga0075365_10061354 3300006038 Bacteria 2511
48 Ga0075365_10063963 3300006038 Bacteria 2463
49 Ga0075365_10104166 3300006038 Bacteria 1945
50 Ga0075365_10131745 3300006038 Bacteria 1730
51 Ga0075365_10437549 3300006038 Bacteria 923
52 Ga0075365_10824730 3300006038 Bacteria 654
53 Ga0075365_11047987 3300006038 Bacteria 574
54 Ga0075368_10024971 3300006042 Bacteria 2291
55 Ga0075363_100002065 3300006048 Bacteria 8031
56 Ga0075363_100003853 3300006048 Bacteria 6469
57 Ga0075363_100183083 3300006048 Bacteria 1193
58 Ga0075363_100234684 3300006048 Bacteria 1054
59 Ga0075363_100301656 3300006048 Bacteria 930
60 Ga0075363_100525187 3300006048 Bacteria 704
61 Ga0075363_100543126 3300006048 Bacteria 693
62 Ga0075363_100727085 3300006048 Bacteria 601
63 Ga0075364_10012745 3300006051 Bacteria 5156
64 Ga0075364_10054973 3300006051 Bacteria 2604
65 Ga0075364_10056349 3300006051 Bacteria 2573
66 Ga0075364_10099855 3300006051 Bacteria 1932
67 Ga0075364_10159454 3300006051 Bacteria 1522
68 Ga0075364_10171039 3300006051 Bacteria 1469
69 Ga0075364_10368416 3300006051 Bacteria 979
70 Ga0075364_11073130 3300006051 Bacteria 547
71 Ga0070715_10009855 3300006163 Bacteria 3383
72 Ga0070716_100064483 3300006173 Bacteria 2130
73 Ga0070712_100000186 3300006175 Bacteria 34602
74 Ga0075362_10264646 3300006177 Bacteria 848
75 Ga0075367_10014665 3300006178 Bacteria 4243
76 Ga0075367_10032979 3300006178 Bacteria 2982
77 Ga0075367_10035687 3300006178 Bacteria 2879
78 Ga0075367_10367546 3300006178 Bacteria 908
79 Ga0075367_10445421 3300006178 Bacteria 821
80 Ga0075367_10789514 3300006178 Bacteria 605
81 Ga0097621_100245816 3300006237 Bacteria 1565
82 Ga0075370_10040786 3300006353 Bacteria 2619
83 Ga0075370_10319671 3300006353 Bacteria 925
84 Ga0075370_10576763 3300006353 Bacteria 681
85 Ga0075370_10717689 3300006353 Bacteria 608
86 Ga0068871_100074167 3300006358 Bacteria 2806
87 Ga0075434_100271585 3300006871 Bacteria 1715
88 Ga0105245_10010457 3300009098 Bacteria 8078
89 Ga0105241_10084259 3300009174 Bacteria 2496
90 Ga0105237_10524319 3300009545 Bacteria 1191
91 Ga0105238_10654059 3300009551 Bacteria 1061
92 Ga0105238_11537462 3300009551 Bacteria 695
93 Ga0105238_12006028 3300009551 Bacteria 612
94 Ga0105239_10147548 3300010375 Bacteria 2624
95 Ga0105239_10676445 3300010375 Bacteria 1179
96 Ga0105239_11606167 3300010375 Bacteria 752
97 Ga0105246_10493336 3300011119 Bacteria 1038
98 Ga0105246_11808526 3300011119 Bacteria 584
99 Ga0157317_1029113 3300012475 Bacteria 530
100 Ga0157378_10577592 3300013297 Bacteria 1133
101 Ga0157372_11729248 3300013307 Bacteria 719
102 Ga0157375_10793172 3300013308 Bacteria 1096
103 Ga0157375_10892592 3300013308 Bacteria 1033
104 Ga0163163_11500345 3300014325 Bacteria 735
105 Ga0157380_10610379 3300014326 Bacteria 1081
106 Ga0157379_10004216 3300014968 Bacteria 12277
107 Ga0157376_10005763 3300014969 Bacteria 8678
108 Ga0206354_10152586 3300020081 Bacteria 781
109 Ga0207692_10194813 3300025898 Bacteria 1188
110 Ga0207692_10655699 3300025898 Bacteria 678
111 Ga0207688_10656094 3300025901 Bacteria 662
112 Ga0207643_10513618 3300025908 Bacteria 767
113 Ga0207705_11141164 3300025909 Bacteria 599
114 Ga0207654_10256606 3300025911 Bacteria 1174
115 Ga0207671_10306384 3300025914 Bacteria 1255
116 Ga0207693_10000115 3300025915 Bacteria 71540
117 Ga0207693_10049762 3300025915 Bacteria 3291
118 Ga0207693_10052567 3300025915 Bacteria 3196
119 Ga0207663_10018872 3300025916 Bacteria 3873
120 Ga0207662_10185310 3300025918 Bacteria 1341
121 Ga0207657_10149069 3300025919 Bacteria 1906
122 Ga0207649_10552522 3300025920 Bacteria 881
123 Ga0207652_10350431 3300025921 Bacteria 1332
124 Ga0207687_10176629 3300025927 Bacteria 1651
125 Ga0207700_10413695 3300025928 Bacteria 1183
126 Ga0207664_10135949 3300025929 Bacteria 2074
127 Ga0207706_10048695 3300025933 Bacteria 3748
128 Ga0207669_11553364 3300025937 Bacteria 565
129 Ga0207665_10003605 3300025939 Bacteria 10341
130 Ga0207691_10760321 3300025940 Bacteria 815
131 Ga0207661_10951846 3300025944 Bacteria 791
132 Ga0207679_10080776 3300025945 Bacteria 2484
133 Ga0207679_10537787 3300025945 Bacteria 1047
134 Ga0207679_11309889 3300025945 Bacteria 665
135 Ga0207678_10021625 3300026067 Bacteria 5641
136 Ga0207678_10048495 3300026067 Bacteria 3671
137 Ga0207678_10093808 3300026067 Bacteria 2564
138 Ga0207708_10358489 3300026075 Bacteria 1198
139 Ga0207702_10020480 3300026078 Bacteria 5475
140 Ga0207702_10819649 3300026078 Bacteria 920
141 Ga0207641_11203796 3300026088 Bacteria 757
142 Ga0207648_11130620 3300026089 Bacteria 735
143 Ga0207675_100079585 3300026118 Bacteria 3071
144 Ga0207675_100881680 3300026118 Bacteria 910
145 Ga0207683_10004132 3300026121 Bacteria 12556
146 Ga0209813_10313445 3300027866 Bacteria 612
147 Ga0207428_10278971 3300027907 Bacteria 1241
148 Ga0268266_10401965 3300028379 Bacteria 1295
149 Ga0268265_12510849 3300028380 Bacteria 521
150 Ga0268264_10001092 3300028381 Bacteria 26779
151 Ga0265326_10000061 3300028558 Bacteria 63914
152 Ga0265319_1002074 3300028563 Bacteria 11244
153 Ga0265319_1017296 3300028563 Bacteria 2743
154 Ga0265319_1020629 3300028563 Bacteria 2436
155 Ga0265334_10000145 3300028573 Bacteria 44296
156 Ga0265318_10004811 3300028577 Bacteria 6464
157 Ga0265318_10190619 3300028577 Bacteria 750
158 Ga0265322_10030934 3300028654 Bacteria 1528
159 Ga0265336_10002833 3300028666 Bacteria 6994
160 Ga0265338_10003545 3300028800 Bacteria 21839
161 Ga0265338_10033312 3300028800 Bacteria 5002
162 Ga0265338_10044042 3300028800 Bacteria 4127
163 Ga0265338_10083425 3300028800 Bacteria 2673
164 Ga0265338_10175323 3300028800 Bacteria 1640
165 Ga0265338_10200906 3300028800 Bacteria 1503
166 Ga0265324_10001284 3300029957 Bacteria 14763
167 Ga0265330_10070813 3300031235 Bacteria 1509
168 Ga0265320_10008476 3300031240 Bacteria 6290
169 Ga0265329_10065627 3300031242 Bacteria 1148
170 Ga0265340_10022213 3300031247 Bacteria 3246
171 Ga0265327_10020906 3300031251 Bacteria 3969
172 Ga0265327_10067611 3300031251 Bacteria 1799
173 Ga0265316_10039745 3300031344 Bacteria 3776
174 Ga0265316_10040911 3300031344 Bacteria 3714
175 Ga0265316_10085516 3300031344 Bacteria 2413
176 Ga0265313_10239102 3300031595 Bacteria 744
177 Ga0265314_10055591 3300031711 Bacteria 2730
178 Ga0307405_10126392 3300031731 Bacteria 1759
179 Ga0307405_10520754 3300031731 Bacteria 957
180 Ga0307405_11082174 3300031731 Bacteria 688
181 Ga0307413_10242224 3300031824 Bacteria 1332
182 Ga0307413_10888218 3300031824 Bacteria 756
183 Ga0307410_10094910 3300031852 Bacteria 2126
184 Ga0307410_11244918 3300031852 Bacteria 649
185 Ga0307410_11343234 3300031852 Bacteria 626
186 Ga0307406_10716971 3300031901 Bacteria 837
187 Ga0307409_100114050 3300031995 Bacteria 2273
188 Ga0307409_100123805 3300031995 Bacteria 2195
189 Ga0307409_100142281 3300031995 Bacteria 2069
190 Ga0307409_100320137 3300031995 Bacteria 1451
191 Ga0307409_100722019 3300031995 Bacteria 998
192 Ga0307409_101232670 3300031995 Bacteria 772
193 Ga0307416_100256045 3300032002 Bacteria 1707
194 Ga0307414_10093793 3300032004 Bacteria 2239
195 Ga0307414_10649754 3300032004 Bacteria 951
196 Ga0307414_10902938 3300032004 Bacteria 810
197 Ga0307411_10691540 3300032005 Bacteria 887
198 Ga0307411_11065326 3300032005 Bacteria 727
199 Ga0307415_100184834 3300032126 Bacteria 1639
200 Ga0307415_100520443 3300032126 Bacteria 1044
201 Ga0307415_100801736 3300032126 Unclassified 860
202 Ga0307415_101019340 3300032126 Bacteria 770
203 Ga0307415_102134880 3300032126 Bacteria 547
204 Ga0373958_0023017 3300034819 Bacteria 1169
205 Ga0373928_0016410 3300035084 Bacteria 1516
206 Ga0373929_0005721 3300035085 Bacteria 2243
207 Ga0373929_0082565 3300035085 Bacteria 786
208 Ga0373940_0023264 3300035088 Bacteria 1598
209 Ga0373949_0011084 3300035090 Bacteria 1982
210 Ga0373949_0134838 3300035090 Bacteria 703
211 Ga0373932_0030559 3300035112 Bacteria 1494
212 Ga0373939_0007552 3300035114 Bacteria 2642
213 Ga0373960_0002800 3300035121 Bacteria 3952
214 Ga0373942_0023191 3300035207 Bacteria 1582
215 Ga0373931_0252171 3300035691 Bacteria 1073
216 Ga0373931_0907829 3300035691 Bacteria 592
217 Ga0395900_0573426 3300037418 Bacteria 1071
218 Ga0395898_0784992 3300037466 Bacteria 893
219 Ga0395905_1211073 3300037471 Bacteria 659
220 Ga0436364_1019648 3300037853 Unclassified 642
221 Ga0395901_0082490 3300038443 Bacteria 3359
222 Ga0395901_0436462 3300038443 Bacteria 1341
223 Ga0436363_1183340 3300039450 Bacteria 723
224 Ga0451791_1147034 3300041451 Bacteria 2839
225 Ga0451791_1251039 3300041451 Bacteria 1004
226 Ga0451793_0904998 3300041452 Bacteria 995
227 Ga0451797_0857017 3300041453 Bacteria 1766
228 Ga0451797_1079593 3300041453 Bacteria 741
229 Ga0451795_0526617 3300041456 Unclassified 1044
230 Ga0451795_1191501 3300041456 Bacteria 505
231 Ga0451798_0553728 3300041458 Bacteria 617
232 Ga0451802_1102294 3300041460 Bacteria 1141
233 Ga0451802_1184021 3300041460 Bacteria 810
234 Ga0451807_2178224 3300041486 Bacteria 690
235 Ga0451833_0280846 3300041491 Bacteria 3900
236 Ga0451835_0397258 3300041492 Bacteria 612
237 Ga0451837_0419415 3300041494 Bacteria 876
238 Ga0451837_1746334 3300041494 Bacteria 836
239 Ga0451839_0093631 3300041496 Bacteria 651
240 Ga0451839_0862786 3300041496 Bacteria 5724
241 Ga0451847_0642285 3300041503 Bacteria 771
242 Ga0451849_0270257 3300041505 Bacteria 647
243 Ga0451849_0653950 3300041505 Bacteria 562
244 Ga0451853_3339713 3300041512 Bacteria 797
245 Ga0439449_0383792 3300042007 Bacteria 533
246 Ga0450903_036199 3300042138 Bacteria 737
247 Ga0450907_060550 3300042146 Bacteria 653
248 Ga0439446_0135685 3300042156 Bacteria 801
249 Ga0439459_0059474 3300042438 Bacteria 860
250 Ga0466969_0064244 3300044656 Bacteria 1777
251 Ga0466972_0069317 3300044658 Bacteria 1684
252 Ga0466965_0014780 3300044683 Bacteria 3698
253 Ga0466965_0605216 3300044683 Bacteria 623
254 Ga0466966_0113808 3300044684 Bacteria 1666
255 Ga0466961_0033147 3300044693 Bacteria 3319
256 Ga0466971_0007113 3300044719 Bacteria 4871
257 Ga0466970_0053421 3300044765 Bacteria 2158
258 Ga0466970_0410253 3300044765 Bacteria 774
259 Ga0466970_0567910 3300044765 Bacteria 656
260 Ga0466957_0061450 3300044842 Bacteria 2306
261 Ga0466960_0001774 3300044901 Bacteria 7918
262 Ga0466960_0009879 3300044901 Bacteria 3946
263 Ga0466960_0016736 3300044901 Bacteria 3186
264 Ga0466960_0158925 3300044901 Bacteria 1212
265 Ga0466960_0270901 3300044901 Bacteria 949
266 Ga0466960_0666485 3300044901 Bacteria 622
267 Ga0466960_0776647 3300044901 Bacteria 579
268 Ga0466967_2270921 3300045976 Bacteria 538
269 Ga0495653_0495826 3300046463 Bacteria 762
270 Ga0495608_0010021 3300046511 Bacteria 6612
271 Ga0495630_1055709 3300046517 Bacteria 617
272 Ga0495663_0282445 3300046525 Unclassified 595
273 Ga0495668_0452281 3300046616 Bacteria 707
274 Ga0495680_0943647 3300047322 Bacteria 555
275 Ga0496100_0437806 3300048903 Bacteria 1000
276 Ga0496101_0171494 3300048904 Bacteria 1668
277 Ga0496101_0183616 3300048904 Bacteria 1611
278 Ga0496101_0340540 3300048904 Bacteria 1178
279 Ga0496102_0059406 3300048905 Bacteria 3496
280 Ga0496102_0476218 3300048905 Bacteria 1170
281 Ga0496102_0975803 3300048905 Bacteria 768
282 Ga0496103_0016571 3300048906 Bacteria 4397
283 Ga0496103_0146600 3300048906 Bacteria 1511
284 Ga0496104_0134973 3300048907 Bacteria 2370
285 Ga0496104_0158808 3300048907 Bacteria 2169
286 Ga0496105_0012774 3300048908 Bacteria 6652
287 Ga0496105_0811924 3300048908 Bacteria 710
288 Ga0496106_0246546 3300048909 Bacteria 1427
289 Ga0496106_0802501 3300048909 Bacteria 746
290 Ga0496107_0332984 3300048910 Bacteria 1129
291 Ga0496107_0490512 3300048910 Bacteria 911
292 Ga0496108_0094647 3300048911 Bacteria 2543
293 Ga0496108_1504542 3300048911 Bacteria 560
294 Ga0496109_0009747 3300048912 Bacteria 8198
295 Ga0496109_0047113 3300048912 Bacteria 3918
296 Ga0496110_0471392 3300048913 Bacteria 1144
297 Ga0496110_1203152 3300048913 Bacteria 667
298 Ga0496110_1623829 3300048913 Bacteria 556
299 Ga0496111_0061387 3300048914 Bacteria 2725
300 Ga0496111_0141874 3300048914 Bacteria 1780
301 Ga0496111_0567810 3300048914 Bacteria 832
302 Ga0496111_0590632 3300048914 Bacteria 813
303 Ga0496112_0002060 3300048915 Bacteria 15937
304 Ga0496112_0002277 3300048915 Bacteria 15347
305 Ga0496112_0003041 3300048915 Bacteria 13723
306 Ga0496112_0077449 3300048915 Bacteria 3288
307 Ga0496112_0210110 3300048915 Bacteria 1904
308 Ga0496113_0666691 3300048916 Bacteria 831
309 Ga0496114_0118838 3300048917 Bacteria 2271
310 Ga0496114_0403734 3300048917 Bacteria 1210
311 Ga0496114_0561542 3300048917 Bacteria 1008
312 Ga0496115_0085368 3300048918 Bacteria 2574
313 Ga0496115_0602191 3300048918 Bacteria 873
314 Ga0501031_0006592 3300049568 Bacteria 7574
315 Ga0501031_0133415 3300049568 Bacteria 1622
316 Ga0501031_0134491 3300049568 Bacteria 1615
317 Ga0501031_0142241 3300049568 Bacteria 1568
318 Ga0501031_0447813 3300049568 Bacteria 834
319 Ga0501031_0561159 3300049568 Bacteria 735
320 Ga0501032_0006417 3300049569 Bacteria 8655
321 Ga0501032_0248359 3300049569 Bacteria 1155
322 Ga0501032_0381970 3300049569 Bacteria 906
323 Ga0501033_0328722 3300049570 Bacteria 1073
324 Ga0501034_0039413 3300049571 Bacteria 4786
325 Ga0501034_0128627 3300049571 Bacteria 2517
326 Ga0501036_0002585 3300049572 Bacteria 14243
327 Ga0501036_0010648 3300049572 Bacteria 7597
328 Ga0501036_0106351 3300049572 Bacteria 2373
329 Ga0501036_0132376 3300049572 Bacteria 2105
330 Ga0501036_0276968 3300049572 Bacteria 1404
331 Ga0501036_0318912 3300049572 Bacteria 1299
332 Ga0501036_0605310 3300049572 Bacteria 909
333 Ga0501037_0162502 3300049573 Bacteria 1592
334 Ga0501037_0562114 3300049573 Bacteria 769
335 Ga0501038_0000962 3300049574 Bacteria 25777
336 Ga0501038_0042591 3300049574 Bacteria 3954
337 Ga0501038_0159216 3300049574 Bacteria 1836
338 Ga0501038_0246013 3300049574 Bacteria 1418
339 Ga0501039_0023887 3300049575 Bacteria 4694
340 Ga0501039_0040035 3300049575 Bacteria 3618
341 Ga0501039_0090626 3300049575 Bacteria 2383
342 Ga0501039_0218790 3300049575 Bacteria 1497
343 Ga0501039_0275206 3300049575 Bacteria 1323
344 Ga0501040_0014652 3300049576 Bacteria 5170
345 Ga0501040_0097569 3300049576 Bacteria 2048
346 Ga0501040_0104086 3300049576 Bacteria 1982
347 Ga0501040_0834911 3300049576 Bacteria 667
348 Ga0501041_0113395 3300049577 Bacteria 1682
349 Ga0501041_0134059 3300049577 Bacteria 1543
350 Ga0501041_0185946 3300049577 Bacteria 1301
351 Ga0501041_0528473 3300049577 Bacteria 751
352 Ga0501041_0729789 3300049577 Bacteria 634
353 Ga0501041_0963127 3300049577 Bacteria 549
354 Ga0501042_0016445 3300049578 Bacteria 5076
355 Ga0501042_0121943 3300049578 Bacteria 1877
356 Ga0501042_0153952 3300049578 Bacteria 1658
357 Ga0501042_0421910 3300049578 Bacteria 967
358 Ga0501042_0842709 3300049578 Bacteria 667
359 Ga0501042_1195631 3300049578 Bacteria 554
360 Ga0501043_0160628 3300049579 Bacteria 1756
361 Ga0501043_0644136 3300049579 Bacteria 779
362 Ga0501043_0783693 3300049579 Bacteria 691
363 Ga0501046_0575951 3300049580 Bacteria 801
364 Ga0501046_1246631 3300049580 Bacteria 509
365 Ga0501047_0001743 3300049581 Bacteria 21088
366 Ga0501048_0052018 3300049582 Bacteria 2914
367 Ga0501048_0814940 3300049582 Bacteria 671
368 Ga0501067_0358980 3300049583 Bacteria 812
369 Ga0501067_0501480 3300049583 Bacteria 679
370 Ga0501067_0651592 3300049583 Bacteria 591
371 Ga0501068_0079526 3300049584 Bacteria 2010
372 Ga0501068_0410426 3300049584 Bacteria 874
373 Ga0501069_0072490 3300049585 Bacteria 1931
374 Ga0501069_0109194 3300049585 Bacteria 1574
375 Ga0501070_0045686 3300049586 Bacteria 3642
376 Ga0501070_0211720 3300049586 Bacteria 1591
377 Ga0501070_0221030 3300049586 Bacteria 1553
378 Ga0501070_0375121 3300049586 Bacteria 1153
379 Ga0501071_0046632 3300049587 Bacteria 3112
380 Ga0501071_0061443 3300049587 Bacteria 2721
381 Ga0501071_0269005 3300049587 Bacteria 1288
382 Ga0501071_0974015 3300049587 Bacteria 655
383 Ga0501072_0114105 3300049588 Bacteria 2151
384 Ga0501072_0161652 3300049588 Bacteria 1786
385 Ga0501072_0291738 3300049588 Bacteria 1297
386 Ga0501072_0610418 3300049588 Bacteria 860
387 Ga0501073_0123836 3300049589 Bacteria 1792
388 Ga0501073_0443422 3300049589 Bacteria 897
389 Ga0501074_0097641 3300049590 Bacteria 2103
390 Ga0501074_0195732 3300049590 Bacteria 1441
391 Ga0501075_0193450 3300049591 Bacteria 1551
392 Ga0501075_0247480 3300049591 Bacteria 1359
393 Ga0501075_0254780 3300049591 Bacteria 1338
394 Ga0501075_0334181 3300049591 Bacteria 1155
395 Ga0501075_0343696 3300049591 Bacteria 1137
396 Ga0501075_0396156 3300049591 Bacteria 1053
397 Ga0501075_0909749 3300049591 Bacteria 669
398 Ga0501076_0023737 3300049592 Bacteria 4730
399 Ga0501076_0113298 3300049592 Bacteria 2194
400 Ga0501076_0513527 3300049592 Bacteria 988
401 Ga0501076_0526934 3300049592 Bacteria 974
402 Ga0501076_1022868 3300049592 Bacteria 681
403 Ga0501077_0027572 3300049593 Bacteria 3607
404 Ga0501077_0864448 3300049593 Bacteria 582
405 Ga0501079_0144188 3300049741 Bacteria 1856
406 Ga0501079_0310529 3300049741 Bacteria 1234
407 Ga0501079_0624389 3300049741 Bacteria 848
408 Ga0501079_1420694 3300049741 Bacteria 546
409 Ga0501081_0157391 3300049743 Bacteria 1635
410 Ga0501083_0736579 3300049744 Bacteria 641
411 Ga0501035_0007502 3300049822 Bacteria 10187
412 Ga0501035_0023521 3300049822 Bacteria 5653
413 Ga0501035_0538184 3300049822 Bacteria 958
414 Ga0501035_0721722 3300049822 Bacteria 802
415 Ga0501035_1028858 3300049822 Bacteria 646
416 Ga0501044_0181567 3300049823 Bacteria 2071
417 Ga0501044_0497469 3300049823 Bacteria 1121
418 Ga0501044_0861295 3300049823 Bacteria 782
419 Ga0501045_0003310 3300049824 Bacteria 11015
420 Ga0501045_0082890 3300049824 Bacteria 2365
421 Ga0501045_0266549 3300049824 Bacteria 1275
422 nmdc:mga03n38_180723_c1 3300050490 Bacteria 1081
423 nmdc:mga03n38_206607_c1 3300050490 Bacteria 1019
424 nmdc:mga03n38_22221_c1 3300050490 Bacteria 2565
425 nmdc:mga03n38_241644_c1 3300050490 Bacteria 950
426 nmdc:mga03n38_266740_c1 3300050490 Bacteria 909
427 nmdc:mga03n38_307917_c1 3300050490 Bacteria 852
428 nmdc:mga03n38_46142_c1 3300050490 Bacteria 1922
429 nmdc:mga00v17_12697_c1 3300050491 Bacteria 4652
430 nmdc:mga00v17_155649_c1 3300050491 Bacteria 1470
431 nmdc:mga00v17_258297_c1 3300050491 Bacteria 1130
432 nmdc:mga00v17_354207_c1 3300050491 Bacteria 954
433 nmdc:mga00v17_47037_c1 3300050491 Bacteria 2612
434 nmdc:mga00v17_64326_c1 3300050491 Bacteria 2260
435 nmdc:mga00v17_843734_c1 3300050491 Bacteria 582
436 nmdc:mga0yw44_12518_c1 3300050492 Bacteria 4427
437 nmdc:mga0yw44_24771_c1 3300050492 Bacteria 3401
438 nmdc:mga0yw44_347238_c1 3300050492 Bacteria 999
439 nmdc:mga0yw44_404915_c1 3300050492 Bacteria 923
440 nmdc:mga0yw44_647889_c1 3300050492 Bacteria 718
441 nmdc:mga0yw44_778551_c1 3300050492 Bacteria 650
442 nmdc:mga0yw44_833693_c1 3300050492 Bacteria 626
443 nmdc:mga06z11_185345_c1 3300050494 Bacteria 1202
444 nmdc:mga06z11_20871_c1 3300050494 Bacteria 3034
445 nmdc:mga06z11_235883_c1 3300050494 Bacteria 1073
446 nmdc:mga06z11_4363_c1 3300050494 Bacteria 5563
447 nmdc:mga06z11_47797_c1 3300050494 Bacteria 2174
448 nmdc:mga04h51_46225_c1 3300050495 Bacteria 1442
449 nmdc:mga04h51_99776_c1 3300050495 Bacteria 1057
450 nmdc:mga07m45_126343_c1 3300050496 Bacteria 1479
451 nmdc:mga07m45_607073_c1 3300050496 Bacteria 632
452 nmdc:mga07m45_69076_c1 3300050496 Bacteria 2008
453 nmdc:mga07m45_710249_c1 3300050496 Bacteria 578
454 nmdc:mga0n895_340807_c1 3300050512 Bacteria 1518
455 nmdc:mga08x19_284577_c1 3300050514 Bacteria 1146
456 Ga0495595_0062718 3300053084 Bacteria 1744
457 Ga0495619_0610414 3300053085 Bacteria 746
458 Ga0500568_0117314 3300053139 Bacteria 993
459 Ga0500573_0048056 3300053140 Bacteria 2456
460 Ga0500604_0234665 3300053151 Bacteria 634
461 Ga0501084_0033111 3300054114 Bacteria 4323
462 Ga0501084_0441531 3300054114 Bacteria 1100
463 Ga0501084_0548479 3300054114 Bacteria 977
464 Ga0501084_0692168 3300054114 Bacteria 860
465 Ga0501084_1366126 3300054114 Bacteria 593
466 Ga0501082_0103491 3300060353 Bacteria 2463
467 Ga0501082_0395701 3300060353 Bacteria 1206
468 Ga0501082_0678467 3300060353 Bacteria 902
469 Ga0501082_0743187 3300060353 Bacteria 859
470 Ga0466962_0021723 3300061719 Bacteria 3080
471 Ga0530510_0081002 3300061734 Bacteria 2363
472 Ga0530510_0494631 3300061734 Bacteria 927
473 Ga0530510_0916889 3300061734 Bacteria 670
474 Ga0530510_1235825 3300061734 Bacteria 573
475 2643826782 2643221561 Bacteria 4984412
476 2644092831 2643221615 Bacteria 5487866
477 2644228208 2643221641 Bacteria 4490190
478 2644322444 2643221657 Bacteria 5490246
479 2644534135 2643221696 Bacteria 5431823
480 2740165703 2739367898 Bacteria 4367674
481 2883823222 2883821847 Bacteria 5121194
482 2984578517 2984576629 Bacteria 4248407
483 2990259325 2990256926 Bacteria 4252839
484 8054612192 8054609563 Bacteria 5170090
485 Ga0307406_10061266
486 Ga0070658_10854782
487 Ga0070658_11241248
488 Ga0070683_100734486
489 Ga0070682_100061423
490 Ga0068868_100957228
491 Ga0070660_101046917
492 Ga0070661_100415798
493 Ga0070671_101026916
494 Ga0070673_100319221
495 Ga0070659_100115340
496 Ga0070667_100108459
497 Ga0070714_100861326
498 Ga0070701_10420754
499 Ga0070711_100914180
500 Ga0070705_100197691
501 Ga0070700_100612433
502 Ga0070663_100057758
503 Ga0070663_100330834
504 Ga0070678_100043960
505 Ga0070698_100562299
506 Ga0070679_100265422
507 Ga0070672_101071624
508 Ga0070696_100011731
509 Ga0070693_100043545
510 Ga0070665_100060800
511 Ga0070664_100071817
512 Ga0070664_100303868
513 Ga0070664_100733023
514 Ga0070664_101089901
515 Ga0068856_100745757
516 Ga0068861_100181035
517 Ga0068870_10194829
518 Ga0068863_101153224
519 Ga0068860_100001322
520 Ga0068860_100764222
521 Ga0081455_10291212
522 Ga0081539_10019051
523 Ga0081539_10184118
524 Ga0070717_10046623
525 Ga0075365_10008963
526 Ga0075365_10019477
527 Ga0075365_10032240
528 Ga0075365_10048578
529 Ga0075365_10049222
530 Ga0075365_10051203
531 Ga0075365_10061354
532 Ga0075365_10063963
533 Ga0075365_10104166
534 Ga0075365_10131745
535 Ga0075365_10437549
536 Ga0075365_10824730
537 Ga0075365_11047987
538 Ga0075368_10024971
539 Ga0075363_100002065
540 Ga0075363_100003853
541 Ga0075363_100183083
542 Ga0075363_100234684
543 Ga0075363_100301656
544 Ga0075363_100525187
545 Ga0075363_100543126
546 Ga0075363_100727085
547 Ga0075364_10012745
548 Ga0075364_10054973
549 Ga0075364_10056349
550 Ga0075364_10099855
551 Ga0075364_10159454
552 Ga0075364_10171039
553 Ga0075364_10368416
554 Ga0075364_11073130
555 Ga0070715_10009855
556 Ga0070716_100064483
557 Ga0070712_100000186
558 Ga0075362_10264646
559 Ga0075367_10014665
560 Ga0075367_10032979
561 Ga0075367_10035687
562 Ga0075367_10367546
563 Ga0075367_10445421
564 Ga0075367_10789514
565 Ga0097621_100245816
566 Ga0075370_10040786
567 Ga0075370_10319671
568 Ga0075370_10576763
569 Ga0075370_10717689
570 Ga0068871_100074167
571 Ga0075434_100271585
572 Ga0105245_10010457
573 Ga0105241_10084259
574 Ga0105237_10524319
575 Ga0105238_10654059
576 Ga0105238_11537462
577 Ga0105238_12006028
578 Ga0105239_10147548
579 Ga0105239_10676445
580 Ga0105239_11606167
581 Ga0105246_10493336
582 Ga0105246_11808526
583 Ga0157317_1029113
584 Ga0157378_10577592
585 Ga0157372_11729248
586 Ga0157375_10793172
587 Ga0157375_10892592
588 Ga0163163_11500345
589 Ga0157380_10610379
590 Ga0157379_10004216
591 Ga0157376_10005763
592 Ga0206354_10152586
593 Ga0207692_10194813
594 Ga0207692_10655699
595 Ga0207688_10656094
596 Ga0207643_10513618
597 Ga0207705_11141164
598 Ga0207654_10256606
599 Ga0207671_10306384
600 Ga0207693_10000115
601 Ga0207693_10049762
602 Ga0207693_10052567
603 Ga0207663_10018872
604 Ga0207662_10185310
605 Ga0207657_10149069
606 Ga0207649_10552522
607 Ga0207652_10350431
608 Ga0207687_10176629
609 Ga0207700_10413695
610 Ga0207664_10135949
611 Ga0207706_10048695
612 Ga0207669_11553364
613 Ga0207665_10003605
614 Ga0207691_10760321
615 Ga0207661_10951846
616 Ga0207679_10080776
617 Ga0207679_10537787
618 Ga0207679_11309889
619 Ga0207678_10021625
620 Ga0207678_10048495
621 Ga0207678_10093808
622 Ga0207708_10358489
623 Ga0207702_10020480
624 Ga0207702_10819649
625 Ga0207641_11203796
626 Ga0207648_11130620
627 Ga0207675_100079585
628 Ga0207675_100881680
629 Ga0207683_10004132
630 Ga0209813_10313445
631 Ga0207428_10278971
632 Ga0268266_10401965
633 Ga0268265_12510849
634 Ga0268264_10001092
635 Ga0265326_10000061
636 Ga0265319_1002074
637 Ga0265319_1017296
638 Ga0265319_1020629
639 Ga0265334_10000145
640 Ga0265318_10004811
641 Ga0265318_10190619
642 Ga0265322_10030934
643 Ga0265336_10002833
644 Ga0265338_10003545
645 Ga0265338_10033312
646 Ga0265338_10044042
647 Ga0265338_10083425
648 Ga0265338_10175323
649 Ga0265338_10200906
650 Ga0265324_10001284
651 Ga0265330_10070813
652 Ga0265320_10008476
653 Ga0265329_10065627
654 Ga0265340_10022213
655 Ga0265327_10020906
656 Ga0265327_10067611
657 Ga0265316_10039745
658 Ga0265316_10040911
659 Ga0265316_10085516
660 Ga0265313_10239102
661 Ga0265314_10055591
662 Ga0307405_10126392
663 Ga0307405_10520754
664 Ga0307405_11082174
665 Ga0307413_10242224
666 Ga0307413_10888218
667 Ga0307410_10094910
668 Ga0307410_11244918
669 Ga0307410_11343234
670 Ga0307406_10716971
671 Ga0307409_100114050
672 Ga0307409_100123805
673 Ga0307409_100142281
674 Ga0307409_100320137
675 Ga0307409_100722019
676 Ga0307409_101232670
677 Ga0307416_100256045
678 Ga0307414_10093793
679 Ga0307414_10649754
680 Ga0307414_10902938
681 Ga0307411_10691540
682 Ga0307411_11065326
683 Ga0307415_100184834
684 Ga0307415_100520443
685 Ga0307415_100801736
686 Ga0307415_101019340
687 Ga0307415_102134880
688 Ga0373958_0023017
689 Ga0373928_0016410
690 Ga0373929_0005721
691 Ga0373929_0082565
692 Ga0373940_0023264
693 Ga0373949_0011084
694 Ga0373949_0134838
695 Ga0373932_0030559
696 Ga0373939_0007552
697 Ga0373960_0002800
698 Ga0373942_0023191
699 Ga0373931_0252171
700 Ga0373931_0907829
701 Ga0395900_0573426
702 Ga0395898_0784992
703 Ga0395905_1211073
704 Ga0436364_1019648
705 Ga0395901_0082490
706 Ga0395901_0436462
707 Ga0436363_1183340
708 Ga0451791_1147034
709 Ga0451791_1251039
710 Ga0451793_0904998
711 Ga0451797_0857017
712 Ga0451797_1079593
713 Ga0451795_0526617
714 Ga0451795_1191501
715 Ga0451798_0553728
716 Ga0451802_1102294
717 Ga0451802_1184021
718 Ga0451807_2178224
719 Ga0451833_0280846
720 Ga0451835_0397258
721 Ga0451837_0419415
722 Ga0451837_1746334
723 Ga0451839_0093631
724 Ga0451839_0862786
725 Ga0451847_0642285
726 Ga0451849_0270257
727 Ga0451849_0653950
728 Ga0451853_3339713
729 Ga0439449_0383792
730 Ga0450903_036199
731 Ga0450907_060550
732 Ga0439446_0135685
733 Ga0439459_0059474
734 Ga0466969_0064244
735 Ga0466972_0069317
736 Ga0466965_0014780
737 Ga0466965_0605216
738 Ga0466966_0113808
739 Ga0466961_0033147
740 Ga0466971_0007113
741 Ga0466970_0053421
742 Ga0466970_0410253
743 Ga0466970_0567910
744 Ga0466957_0061450
745 Ga0466960_0001774
746 Ga0466960_0009879
747 Ga0466960_0016736
748 Ga0466960_0158925
749 Ga0466960_0270901
750 Ga0466960_0666485
751 Ga0466960_0776647
752 Ga0466967_2270921
753 Ga0495653_0495826
754 Ga0495608_0010021
755 Ga0495630_1055709
756 Ga0495663_0282445
757 Ga0495668_0452281
758 Ga0495680_0943647
759 Ga0496100_0437806
760 Ga0496101_0171494
761 Ga0496101_0183616
762 Ga0496101_0340540
763 Ga0496102_0059406
764 Ga0496102_0476218
765 Ga0496102_0975803
766 Ga0496103_0016571
767 Ga0496103_0146600
768 Ga0496104_0134973
769 Ga0496104_0158808
770 Ga0496105_0012774
771 Ga0496105_0811924
772 Ga0496106_0246546
773 Ga0496106_0802501
774 Ga0496107_0332984
775 Ga0496107_0490512
776 Ga0496108_0094647
777 Ga0496108_1504542
778 Ga0496109_0009747
779 Ga0496109_0047113
780 Ga0496110_0471392
781 Ga0496110_1203152
782 Ga0496110_1623829
783 Ga0496111_0061387
784 Ga0496111_0141874
785 Ga0496111_0567810
786 Ga0496111_0590632
787 Ga0496112_0002060
788 Ga0496112_0002277
789 Ga0496112_0003041
790 Ga0496112_0077449
791 Ga0496112_0210110
792 Ga0496113_0666691
793 Ga0496114_0118838
794 Ga0496114_0403734
795 Ga0496114_0561542
796 Ga0496115_0085368
797 Ga0496115_0602191
798 Ga0501031_0006592
799 Ga0501031_0133415
800 Ga0501031_0134491
801 Ga0501031_0142241
802 Ga0501031_0447813
803 Ga0501031_0561159
804 Ga0501032_0006417
805 Ga0501032_0248359
806 Ga0501032_0381970
807 Ga0501033_0328722
808 Ga0501034_0039413
809 Ga0501034_0128627
810 Ga0501036_0002585
811 Ga0501036_0010648
812 Ga0501036_0106351
813 Ga0501036_0132376
814 Ga0501036_0276968
815 Ga0501036_0318912
816 Ga0501036_0605310
817 Ga0501037_0162502
818 Ga0501037_0562114
819 Ga0501038_0000962
820 Ga0501038_0042591
821 Ga0501038_0159216
822 Ga0501038_0246013
823 Ga0501039_0023887
824 Ga0501039_0040035
825 Ga0501039_0090626
826 Ga0501039_0218790
827 Ga0501039_0275206
828 Ga0501040_0014652
829 Ga0501040_0097569
830 Ga0501040_0104086
831 Ga0501040_0834911
832 Ga0501041_0113395
833 Ga0501041_0134059
834 Ga0501041_0185946
835 Ga0501041_0528473
836 Ga0501041_0729789
837 Ga0501041_0963127
838 Ga0501042_0016445
839 Ga0501042_0121943
840 Ga0501042_0153952
841 Ga0501042_0421910
842 Ga0501042_0842709
843 Ga0501042_1195631
844 Ga0501043_0160628
845 Ga0501043_0644136
846 Ga0501043_0783693
847 Ga0501046_0575951
848 Ga0501046_1246631
849 Ga0501047_0001743
850 Ga0501048_0052018
851 Ga0501048_0814940
852 Ga0501067_0358980
853 Ga0501067_0501480
854 Ga0501067_0651592
855 Ga0501068_0079526
856 Ga0501068_0410426
857 Ga0501069_0072490
858 Ga0501069_0109194
859 Ga0501070_0045686
860 Ga0501070_0211720
861 Ga0501070_0221030
862 Ga0501070_0375121
863 Ga0501071_0046632
864 Ga0501071_0061443
865 Ga0501071_0269005
866 Ga0501071_0974015
867 Ga0501072_0114105
868 Ga0501072_0161652
869 Ga0501072_0291738
870 Ga0501072_0610418
871 Ga0501073_0123836
872 Ga0501073_0443422
873 Ga0501074_0097641
874 Ga0501074_0195732
875 Ga0501075_0193450
876 Ga0501075_0247480
877 Ga0501075_0254780
878 Ga0501075_0334181
879 Ga0501075_0343696
880 Ga0501075_0396156
881 Ga0501075_0909749
882 Ga0501076_0023737
883 Ga0501076_0113298
884 Ga0501076_0513527
885 Ga0501076_0526934
886 Ga0501076_1022868
887 Ga0501077_0027572
888 Ga0501077_0864448
889 Ga0501079_0144188
890 Ga0501079_0310529
891 Ga0501079_0624389
892 Ga0501079_1420694
893 Ga0501081_0157391
894 Ga0501083_0736579
895 Ga0501035_0007502
896 Ga0501035_0023521
897 Ga0501035_0538184
898 Ga0501035_0721722
899 Ga0501035_1028858
900 Ga0501044_0181567
901 Ga0501044_0497469
902 Ga0501044_0861295
903 Ga0501045_0003310
904 Ga0501045_0082890
905 Ga0501045_0266549
906 nmdc:mga03n38_180723_c1
907 nmdc:mga03n38_206607_c1
908 nmdc:mga03n38_22221_c1
909 nmdc:mga03n38_241644_c1
910 nmdc:mga03n38_266740_c1
911 nmdc:mga03n38_307917_c1
912 nmdc:mga03n38_46142_c1
913 nmdc:mga00v17_12697_c1
914 nmdc:mga00v17_155649_c1
915 nmdc:mga00v17_258297_c1
916 nmdc:mga00v17_354207_c1
917 nmdc:mga00v17_47037_c1
918 nmdc:mga00v17_64326_c1
919 nmdc:mga00v17_843734_c1
920 nmdc:mga0yw44_12518_c1
921 nmdc:mga0yw44_24771_c1
922 nmdc:mga0yw44_347238_c1
923 nmdc:mga0yw44_404915_c1
924 nmdc:mga0yw44_647889_c1
925 nmdc:mga0yw44_778551_c1
926 nmdc:mga0yw44_833693_c1
927 nmdc:mga06z11_185345_c1
928 nmdc:mga06z11_20871_c1
929 nmdc:mga06z11_235883_c1
930 nmdc:mga06z11_4363_c1
931 nmdc:mga06z11_47797_c1
932 nmdc:mga04h51_46225_c1
933 nmdc:mga04h51_99776_c1
934 nmdc:mga07m45_126343_c1
935 nmdc:mga07m45_607073_c1
936 nmdc:mga07m45_69076_c1
937 nmdc:mga07m45_710249_c1
938 nmdc:mga0n895_340807_c1
939 nmdc:mga08x19_284577_c1
940 Ga0495595_0062718
941 Ga0495619_0610414
942 Ga0500568_0117314
943 Ga0500573_0048056
944 Ga0500604_0234665
945 Ga0501084_0033111
946 Ga0501084_0441531
947 Ga0501084_0548479
948 Ga0501084_0692168
949 Ga0501084_1366126
950 Ga0501082_0103491
951 Ga0501082_0395701
952 Ga0501082_0678467
953 Ga0501082_0743187
954 Ga0466962_0021723
955 Ga0530510_0081002
956 Ga0530510_0494631
957 Ga0530510_0916889
958 Ga0530510_1235825
959 2643826782
960 2644092831
961 2644228208
962 2644322444
963 2644534135
964 2740165703
965 2883823222
966 2984578517
967 2990259325
968 8054612192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

24

154

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9138 26 67
4hf2-assembly1.cif.gz_A crystal structure of e43a iscr mutant bound to its promoter 0.9128 1 132
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9104 10 67
4hf2-assembly1.cif.gz_B crystal structure of e43a iscr mutant bound to its promoter 0.9048 1 133
5zup-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9025 26 67
ID Description Score Start End Superfamily
af_P9WME3_1_141_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9446 1 140 1.10.10.10
af_P9WME3_1_141_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9318 1 140 1.10.10.10
af_P64638_1_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9252 10 61 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9138 26 67 1.10.10.10
4hf2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9128 1 132 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W1V5V0-F1-model_v4 Rrf2 family transcriptional regulator 0.9843 1 152 GO:0003700
GO:0005829
AF-A0A542S4G1-F1-model_v4 BadM/Rrf2 family transcriptional regulator 0.9839 1 152 GO:0003700
GO:0005829
AF-A0A0P0E7X7-F1-model_v4 Rrf2 family transcriptional regulator 0.9837 1 150 GO:0003700
GO:0005829
AF-A0A6J4N995-F1-model_v4 Predicted transcriptional regulator of sulfate adenylyltransferase, Rrf2 family 0.9833 1 152 GO:0003700
GO:0005829
GO:0016779
AF-A0A2E2Q0J1-F1-model_v4 Transcriptional regulator 0.9825 1 152 GO:0003700
GO:0005829

Map