F452831

General Info

Members Datasets Scaffolds Average Seq Length
483 269 966 164

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0110637|Ga0496103_0110637_88_675
Length 195
Sequence MGSVANFASILQPAVQLCIGAPGRPPLWQAVPVTEEREELSWELFGRAGRELAVMIAEDGYRPDLIMSIARGGVFVAGSLGYALDVKNLHLVNVEFYTGVDQRLELPVMLPPVPQLVDLSGARVLIADDVADTGATLQLVKEFCQDKVAEVRTAVIYEKPRSSVKCEYAWRHTDRWINFPWSVQGPVVLAANRDA

Samples

Sample ID Description Type Environment
1 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
183 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
246 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
247 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
248 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
249 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
250 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
255 2558860280 Kutzneria sp. 744 Isolate Unclassified
256 2582580736 Prauserella sp. Am3 Isolate Unclassified
257 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
258 2643221615 Nocardioides sp. Root224 Isolate Unclassified
259 2643221641 Nocardioides sp. Root122 Isolate Unclassified
260 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
261 2739367898 Nocardioides sp. CF479 Isolate Unclassified
262 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
263 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
264 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
265 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
266 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
267 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
268 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
269 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 0.21
Isolates 3.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0.21
Rhizoplane 5.8
Rhizosphere 81.57
Stem 0
Stem Tuber 0.21
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496103_0110637 3300048906 Bacteria 1745
2 JGI24737J22298_10017890 3300001990 Bacteria 2279
3 JGI24735J21928_10205047 3300002067 Bacteria 572
4 rootH2_10088501 3300003320 Bacteria 6653
5 Ga0070658_10341109 3300005327 Bacteria 1281
6 Ga0070658_10801916 3300005327 Bacteria 818
7 Ga0070676_10045263 3300005328 Bacteria 2563
8 Ga0070683_100008022 3300005329 Bacteria 8961
9 Ga0070683_100052516 3300005329 Bacteria 3776
10 Ga0070670_100065585 3300005331 Bacteria 3115
11 Ga0068869_100071191 3300005334 Bacteria 2574
12 Ga0068869_100684929 3300005334 Bacteria 873
13 Ga0070666_10832304 3300005335 Bacteria 681
14 Ga0070682_100063351 3300005337 Bacteria 2344
15 Ga0070682_100092012 3300005337 Bacteria 1986
16 Ga0068868_100056594 3300005338 Bacteria 3097
17 Ga0068868_100239020 3300005338 Bacteria 1525
18 Ga0068868_100817780 3300005338 Bacteria 842
19 Ga0070660_100041406 3300005339 Bacteria 3511
20 Ga0070660_100097079 3300005339 Bacteria 2331
21 Ga0070660_100151100 3300005339 Bacteria 1867
22 Ga0070689_100138796 3300005340 Bacteria 1954
23 Ga0070691_10280804 3300005341 Bacteria 903
24 Ga0070687_100026795 3300005343 Bacteria 2779
25 Ga0070687_100057359 3300005343 Bacteria 2042
26 Ga0070661_100014942 3300005344 Bacteria 5477
27 Ga0070661_100413814 3300005344 Bacteria 1068
28 Ga0070692_10011776 3300005345 Bacteria 4028
29 Ga0070692_10403297 3300005345 Bacteria 864
30 Ga0070668_100000514 3300005347 Bacteria 25634
31 Ga0070668_100088958 3300005347 Bacteria 2432
32 Ga0070668_100108201 3300005347 Bacteria 2211
33 Ga0070668_100795771 3300005347 Bacteria 840
34 Ga0070669_100234116 3300005353 Bacteria 1457
35 Ga0070675_100007054 3300005354 Bacteria 8643
36 Ga0070675_100121967 3300005354 Bacteria 2215
37 Ga0070671_100346459 3300005355 Bacteria 1268
38 Ga0070671_100681638 3300005355 Bacteria 891
39 Ga0070673_101505992 3300005364 Bacteria 634
40 Ga0070688_100328956 3300005365 Bacteria 1113
41 Ga0070659_100016751 3300005366 Bacteria 5506
42 Ga0070659_100018690 3300005366 Bacteria 5232
43 Ga0070709_11067019 3300005434 Bacteria 645
44 Ga0070714_100463787 3300005435 Bacteria 1204
45 Ga0070713_100115456 3300005436 Bacteria 2346
46 Ga0070713_100334557 3300005436 Bacteria 1401
47 Ga0070700_100281081 3300005441 Bacteria 1207
48 Ga0070694_100522471 3300005444 Bacteria 947
49 Ga0070708_100886382 3300005445 Bacteria 838
50 Ga0070663_100031814 3300005455 Bacteria 3630
51 Ga0070663_100292016 3300005455 Bacteria 1302
52 Ga0070663_100496170 3300005455 Bacteria 1013
53 Ga0070663_100598585 3300005455 Bacteria 927
54 Ga0070678_100048922 3300005456 Bacteria 3048
55 Ga0070662_100140891 3300005457 Bacteria 1868
56 Ga0070685_10218474 3300005466 Bacteria 1247
57 Ga0070707_101898862 3300005468 Bacteria 563
58 Ga0070698_100123790 3300005471 Bacteria 2544
59 Ga0070699_100476130 3300005518 Bacteria 1133
60 Ga0070679_100168763 3300005530 Bacteria 2161
61 Ga0070679_100708433 3300005530 Bacteria 949
62 Ga0070684_100040203 3300005535 Bacteria 4026
63 Ga0070684_100820874 3300005535 Bacteria 870
64 Ga0068853_100422587 3300005539 Bacteria 1250
65 Ga0070672_100968455 3300005543 Bacteria 753
66 Ga0070693_100296219 3300005547 Bacteria 1089
67 Ga0070665_100052463 3300005548 Bacteria 4090
68 Ga0070665_100063380 3300005548 Bacteria 3706
69 Ga0070665_100095744 3300005548 Bacteria 2974
70 Ga0070665_100192053 3300005548 Bacteria 2043
71 Ga0070665_100661332 3300005548 Bacteria 1058
72 Ga0068855_100014099 3300005563 Bacteria 9632
73 Ga0068855_100134535 3300005563 Bacteria 2821
74 Ga0070664_100039802 3300005564 Bacteria 3962
75 Ga0070664_100388735 3300005564 Bacteria 1274
76 Ga0068857_100021381 3300005577 Bacteria 5695
77 Ga0068857_100201803 3300005577 Bacteria 1813
78 Ga0068857_100226821 3300005577 Bacteria 1707
79 Ga0068857_100574201 3300005577 Bacteria 1064
80 Ga0068854_100022622 3300005578 Bacteria 4286
81 Ga0068856_100044281 3300005614 Bacteria 4379
82 Ga0068856_100065397 3300005614 Bacteria 3594
83 Ga0068856_100209616 3300005614 Bacteria 1964
84 Ga0068856_100404721 3300005614 Bacteria 1384
85 Ga0070702_100011013 3300005615 Bacteria 4484
86 Ga0070702_100039328 3300005615 Bacteria 2639
87 Ga0070702_100437917 3300005615 Bacteria 945
88 Ga0068852_100019150 3300005616 Bacteria 5410
89 Ga0068852_100062917 3300005616 Bacteria 3229
90 Ga0068852_100071052 3300005616 Bacteria 3055
91 Ga0068852_100870531 3300005616 Bacteria 917
92 Ga0068859_100001140 3300005617 Bacteria 27061
93 Ga0068859_100286609 3300005617 Bacteria 1740
94 Ga0068859_100420614 3300005617 Bacteria 1432
95 Ga0068864_100191420 3300005618 Bacteria 1875
96 Ga0068864_100481507 3300005618 Bacteria 1191
97 Ga0068864_101405507 3300005618 Bacteria 700
98 Ga0068864_101602145 3300005618 Bacteria 655
99 Ga0068861_100027268 3300005719 Bacteria 4159
100 Ga0068861_100079260 3300005719 Bacteria 2567
101 Ga0068870_10040220 3300005840 Bacteria 2423
102 Ga0068870_10106825 3300005840 Bacteria 1592
103 Ga0068863_100380728 3300005841 Bacteria 1378
104 Ga0068863_100589444 3300005841 Bacteria 1100
105 Ga0068858_100044201 3300005842 Bacteria 4130
106 Ga0068858_100893388 3300005842 Bacteria 869
107 Ga0068860_100594385 3300005843 Bacteria 1112
108 Ga0068860_100717280 3300005843 Bacteria 1010
109 Ga0068860_100929807 3300005843 Bacteria 886
110 Ga0068862_100064450 3300005844 Bacteria 3154
111 Ga0068862_100077671 3300005844 Bacteria 2875
112 Ga0068862_101093968 3300005844 Bacteria 792
113 Ga0081538_10077851 3300005981 Bacteria 1783
114 Ga0070717_10031509 3300006028 Bacteria 4266
115 Ga0070717_10593249 3300006028 Bacteria 1005
116 Ga0075365_10004913 3300006038 Bacteria 7148
117 Ga0075368_10017393 3300006042 Bacteria 2691
118 Ga0070716_100243032 3300006173 Bacteria 1222
119 Ga0070716_100425901 3300006173 Bacteria 961
120 Ga0075367_10231066 3300006178 Bacteria 1158
121 Ga0075367_10289146 3300006178 Bacteria 1031
122 Ga0075370_10316515 3300006353 Bacteria 929
123 Ga0075370_10409371 3300006353 Bacteria 814
124 Ga0068871_100167139 3300006358 Bacteria 1884
125 Ga0075428_100396210 3300006844 Bacteria 1480
126 Ga0075430_100186083 3300006846 Bacteria 1727
127 Ga0075430_100272123 3300006846 Bacteria 1402
128 Ga0068865_100122537 3300006881 Bacteria 1936
129 Ga0068865_101050916 3300006881 Bacteria 715
130 Ga0075436_100144119 3300006914 Bacteria 1675
131 Ga0097620_100001140 3300006931 Bacteria 27061
132 Ga0097620_100286590 3300006931 Bacteria 1740
133 Ga0097620_100420600 3300006931 Bacteria 1432
134 Ga0105251_10140038 3300009011 Bacteria 1095
135 Ga0105240_10029124 3300009093 Bacteria 7200
136 Ga0105240_10133920 3300009093 Bacteria 2969
137 Ga0111539_10000944 3300009094 Bacteria 38074
138 Ga0111539_10091358 3300009094 Bacteria 3577
139 Ga0111539_10715122 3300009094 Bacteria 1166
140 Ga0105245_10010209 3300009098 Bacteria 8177
141 Ga0105245_10290059 3300009098 Bacteria 1602
142 Ga0105245_10626135 3300009098 Bacteria 1104
143 Ga0105245_10680024 3300009098 Bacteria 1061
144 Ga0105245_10822778 3300009098 Bacteria 967
145 Ga0105245_11084854 3300009098 Bacteria 847
146 Ga0105247_10014833 3300009101 Bacteria 4671
147 Ga0105247_10512750 3300009101 Bacteria 875
148 Ga0114129_10378691 3300009147 Bacteria 1869
149 Ga0105243_10290213 3300009148 Bacteria 1477
150 Ga0105243_10298893 3300009148 Bacteria 1458
151 Ga0105241_10192904 3300009174 Bacteria 1697
152 Ga0105241_10288505 3300009174 Bacteria 1404
153 Ga0105241_10308312 3300009174 Bacteria 1361
154 Ga0105241_10440232 3300009174 Bacteria 1151
155 Ga0105242_10086736 3300009176 Bacteria 2627
156 Ga0105248_11193880 3300009177 Bacteria 860
157 Ga0105237_10152611 3300009545 Bacteria 2306
158 Ga0105237_10315192 3300009545 Bacteria 1567
159 Ga0105237_10363247 3300009545 Bacteria 1452
160 Ga0105237_10656716 3300009545 Bacteria 1055
161 Ga0105237_12027193 3300009545 Bacteria 584
162 Ga0105238_10164106 3300009551 Bacteria 2197
163 Ga0105238_10240261 3300009551 Bacteria 1789
164 Ga0105249_10051741 3300009553 Bacteria 3748
165 Ga0105239_10019407 3300010375 Bacteria 7507
166 Ga0105239_10049537 3300010375 Bacteria 4606
167 Ga0105239_10050879 3300010375 Bacteria 4543
168 Ga0105239_10083306 3300010375 Bacteria 3522
169 Ga0105239_10287321 3300010375 Bacteria 1852
170 Ga0105239_10652919 3300010375 Bacteria 1202
171 Ga0105239_11466021 3300010375 Bacteria 788
172 Ga0105246_10730893 3300011119 Bacteria 871
173 Ga0157342_1013767 3300012507 Bacteria 868
174 Ga0157369_10312881 3300013105 Bacteria 1633
175 Ga0157374_10390734 3300013296 Bacteria 1387
176 Ga0157374_10452678 3300013296 Bacteria 1285
177 Ga0157374_10631303 3300013296 Bacteria 1082
178 Ga0157374_11208817 3300013296 Bacteria 777
179 Ga0163162_10181256 3300013306 Bacteria 2232
180 Ga0163162_10263996 3300013306 Bacteria 1853
181 Ga0157372_10366463 3300013307 Bacteria 1679
182 Ga0157372_12055524 3300013307 Bacteria 656
183 Ga0157375_10277562 3300013308 Bacteria 1838
184 Ga0157375_10904287 3300013308 Bacteria 1026
185 Ga0157375_10907385 3300013308 Bacteria 1025
186 Ga0157380_10614369 3300014326 Bacteria 1078
187 Ga0157380_10760154 3300014326 Bacteria 982
188 Ga0157377_10008068 3300014745 Bacteria 5121
189 Ga0157377_10022822 3300014745 Bacteria 3309
190 Ga0157379_10146447 3300014968 Bacteria 2130
191 Ga0157376_10049469 3300014969 Bacteria 3482
192 Ga0206354_10447676 3300020081 Bacteria 903
193 Ga0213874_10053284 3300021377 Bacteria 1248
194 Ga0213876_10126243 3300021384 Bacteria 1359
195 Ga0207656_10055587 3300025321 Bacteria 1723
196 Ga0207642_10046492 3300025899 Bacteria 1934
197 Ga0207710_10013573 3300025900 Bacteria 3426
198 Ga0207688_10023727 3300025901 Bacteria 3361
199 Ga0207688_10032085 3300025901 Bacteria 2902
200 Ga0207680_10184058 3300025903 Bacteria 1414
201 Ga0207647_10021264 3300025904 Bacteria 4334
202 Ga0207647_10072246 3300025904 Bacteria 2081
203 Ga0207647_10265418 3300025904 Bacteria 982
204 Ga0207645_10049397 3300025907 Bacteria 2686
205 Ga0207643_10041023 3300025908 Bacteria 2607
206 Ga0207643_10054547 3300025908 Bacteria 2272
207 Ga0207684_10326710 3300025910 Bacteria 1322
208 Ga0207684_10798702 3300025910 Bacteria 798
209 Ga0207654_10116690 3300025911 Bacteria 1669
210 Ga0207654_10230048 3300025911 Bacteria 1234
211 Ga0207671_10181171 3300025914 Bacteria 1640
212 Ga0207671_10619023 3300025914 Bacteria 863
213 Ga0207671_11060119 3300025914 Bacteria 637
214 Ga0207693_10283246 3300025915 Bacteria 1299
215 Ga0207662_10032544 3300025918 Bacteria 3036
216 Ga0207662_10045024 3300025918 Bacteria 2607
217 Ga0207657_10093416 3300025919 Bacteria 2506
218 Ga0207657_11072127 3300025919 Bacteria 616
219 Ga0207652_10111199 3300025921 Bacteria 2429
220 Ga0207681_10350510 3300025923 Bacteria 1182
221 Ga0207694_10665518 3300025924 Bacteria 877
222 Ga0207659_10014136 3300025926 Bacteria 5140
223 Ga0207687_10003870 3300025927 Bacteria 10051
224 Ga0207687_10019513 3300025927 Bacteria 4492
225 Ga0207687_10063209 3300025927 Bacteria 2620
226 Ga0207700_10114697 3300025928 Bacteria 2174
227 Ga0207664_10010803 3300025929 Bacteria 6461
228 Ga0207664_10122548 3300025929 Bacteria 2178
229 Ga0207644_10440022 3300025931 Bacteria 1070
230 Ga0207690_10079096 3300025932 Bacteria 2290
231 Ga0207690_10301686 3300025932 Bacteria 1253
232 Ga0207706_10003470 3300025933 Bacteria 15050
233 Ga0207706_10309018 3300025933 Bacteria 1377
234 Ga0207709_10181403 3300025935 Bacteria 1487
235 Ga0207669_10065740 3300025937 Bacteria 2251
236 Ga0207704_10944700 3300025938 Bacteria 727
237 Ga0207691_10076579 3300025940 Bacteria 3015
238 Ga0207691_10828779 3300025940 Bacteria 776
239 Ga0207711_10630244 3300025941 Bacteria 1000
240 Ga0207689_10041050 3300025942 Bacteria 3828
241 Ga0207689_10601740 3300025942 Bacteria 925
242 Ga0207661_10007018 3300025944 Bacteria 7991
243 Ga0207679_10158690 3300025945 Bacteria 1849
244 Ga0207679_10367558 3300025945 Bacteria 1258
245 Ga0207679_11306259 3300025945 Bacteria 666
246 Ga0207667_10020096 3300025949 Bacteria 7437
247 Ga0207667_10300835 3300025949 Bacteria 1639
248 Ga0207667_10414033 3300025949 Bacteria 1372
249 Ga0207651_10232433 3300025960 Bacteria 1498
250 Ga0207712_10054784 3300025961 Bacteria 2802
251 Ga0207668_10100318 3300025972 Bacteria 2149
252 Ga0207668_10126798 3300025972 Bacteria 1942
253 Ga0207668_10126989 3300025972 Bacteria 1941
254 Ga0207668_10147767 3300025972 Bacteria 1816
255 Ga0207640_10214737 3300025981 Bacteria 1468
256 Ga0207658_10211394 3300025986 Bacteria 1626
257 Ga0207658_10640589 3300025986 Bacteria 957
258 Ga0207677_10027543 3300026023 Bacteria 3581
259 Ga0207677_10212900 3300026023 Bacteria 1544
260 Ga0207677_10239490 3300026023 Bacteria 1467
261 Ga0207677_10679653 3300026023 Bacteria 911
262 Ga0207677_10731582 3300026023 Bacteria 880
263 Ga0207677_10992389 3300026023 Bacteria 761
264 Ga0207703_10128346 3300026035 Bacteria 2186
265 Ga0207703_10280813 3300026035 Bacteria 1512
266 Ga0207639_10185439 3300026041 Bacteria 1773
267 Ga0207639_10344213 3300026041 Bacteria 1330
268 Ga0207678_10000054 3300026067 Bacteria 87616
269 Ga0207678_10023657 3300026067 Bacteria 5372
270 Ga0207708_10037892 3300026075 Bacteria 3673
271 Ga0207708_10387463 3300026075 Bacteria 1153
272 Ga0207708_10833061 3300026075 Bacteria 796
273 Ga0207702_10188348 3300026078 Bacteria 1904
274 Ga0207702_10940287 3300026078 Bacteria 857
275 Ga0207702_11547888 3300026078 Bacteria 656
276 Ga0207641_11441266 3300026088 Bacteria 690
277 Ga0207648_10130347 3300026089 Bacteria 2213
278 Ga0207648_10285284 3300026089 Bacteria 1477
279 Ga0207676_10249999 3300026095 Bacteria 1595
280 Ga0207676_10579822 3300026095 Bacteria 1075
281 Ga0207676_10669716 3300026095 Bacteria 1003
282 Ga0207676_11206126 3300026095 Bacteria 750
283 Ga0207674_10014816 3300026116 Bacteria 8600
284 Ga0207674_10246578 3300026116 Bacteria 1733
285 Ga0207674_10479214 3300026116 Bacteria 1203
286 Ga0207675_100084961 3300026118 Bacteria 2970
287 Ga0207675_100098277 3300026118 Bacteria 2757
288 Ga0207698_10063205 3300026142 Bacteria 2896
289 Ga0207698_10097227 3300026142 Bacteria 2429
290 Ga0207698_10108170 3300026142 Bacteria 2323
291 Ga0207428_10048177 3300027907 Bacteria 3420
292 Ga0207428_10051642 3300027907 Bacteria 3286
293 Ga0268266_10104513 3300028379 Bacteria 2501
294 Ga0268266_10339924 3300028379 Bacteria 1409
295 Ga0268266_10472864 3300028379 Bacteria 1194
296 Ga0268265_10015247 3300028380 Bacteria 5255
297 Ga0268265_10487423 3300028380 Bacteria 1159
298 Ga0268265_11420191 3300028380 Bacteria 696
299 Ga0268264_10742646 3300028381 Bacteria 977
300 Ga0265319_1114493 3300028563 Bacteria 842
301 Ga0307515_10028758 3300028794 Bacteria 9429
302 Ga0307515_10346666 3300028794 Bacteria 1134
303 Ga0265338_10194581 3300028800 Bacteria 1534
304 Ga0307511_10000171 3300030521 Bacteria 63672
305 Ga0307511_10218179 3300030521 Bacteria 962
306 Ga0265340_10134665 3300031247 Bacteria 1132
307 Ga0265327_10049449 3300031251 Bacteria 2205
308 Ga0307408_100090855 3300031548 Bacteria 2305
309 Ga0307405_10119963 3300031731 Bacteria 1798
310 Ga0307405_10121989 3300031731 Bacteria 1785
311 Ga0307413_10169093 3300031824 Bacteria 1545
312 Ga0307413_10303238 3300031824 Bacteria 1212
313 Ga0307413_11798763 3300031824 Bacteria 548
314 Ga0307518_10000115 3300031838 Bacteria 56725
315 Ga0307518_10287687 3300031838 Bacteria 1010
316 Ga0307410_10051891 3300031852 Bacteria 2767
317 Ga0307410_10621194 3300031852 Bacteria 903
318 Ga0326468_10006943 3300031889 Bacteria 1060
319 Ga0307406_10175311 3300031901 Bacteria 1556
320 Ga0307406_10715952 3300031901 Bacteria 837
321 Ga0307407_10544952 3300031903 Bacteria 857
322 Ga0307409_100044372 3300031995 Bacteria 3348
323 Ga0307409_100179507 3300031995 Bacteria 1873
324 Ga0307409_100346804 3300031995 Bacteria 1399
325 Ga0307416_100092421 3300032002 Bacteria 2602
326 Ga0307416_100187014 3300032002 Bacteria 1948
327 Ga0307416_100433142 3300032002 Bacteria 1363
328 Ga0307416_100652289 3300032002 Bacteria 1137
329 Ga0307414_11255588 3300032004 Bacteria 687
330 Ga0307411_10237193 3300032005 Bacteria 1425
331 Ga0307411_10549607 3300032005 Bacteria 985
332 Ga0307415_100268996 3300032126 Bacteria 1395
333 Ga0307415_100298898 3300032126 Bacteria 1333
334 Ga0307507_10001863 3300033179 Bacteria 46053
335 Ga0307507_10011022 3300033179 Bacteria 11504
336 Ga0307507_10118376 3300033179 Bacteria 2130
337 Ga0307510_10034832 3300033180 Bacteria 5628
338 Ga0373927_0060221 3300035695 Bacteria 2456
339 Ga0373933_0301049 3300035724 Bacteria 1038
340 Ga0395900_0153701 3300037418 Bacteria 2351
341 Ga0395900_0323884 3300037418 Bacteria 1521
342 Ga0395900_0401705 3300037418 Bacteria 1334
343 Ga0395898_0198582 3300037466 Bacteria 1916
344 Ga0395898_0243878 3300037466 Bacteria 1714
345 Ga0395901_0113836 3300038443 Bacteria 2841
346 Ga0395901_0410592 3300038443 Bacteria 1390
347 Ga0395901_0597764 3300038443 Bacteria 1113
348 Ga0395901_1355973 3300038443 Bacteria 671
349 Ga0395901_1541696 3300038443 Bacteria 619
350 Ga0436365_0630566 3300039437 Bacteria 5948
351 Ga0436365_0782726 3300039437 Bacteria 4868
352 Ga0451797_1164021 3300041453 Bacteria 1060
353 Ga0451855_0116680 3300041511 Bacteria 644
354 Ga0451853_0232001 3300041512 Bacteria 4083
355 Ga0451853_3804447 3300041512 Bacteria 2427
356 Ga0439442_034918 3300042002 Bacteria 1051
357 Ga0466969_0002925 3300044656 Bacteria 9110
358 Ga0466972_0003368 3300044658 Bacteria 7922
359 Ga0466965_0217425 3300044683 Bacteria 1018
360 Ga0466965_0317076 3300044683 Bacteria 849
361 Ga0466966_0009064 3300044684 Bacteria 6592
362 Ga0466966_0222284 3300044684 Bacteria 1140
363 Ga0466961_0004145 3300044693 Bacteria 9055
364 Ga0466961_0090392 3300044693 Bacteria 1934
365 Ga0466961_0532588 3300044693 Bacteria 708
366 Ga0466961_0643387 3300044693 Bacteria 636
367 Ga0466963_0061493 3300044694 Bacteria 2511
368 Ga0466964_0193347 3300044706 Bacteria 972
369 Ga0466971_0017908 3300044719 Bacteria 3138
370 Ga0466971_0372750 3300044719 Bacteria 693
371 Ga0466970_0008309 3300044765 Bacteria 5221
372 Ga0466970_0076297 3300044765 Bacteria 1806
373 Ga0466970_0148330 3300044765 Bacteria 1295
374 Ga0466970_0160568 3300044765 Bacteria 1243
375 Ga0466970_0194960 3300044765 Bacteria 1126
376 Ga0466957_0931674 3300044842 Bacteria 622
377 Ga0466960_0009438 3300044901 Bacteria 4022
378 Ga0466960_0060938 3300044901 Bacteria 1851
379 Ga0466960_0630606 3300044901 Bacteria 638
380 Ga0466959_0006815 3300045049 Bacteria 7959
381 Ga0466959_0124066 3300045049 Bacteria 1834
382 Ga0466959_0143869 3300045049 Bacteria 1683
383 Ga0466959_0210819 3300045049 Bacteria 1350
384 Ga0466958_0167306 3300045836 Bacteria 1391
385 Ga0466958_0621293 3300045836 Bacteria 703
386 Ga0466967_0110704 3300045976 Bacteria 2523
387 Ga0466967_0147013 3300045976 Bacteria 2199
388 Ga0466967_0187019 3300045976 Bacteria 1956
389 Ga0466967_0276404 3300045976 Bacteria 1611
390 Ga0466967_1071163 3300045976 Bacteria 803
391 Ga0495607_0070152 3300046501 Bacteria 1959
392 Ga0495632_0064567 3300046519 Bacteria 1770
393 Ga0495652_0303065 3300046529 Bacteria 1161
394 Ga0495640_0297826 3300046533 Bacteria 1002
395 Ga0495598_0286021 3300046537 Bacteria 620
396 Ga0495656_0165337 3300046615 Bacteria 1078
397 Ga0496101_0345374 3300048904 Bacteria 1169
398 Ga0496101_0552521 3300048904 Bacteria 910
399 Ga0496102_0000271 3300048905 Bacteria 66136
400 Ga0496102_0031043 3300048905 Bacteria 4789
401 Ga0496102_0221964 3300048905 Bacteria 1782
402 Ga0496102_0403953 3300048905 Bacteria 1284
403 Ga0496102_0912517 3300048905 Bacteria 800
404 Ga0496103_0000053 3300048906 Bacteria 148944
405 Ga0496103_0216883 3300048906 Bacteria 1231
406 Ga0496104_0230209 3300048907 Bacteria 1765
407 Ga0496104_0517283 3300048907 Bacteria 1105
408 Ga0496105_0291212 3300048908 Bacteria 1314
409 Ga0496106_0797913 3300048909 Bacteria 749
410 Ga0496108_0010788 3300048911 Bacteria 7416
411 Ga0496108_0152153 3300048911 Bacteria 1997
412 Ga0496109_0092876 3300048912 Bacteria 2791
413 Ga0496110_0255886 3300048913 Bacteria 1594
414 Ga0496110_0862057 3300048913 Bacteria 811
415 Ga0496110_1069935 3300048913 Bacteria 714
416 Ga0496111_0160904 3300048914 Bacteria 1667
417 Ga0496112_0108583 3300048915 Bacteria 2745
418 Ga0496113_0311327 3300048916 Bacteria 1261
419 Ga0496114_0262065 3300048917 Bacteria 1522
420 Ga0496114_0290638 3300048917 Bacteria 1442
421 Ga0496115_0299843 3300048918 Bacteria 1317
422 Ga0496115_0400166 3300048918 Bacteria 1114
423 Ga0496119_0005943 3300048922 Bacteria 11484
424 Ga0496120_0016529 3300048923 Bacteria 4822
425 Ga0496120_0271635 3300048923 Bacteria 787
426 Ga0496121_0046599 3300048924 Bacteria 3709
427 Ga0496121_0096653 3300048924 Bacteria 2291
428 Ga0496126_0000026 3300048929 Bacteria 422310
429 Ga0496126_0068553 3300048929 Bacteria 3167
430 Ga0501034_0376677 3300049571 Bacteria 1345
431 Ga0501043_0491556 3300049579 Bacteria 918
432 Ga0501046_1009681 3300049580 Bacteria 577
433 Ga0501048_0049423 3300049582 Bacteria 2997
434 Ga0501069_0268116 3300049585 Bacteria 998
435 Ga0501072_0031845 3300049588 Bacteria 4128
436 Ga0501074_0074986 3300049590 Bacteria 2429
437 Ga0501075_1098882 3300049591 Bacteria 604
438 Ga0501076_0617440 3300049592 Bacteria 894
439 Ga0501249_085903 3300049679 Bacteria 743
440 Ga0501079_0201516 3300049741 Bacteria 1554
441 Ga0501035_0021834 3300049822 Bacteria 5882
442 Ga0501045_0083657 3300049824 Bacteria 2354
443 nmdc:mga03n38_256813_c1 3300050490 Bacteria 925
444 nmdc:mga0yw44_1007958_c1 3300050492 Bacteria 564
445 nmdc:mga0yw44_17438_c1 3300050492 Bacteria 3907
446 nmdc:mga0yw44_565827_c1 3300050492 Bacteria 772
447 nmdc:mga0yw44_978470_c1 3300050492 Bacteria 573
448 nmdc:mga06z11_234955_c1 3300050494 Bacteria 1075
449 nmdc:mga04h51_10149_c1 3300050495 Bacteria 2578
450 nmdc:mga07m45_124832_c1 3300050496 Bacteria 1488
451 nmdc:mga05p37_308011_c1 3300050507 Bacteria 1878
452 nmdc:mga0qj67_196250_c1 3300050509 Bacteria 1640
453 nmdc:mga0qj67_438517_c1 3300050509 Bacteria 1052
454 nmdc:mga0qj67_487558_c1 3300050509 Bacteria 991
455 nmdc:mga08y16_57877_c1 3300050511 Bacteria 4050
456 nmdc:mga08y16_83517_c1 3300050511 Bacteria 3329
457 nmdc:mga08x19_592338_c1 3300050514 Bacteria 785
458 Ga0500644_0218450 3300053088 Bacteria 794
459 Ga0500583_0147219 3300053092 Bacteria 1172
460 Ga0500556_0000873 3300053104 Bacteria 17059
461 Ga0500593_000011 3300053117 Bacteria 62847
462 Ga0500655_068891 3300053133 Bacteria 719
463 Ga0500573_0097004 3300053140 Bacteria 1661
464 Ga0500573_0417780 3300053140 Bacteria 630
465 Ga0500616_0265744 3300053153 Bacteria 726
466 Ga0501084_0244922 3300054114 Bacteria 1513
467 Ga0501082_0198706 3300060353 Bacteria 1744
468 2552109855 2551306166 Bacteria 9731570
469 2559424030 2558860280 Bacteria 11429938
470 2583151932 2582580736 Bacteria 5325865
471 2586065197 2585427649 Bacteria 9053857
472 2644093818 2643221615 Bacteria 5487866
473 2644230171 2643221641 Bacteria 4490190
474 2644323662 2643221657 Bacteria 5490246
475 2740169166 2739367898 Bacteria 4367674
476 2809593591 2808606522 Bacteria 9488490
477 2816510235 2816332139 Bacteria 9138787
478 2899362307 2899359706 Bacteria 10940472
479 2899374496 2899370129 Bacteria 6781179
480 2917739173 2917736166 Bacteria 9690793
481 8003315304 8003314358 Bacteria 10575343
482 8053950240 8053945823 Bacteria 8962862
483 8054611002 8054609563 Bacteria 5170090
484 Ga0496103_0110637
485 JGI24737J22298_10017890
486 JGI24735J21928_10205047
487 rootH2_10088501
488 Ga0070658_10341109
489 Ga0070658_10801916
490 Ga0070676_10045263
491 Ga0070683_100008022
492 Ga0070683_100052516
493 Ga0070670_100065585
494 Ga0068869_100071191
495 Ga0068869_100684929
496 Ga0070666_10832304
497 Ga0070682_100063351
498 Ga0070682_100092012
499 Ga0068868_100056594
500 Ga0068868_100239020
501 Ga0068868_100817780
502 Ga0070660_100041406
503 Ga0070660_100097079
504 Ga0070660_100151100
505 Ga0070689_100138796
506 Ga0070691_10280804
507 Ga0070687_100026795
508 Ga0070687_100057359
509 Ga0070661_100014942
510 Ga0070661_100413814
511 Ga0070692_10011776
512 Ga0070692_10403297
513 Ga0070668_100000514
514 Ga0070668_100088958
515 Ga0070668_100108201
516 Ga0070668_100795771
517 Ga0070669_100234116
518 Ga0070675_100007054
519 Ga0070675_100121967
520 Ga0070671_100346459
521 Ga0070671_100681638
522 Ga0070673_101505992
523 Ga0070688_100328956
524 Ga0070659_100016751
525 Ga0070659_100018690
526 Ga0070709_11067019
527 Ga0070714_100463787
528 Ga0070713_100115456
529 Ga0070713_100334557
530 Ga0070700_100281081
531 Ga0070694_100522471
532 Ga0070708_100886382
533 Ga0070663_100031814
534 Ga0070663_100292016
535 Ga0070663_100496170
536 Ga0070663_100598585
537 Ga0070678_100048922
538 Ga0070662_100140891
539 Ga0070685_10218474
540 Ga0070707_101898862
541 Ga0070698_100123790
542 Ga0070699_100476130
543 Ga0070679_100168763
544 Ga0070679_100708433
545 Ga0070684_100040203
546 Ga0070684_100820874
547 Ga0068853_100422587
548 Ga0070672_100968455
549 Ga0070693_100296219
550 Ga0070665_100052463
551 Ga0070665_100063380
552 Ga0070665_100095744
553 Ga0070665_100192053
554 Ga0070665_100661332
555 Ga0068855_100014099
556 Ga0068855_100134535
557 Ga0070664_100039802
558 Ga0070664_100388735
559 Ga0068857_100021381
560 Ga0068857_100201803
561 Ga0068857_100226821
562 Ga0068857_100574201
563 Ga0068854_100022622
564 Ga0068856_100044281
565 Ga0068856_100065397
566 Ga0068856_100209616
567 Ga0068856_100404721
568 Ga0070702_100011013
569 Ga0070702_100039328
570 Ga0070702_100437917
571 Ga0068852_100019150
572 Ga0068852_100062917
573 Ga0068852_100071052
574 Ga0068852_100870531
575 Ga0068859_100001140
576 Ga0068859_100286609
577 Ga0068859_100420614
578 Ga0068864_100191420
579 Ga0068864_100481507
580 Ga0068864_101405507
581 Ga0068864_101602145
582 Ga0068861_100027268
583 Ga0068861_100079260
584 Ga0068870_10040220
585 Ga0068870_10106825
586 Ga0068863_100380728
587 Ga0068863_100589444
588 Ga0068858_100044201
589 Ga0068858_100893388
590 Ga0068860_100594385
591 Ga0068860_100717280
592 Ga0068860_100929807
593 Ga0068862_100064450
594 Ga0068862_100077671
595 Ga0068862_101093968
596 Ga0081538_10077851
597 Ga0070717_10031509
598 Ga0070717_10593249
599 Ga0075365_10004913
600 Ga0075368_10017393
601 Ga0070716_100243032
602 Ga0070716_100425901
603 Ga0075367_10231066
604 Ga0075367_10289146
605 Ga0075370_10316515
606 Ga0075370_10409371
607 Ga0068871_100167139
608 Ga0075428_100396210
609 Ga0075430_100186083
610 Ga0075430_100272123
611 Ga0068865_100122537
612 Ga0068865_101050916
613 Ga0075436_100144119
614 Ga0097620_100001140
615 Ga0097620_100286590
616 Ga0097620_100420600
617 Ga0105251_10140038
618 Ga0105240_10029124
619 Ga0105240_10133920
620 Ga0111539_10000944
621 Ga0111539_10091358
622 Ga0111539_10715122
623 Ga0105245_10010209
624 Ga0105245_10290059
625 Ga0105245_10626135
626 Ga0105245_10680024
627 Ga0105245_10822778
628 Ga0105245_11084854
629 Ga0105247_10014833
630 Ga0105247_10512750
631 Ga0114129_10378691
632 Ga0105243_10290213
633 Ga0105243_10298893
634 Ga0105241_10192904
635 Ga0105241_10288505
636 Ga0105241_10308312
637 Ga0105241_10440232
638 Ga0105242_10086736
639 Ga0105248_11193880
640 Ga0105237_10152611
641 Ga0105237_10315192
642 Ga0105237_10363247
643 Ga0105237_10656716
644 Ga0105237_12027193
645 Ga0105238_10164106
646 Ga0105238_10240261
647 Ga0105249_10051741
648 Ga0105239_10019407
649 Ga0105239_10049537
650 Ga0105239_10050879
651 Ga0105239_10083306
652 Ga0105239_10287321
653 Ga0105239_10652919
654 Ga0105239_11466021
655 Ga0105246_10730893
656 Ga0157342_1013767
657 Ga0157369_10312881
658 Ga0157374_10390734
659 Ga0157374_10452678
660 Ga0157374_10631303
661 Ga0157374_11208817
662 Ga0163162_10181256
663 Ga0163162_10263996
664 Ga0157372_10366463
665 Ga0157372_12055524
666 Ga0157375_10277562
667 Ga0157375_10904287
668 Ga0157375_10907385
669 Ga0157380_10614369
670 Ga0157380_10760154
671 Ga0157377_10008068
672 Ga0157377_10022822
673 Ga0157379_10146447
674 Ga0157376_10049469
675 Ga0206354_10447676
676 Ga0213874_10053284
677 Ga0213876_10126243
678 Ga0207656_10055587
679 Ga0207642_10046492
680 Ga0207710_10013573
681 Ga0207688_10023727
682 Ga0207688_10032085
683 Ga0207680_10184058
684 Ga0207647_10021264
685 Ga0207647_10072246
686 Ga0207647_10265418
687 Ga0207645_10049397
688 Ga0207643_10041023
689 Ga0207643_10054547
690 Ga0207684_10326710
691 Ga0207684_10798702
692 Ga0207654_10116690
693 Ga0207654_10230048
694 Ga0207671_10181171
695 Ga0207671_10619023
696 Ga0207671_11060119
697 Ga0207693_10283246
698 Ga0207662_10032544
699 Ga0207662_10045024
700 Ga0207657_10093416
701 Ga0207657_11072127
702 Ga0207652_10111199
703 Ga0207681_10350510
704 Ga0207694_10665518
705 Ga0207659_10014136
706 Ga0207687_10003870
707 Ga0207687_10019513
708 Ga0207687_10063209
709 Ga0207700_10114697
710 Ga0207664_10010803
711 Ga0207664_10122548
712 Ga0207644_10440022
713 Ga0207690_10079096
714 Ga0207690_10301686
715 Ga0207706_10003470
716 Ga0207706_10309018
717 Ga0207709_10181403
718 Ga0207669_10065740
719 Ga0207704_10944700
720 Ga0207691_10076579
721 Ga0207691_10828779
722 Ga0207711_10630244
723 Ga0207689_10041050
724 Ga0207689_10601740
725 Ga0207661_10007018
726 Ga0207679_10158690
727 Ga0207679_10367558
728 Ga0207679_11306259
729 Ga0207667_10020096
730 Ga0207667_10300835
731 Ga0207667_10414033
732 Ga0207651_10232433
733 Ga0207712_10054784
734 Ga0207668_10100318
735 Ga0207668_10126798
736 Ga0207668_10126989
737 Ga0207668_10147767
738 Ga0207640_10214737
739 Ga0207658_10211394
740 Ga0207658_10640589
741 Ga0207677_10027543
742 Ga0207677_10212900
743 Ga0207677_10239490
744 Ga0207677_10679653
745 Ga0207677_10731582
746 Ga0207677_10992389
747 Ga0207703_10128346
748 Ga0207703_10280813
749 Ga0207639_10185439
750 Ga0207639_10344213
751 Ga0207678_10000054
752 Ga0207678_10023657
753 Ga0207708_10037892
754 Ga0207708_10387463
755 Ga0207708_10833061
756 Ga0207702_10188348
757 Ga0207702_10940287
758 Ga0207702_11547888
759 Ga0207641_11441266
760 Ga0207648_10130347
761 Ga0207648_10285284
762 Ga0207676_10249999
763 Ga0207676_10579822
764 Ga0207676_10669716
765 Ga0207676_11206126
766 Ga0207674_10014816
767 Ga0207674_10246578
768 Ga0207674_10479214
769 Ga0207675_100084961
770 Ga0207675_100098277
771 Ga0207698_10063205
772 Ga0207698_10097227
773 Ga0207698_10108170
774 Ga0207428_10048177
775 Ga0207428_10051642
776 Ga0268266_10104513
777 Ga0268266_10339924
778 Ga0268266_10472864
779 Ga0268265_10015247
780 Ga0268265_10487423
781 Ga0268265_11420191
782 Ga0268264_10742646
783 Ga0265319_1114493
784 Ga0307515_10028758
785 Ga0307515_10346666
786 Ga0265338_10194581
787 Ga0307511_10000171
788 Ga0307511_10218179
789 Ga0265340_10134665
790 Ga0265327_10049449
791 Ga0307408_100090855
792 Ga0307405_10119963
793 Ga0307405_10121989
794 Ga0307413_10169093
795 Ga0307413_10303238
796 Ga0307413_11798763
797 Ga0307518_10000115
798 Ga0307518_10287687
799 Ga0307410_10051891
800 Ga0307410_10621194
801 Ga0326468_10006943
802 Ga0307406_10175311
803 Ga0307406_10715952
804 Ga0307407_10544952
805 Ga0307409_100044372
806 Ga0307409_100179507
807 Ga0307409_100346804
808 Ga0307416_100092421
809 Ga0307416_100187014
810 Ga0307416_100433142
811 Ga0307416_100652289
812 Ga0307414_11255588
813 Ga0307411_10237193
814 Ga0307411_10549607
815 Ga0307415_100268996
816 Ga0307415_100298898
817 Ga0307507_10001863
818 Ga0307507_10011022
819 Ga0307507_10118376
820 Ga0307510_10034832
821 Ga0373927_0060221
822 Ga0373933_0301049
823 Ga0395900_0153701
824 Ga0395900_0323884
825 Ga0395900_0401705
826 Ga0395898_0198582
827 Ga0395898_0243878
828 Ga0395901_0113836
829 Ga0395901_0410592
830 Ga0395901_0597764
831 Ga0395901_1355973
832 Ga0395901_1541696
833 Ga0436365_0630566
834 Ga0436365_0782726
835 Ga0451797_1164021
836 Ga0451855_0116680
837 Ga0451853_0232001
838 Ga0451853_3804447
839 Ga0439442_034918
840 Ga0466969_0002925
841 Ga0466972_0003368
842 Ga0466965_0217425
843 Ga0466965_0317076
844 Ga0466966_0009064
845 Ga0466966_0222284
846 Ga0466961_0004145
847 Ga0466961_0090392
848 Ga0466961_0532588
849 Ga0466961_0643387
850 Ga0466963_0061493
851 Ga0466964_0193347
852 Ga0466971_0017908
853 Ga0466971_0372750
854 Ga0466970_0008309
855 Ga0466970_0076297
856 Ga0466970_0148330
857 Ga0466970_0160568
858 Ga0466970_0194960
859 Ga0466957_0931674
860 Ga0466960_0009438
861 Ga0466960_0060938
862 Ga0466960_0630606
863 Ga0466959_0006815
864 Ga0466959_0124066
865 Ga0466959_0143869
866 Ga0466959_0210819
867 Ga0466958_0167306
868 Ga0466958_0621293
869 Ga0466967_0110704
870 Ga0466967_0147013
871 Ga0466967_0187019
872 Ga0466967_0276404
873 Ga0466967_1071163
874 Ga0495607_0070152
875 Ga0495632_0064567
876 Ga0495652_0303065
877 Ga0495640_0297826
878 Ga0495598_0286021
879 Ga0495656_0165337
880 Ga0496101_0345374
881 Ga0496101_0552521
882 Ga0496102_0000271
883 Ga0496102_0031043
884 Ga0496102_0221964
885 Ga0496102_0403953
886 Ga0496102_0912517
887 Ga0496103_0000053
888 Ga0496103_0216883
889 Ga0496104_0230209
890 Ga0496104_0517283
891 Ga0496105_0291212
892 Ga0496106_0797913
893 Ga0496108_0010788
894 Ga0496108_0152153
895 Ga0496109_0092876
896 Ga0496110_0255886
897 Ga0496110_0862057
898 Ga0496110_1069935
899 Ga0496111_0160904
900 Ga0496112_0108583
901 Ga0496113_0311327
902 Ga0496114_0262065
903 Ga0496114_0290638
904 Ga0496115_0299843
905 Ga0496115_0400166
906 Ga0496119_0005943
907 Ga0496120_0016529
908 Ga0496120_0271635
909 Ga0496121_0046599
910 Ga0496121_0096653
911 Ga0496126_0000026
912 Ga0496126_0068553
913 Ga0501034_0376677
914 Ga0501043_0491556
915 Ga0501046_1009681
916 Ga0501048_0049423
917 Ga0501069_0268116
918 Ga0501072_0031845
919 Ga0501074_0074986
920 Ga0501075_1098882
921 Ga0501076_0617440
922 Ga0501249_085903
923 Ga0501079_0201516
924 Ga0501035_0021834
925 Ga0501045_0083657
926 nmdc:mga03n38_256813_c1
927 nmdc:mga0yw44_1007958_c1
928 nmdc:mga0yw44_17438_c1
929 nmdc:mga0yw44_565827_c1
930 nmdc:mga0yw44_978470_c1
931 nmdc:mga06z11_234955_c1
932 nmdc:mga04h51_10149_c1
933 nmdc:mga07m45_124832_c1
934 nmdc:mga05p37_308011_c1
935 nmdc:mga0qj67_196250_c1
936 nmdc:mga0qj67_438517_c1
937 nmdc:mga0qj67_487558_c1
938 nmdc:mga08y16_57877_c1
939 nmdc:mga08y16_83517_c1
940 nmdc:mga08x19_592338_c1
941 Ga0500644_0218450
942 Ga0500583_0147219
943 Ga0500556_0000873
944 Ga0500593_000011
945 Ga0500655_068891
946 Ga0500573_0097004
947 Ga0500573_0417780
948 Ga0500616_0265744
949 Ga0501084_0244922
950 Ga0501082_0198706
951 2552109855
952 2559424030
953 2583151932
954 2586065197
955 2644093818
956 2644230171
957 2644323662
958 2740169166
959 2809593591
960 2816510235
961 2899362307
962 2899374496
963 2917739173
964 8003315304
965 8053950240
966 8054611002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

38

186

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bqp-assembly1.cif.gz_C hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with xanthosine and phosphate bound in the nucleotide binding site and with sulfate bound in the pyrophosphate binding site 0.9424 9 154
5bqo-assembly2.cif.gz_C hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with sulfate bound in the 5-phosphoribosyl binding site. 0.9393 9 155
5bqo-assembly1.cif.gz_A-2 hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus with sulfate bound in the 5-phosphoribosyl binding site. 0.9358 9 155
4z1o-assembly1.cif.gz_A-2 hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus in complex with alpha-phosphoribosylpyrophosphoric acid (prpp) and magnesium 0.929 10 155
4zfn-assembly1.cif.gz_A-2 hypoxanthine-guanine-xanthine phosphoribosyltransferase (hgxprt) from sulfolobus solfataricus containing gmp complexed in two different ways together with one or two mg2+ 0.9195 9 154
ID Description Score Start End Superfamily
4zfnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8995 9 154 3.40.50.2020
1vdmG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.884 8 159 3.40.50.2020
1vdmG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8569 8 159 3.40.50.2020
5vogA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8445 5 153 3.40.50.2020
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8139 12 145 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A0D6WUG6-F1-model_v4 deleted 0.9877 9 159
AF-A0A1X0GMQ8-F1-model_v4 deleted 0.9852 9 157
AF-A0A6P1D1D3-F1-model_v4 Phosphoribosyltransferase 0.983 5 159 GO:0016757
AF-A0A7K2U633-F1-model_v4 Phosphoribosyltransferase 0.9818 5 159 GO:0016757
AF-A0A100Y616-F1-model_v4 Phosphoribosyltransferase 0.981 9 163 GO:0016757

Map