F452640

General Info

Members Datasets Scaffolds Average Seq Length
482 270 964 161

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0070537|Ga0373926_0070537_201_737
Length 178
Sequence MARRDSGRDLLRKREDRIMAIKVGDRVPNGTFMVMTGDGPKPMTSDELFKGKKVVLFAVPGAFTPTCHRNHLPGFVKNAAAIKAKGVDTIAVTGVNDVFVMDAWKKASGGEAIEFLADGSGHWAKATGLTADLSERGLGIRSQRYAMVVDDGVVKALNIEDAPGKADISGADNLMKSL

Samples

Sample ID Description Type Environment
1 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
161 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
162 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
165 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
258 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
259 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
260 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
261 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
262 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
263 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
264 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.72
Metatranscriptomes 2.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.98
Nodule 0
Rhizoplane 3.32
Rhizosphere 90.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373926_0070537 3300035083 Bacteria 1283
2 JGI24751J29686_10056195 3300002459 Bacteria 811
3 JGI25153J46596_10008159 3300003215 Bacteria 5044
4 JGI25404J52841_10020160 3300003659 Bacteria 1444
5 Ga0065712_10356693 3300005290 Bacteria 780
6 Ga0070658_10118467 3300005327 Bacteria 2198
7 Ga0070658_10490730 3300005327 Bacteria 1060
8 Ga0070658_10529662 3300005327 Bacteria 1019
9 Ga0070676_10146047 3300005328 Bacteria 1510
10 Ga0070670_100347850 3300005331 Bacteria 1302
11 Ga0068869_100106516 3300005334 Bacteria 2128
12 Ga0068869_100359785 3300005334 Bacteria 1188
13 Ga0070680_100016815 3300005336 Bacteria 5755
14 Ga0070680_100026107 3300005336 Bacteria 4672
15 Ga0068868_101247476 3300005338 Bacteria 689
16 Ga0070660_100025186 3300005339 Bacteria 4420
17 Ga0070661_100112873 3300005344 Bacteria 2031
18 Ga0070669_100446256 3300005353 Bacteria 1066
19 Ga0070674_100284970 3300005356 Bacteria 1311
20 Ga0070659_100436689 3300005366 Bacteria 1109
21 Ga0070714_100090791 3300005435 Bacteria 2676
22 Ga0070714_100157319 3300005435 Bacteria 2053
23 Ga0070714_101280668 3300005435 Bacteria 715
24 Ga0070710_10313926 3300005437 Bacteria 1027
25 Ga0070681_10079521 3300005458 Bacteria 3235
26 Ga0070681_10179071 3300005458 Bacteria 2041
27 Ga0070681_10232802 3300005458 Bacteria 1756
28 Ga0070699_101296220 3300005518 Bacteria 668
29 Ga0070679_100050724 3300005530 Bacteria 4133
30 Ga0070679_100054287 3300005530 Bacteria 3988
31 Ga0070684_100237514 3300005535 Bacteria 1665
32 Ga0068853_100688510 3300005539 Bacteria 975
33 Ga0070665_100321783 3300005548 Bacteria 1551
34 Ga0068855_101106312 3300005563 Bacteria 828
35 Ga0070664_101337996 3300005564 Bacteria 677
36 Ga0068857_100057201 3300005577 Bacteria 3461
37 Ga0068857_100945900 3300005577 Bacteria 828
38 Ga0068856_100819910 3300005614 Bacteria 950
39 Ga0068859_100476635 3300005617 Bacteria 1343
40 Ga0068864_100081481 3300005618 Bacteria 2837
41 Ga0068861_101228869 3300005719 Bacteria 726
42 Ga0068870_10044225 3300005840 Bacteria 2326
43 Ga0068863_101267473 3300005841 Bacteria 744
44 Ga0068858_100267606 3300005842 Bacteria 1625
45 Ga0068862_100812591 3300005844 Bacteria 914
46 Ga0081540_1000054 3300005983 Bacteria 122877
47 Ga0081539_10013620 3300005985 Bacteria 6114
48 Ga0070717_10049259 3300006028 Bacteria 3458
49 Ga0070717_10732281 3300006028 Bacteria 899
50 Ga0070717_11088788 3300006028 Bacteria 728
51 Ga0075365_10124249 3300006038 Bacteria 1782
52 Ga0075365_10884988 3300006038 Bacteria 630
53 Ga0075432_10394897 3300006058 Bacteria 596
54 Ga0070716_101128363 3300006173 Bacteria 626
55 Ga0070712_100001221 3300006175 Bacteria 15562
56 Ga0070712_100011722 3300006175 Bacteria 5569
57 Ga0075362_10361559 3300006177 Bacteria 728
58 Ga0075366_10031057 3300006195 Bacteria 3143
59 Ga0075366_10034161 3300006195 Bacteria 2996
60 Ga0075370_10005821 3300006353 Bacteria 6159
61 Ga0075428_101210440 3300006844 Bacteria 796
62 Ga0075434_101976115 3300006871 Bacteria 589
63 Ga0075429_100307925 3300006880 Bacteria 1387
64 Ga0068865_100310535 3300006881 Bacteria 1265
65 Ga0097620_100476676 3300006931 Bacteria 1343
66 Ga0105240_10744992 3300009093 Bacteria 1066
67 Ga0111539_10015064 3300009094 Bacteria 9636
68 Ga0111539_11063271 3300009094 Bacteria 940
69 Ga0105245_10337610 3300009098 Bacteria 1489
70 Ga0105247_10046837 3300009101 Bacteria 2655
71 Ga0114129_11555061 3300009147 Bacteria 811
72 Ga0105243_10074000 3300009148 Bacteria 2762
73 Ga0105243_11055149 3300009148 Bacteria 818
74 Ga0105241_10711915 3300009174 Bacteria 917
75 Ga0105238_10467994 3300009551 Bacteria 1259
76 Ga0105238_10786763 3300009551 Bacteria 966
77 Ga0105238_12537096 3300009551 Bacteria 549
78 Ga0105249_10239062 3300009553 Bacteria 1795
79 Ga0157371_10336771 3300013102 Bacteria 1097
80 Ga0157370_10379661 3300013104 Bacteria 1302
81 Ga0157370_10929623 3300013104 Bacteria 789
82 Ga0157369_11314321 3300013105 Bacteria 737
83 Ga0157374_11645546 3300013296 Bacteria 666
84 Ga0163162_10579501 3300013306 Bacteria 1249
85 Ga0163162_11897789 3300013306 Bacteria 682
86 Ga0157372_12269488 3300013307 Bacteria 623
87 Ga0163163_10022803 3300014325 Bacteria 5933
88 Ga0157380_10387367 3300014326 Bacteria 1321
89 Ga0157380_10567499 3300014326 Bacteria 1116
90 Ga0157376_11287118 3300014969 Bacteria 761
91 Ga0182005_1051003 3300015265 Bacteria 1125
92 Ga0163161_10433896 3300017792 Bacteria 1059
93 Ga0206356_10122878 3300020070 Bacteria 538
94 Ga0206356_10422222 3300020070 Bacteria 863
95 Ga0206354_10205483 3300020081 Bacteria 758
96 Ga0206353_10185415 3300020082 Bacteria 632
97 Ga0206353_11666496 3300020082 Bacteria 765
98 Ga0213873_10048276 3300021358 Bacteria 1119
99 Ga0213876_10020288 3300021384 Bacteria 3512
100 Ga0213875_10003821 3300021388 Bacteria 8464
101 Ga0224712_10170860 3300022467 Bacteria 975
102 Ga0224712_10504490 3300022467 Bacteria 585
103 Ga0228598_1007333 3300024227 Bacteria 2248
104 Ga0228598_1081122 3300024227 Bacteria 650
105 Ga0209758_1000382 3300025297 Bacteria 76653
106 Ga0207692_10070614 3300025898 Bacteria 1839
107 Ga0207692_10340203 3300025898 Bacteria 923
108 Ga0207692_11016653 3300025898 Bacteria 548
109 Ga0207710_10020497 3300025900 Bacteria 2827
110 Ga0207688_10357489 3300025901 Bacteria 901
111 Ga0207699_10941654 3300025906 Bacteria 638
112 Ga0207645_10150624 3300025907 Bacteria 1518
113 Ga0207643_10028918 3300025908 Bacteria 3081
114 Ga0207705_10207096 3300025909 Bacteria 1487
115 Ga0207705_10417477 3300025909 Bacteria 1039
116 Ga0207705_10455166 3300025909 Bacteria 992
117 Ga0207707_10032493 3300025912 Bacteria 4568
118 Ga0207707_10207479 3300025912 Bacteria 1707
119 Ga0207707_10246720 3300025912 Bacteria 1551
120 Ga0207695_11407724 3300025913 Bacteria 578
121 Ga0207693_10002161 3300025915 Bacteria 17125
122 Ga0207693_10034679 3300025915 Bacteria 3980
123 Ga0207693_10062818 3300025915 Bacteria 2909
124 Ga0207693_10649085 3300025915 Bacteria 820
125 Ga0207663_11243987 3300025916 Bacteria 600
126 Ga0207660_10331694 3300025917 Bacteria 1216
127 Ga0207662_10149872 3300025918 Bacteria 1483
128 Ga0207657_10009131 3300025919 Bacteria 10005
129 Ga0207657_10037453 3300025919 Bacteria 4330
130 Ga0207649_10147906 3300025920 Bacteria 1614
131 Ga0207652_10028774 3300025921 Bacteria 4638
132 Ga0207652_10035704 3300025921 Bacteria 4198
133 Ga0207652_10057234 3300025921 Bacteria 3357
134 Ga0207652_10615611 3300025921 Bacteria 973
135 Ga0207694_10478784 3300025924 Bacteria 1041
136 Ga0207694_10781980 3300025924 Bacteria 806
137 Ga0207650_10624276 3300025925 Bacteria 907
138 Ga0207659_10255324 3300025926 Bacteria 1424
139 Ga0207687_10542463 3300025927 Bacteria 975
140 Ga0207700_10680523 3300025928 Bacteria 918
141 Ga0207664_10137110 3300025929 Bacteria 2066
142 Ga0207664_10186933 3300025929 Bacteria 1781
143 Ga0207664_10556721 3300025929 Bacteria 1029
144 Ga0207690_10338587 3300025932 Bacteria 1187
145 Ga0207709_10751617 3300025935 Bacteria 784
146 Ga0207669_10531779 3300025937 Bacteria 946
147 Ga0207669_11074674 3300025937 Bacteria 678
148 Ga0207665_10408027 3300025939 Bacteria 1036
149 Ga0207691_10128282 3300025940 Bacteria 2242
150 Ga0207689_10017121 3300025942 Bacteria 6135
151 Ga0207679_11260120 3300025945 Bacteria 679
152 Ga0207667_11291347 3300025949 Bacteria 707
153 Ga0207668_11322822 3300025972 Bacteria 649
154 Ga0207658_11115115 3300025986 Bacteria 721
155 Ga0207677_11606870 3300026023 Bacteria 602
156 Ga0207678_10385788 3300026067 Bacteria 1211
157 Ga0207702_10386796 3300026078 Bacteria 1346
158 Ga0207702_10718988 3300026078 Bacteria 985
159 Ga0207648_10172670 3300026089 Bacteria 1911
160 Ga0207676_10085844 3300026095 Bacteria 2569
161 Ga0207674_10931832 3300026116 Bacteria 837
162 Ga0207675_101156167 3300026118 Bacteria 794
163 Ga0207675_102251085 3300026118 Bacteria 559
164 Ga0207698_10040979 3300026142 Bacteria 3447
165 Ga0207698_11363156 3300026142 Bacteria 724
166 Ga0207428_10228455 3300027907 Bacteria 1393
167 Ga0268266_10556405 3300028379 Bacteria 1099
168 Ga0268266_11547650 3300028379 Bacteria 639
169 Ga0268265_10364787 3300028380 Bacteria 1324
170 Ga0268265_10612809 3300028380 Bacteria 1042
171 Ga0265338_10137562 3300028800 Bacteria 1917
172 Ga0265763_1017529 3300030763 Bacteria 727
173 Ga0265773_1004659 3300031018 Bacteria 961
174 Ga0265760_10050519 3300031090 Bacteria 1251
175 Ga0265325_10000254 3300031241 Bacteria 38034
176 Ga0265325_10038439 3300031241 Bacteria 2526
177 Ga0265325_10040788 3300031241 Bacteria 2436
178 Ga0265339_10000016 3300031249 Bacteria 185313
179 Ga0265316_10244267 3300031344 Bacteria 1320
180 Ga0307408_101243614 3300031548 Bacteria 696
181 Ga0265313_10000060 3300031595 Bacteria 107224
182 Ga0265313_10036467 3300031595 Bacteria 2468
183 Ga0265313_10043293 3300031595 Bacteria 2205
184 Ga0265342_10000464 3300031712 Bacteria 43974
185 Ga0307407_10827085 3300031903 Bacteria 706
186 Ga0307412_10881755 3300031911 Bacteria 783
187 Ga0307409_102379695 3300031995 Bacteria 559
188 Ga0307416_102306345 3300032002 Bacteria 639
189 Ga0316583_10264563 3300032133 Bacteria 595
190 Ga0373944_0010355 3300035089 Bacteria 2540
191 Ga0373923_0078935 3300035111 Bacteria 1425
192 Ga0373923_0213477 3300035111 Bacteria 895
193 Ga0373941_0001010 3300035115 Bacteria 5851
194 Ga0373945_0012067 3300035116 Bacteria 2864
195 Ga0373945_0062790 3300035116 Bacteria 1389
196 Ga0373943_0000078 3300035170 Bacteria 34436
197 Ga0373943_0009794 3300035170 Bacteria 4291
198 Ga0373946_0040718 3300035171 Bacteria 1902
199 Ga0373961_0002339 3300035241 Bacteria 4945
200 Ga0373924_0037412 3300035410 Bacteria 1976
201 Ga0373924_0520906 3300035410 Bacteria 535
202 Ga0373935_0001829 3300035692 Bacteria 11938
203 Ga0373935_0058217 3300035692 Bacteria 2468
204 Ga0373935_0505018 3300035692 Bacteria 878
205 Ga0373927_0030476 3300035695 Bacteria 3519
206 Ga0373927_0035127 3300035695 Bacteria 3259
207 Ga0373947_0000876 3300035725 Bacteria 18196
208 Ga0373947_0022273 3300035725 Bacteria 3673
209 Ga0373947_0028015 3300035725 Bacteria 3299
210 Ga0373947_0072026 3300035725 Bacteria 2121
211 Ga0373937_0396045 3300036401 Bacteria 1310
212 Ga0373937_0940445 3300036401 Bacteria 813
213 Ga0373925_0005935 3300037068 Bacteria 9050
214 Ga0373925_0045735 3300037068 Bacteria 3252
215 Ga0373925_0050050 3300037068 Bacteria 3116
216 Ga0395899_0038411 3300037312 Bacteria 3585
217 Ga0395899_0180767 3300037312 Bacteria 1481
218 Ga0395900_0003699 3300037418 Bacteria 16435
219 Ga0395900_0015404 3300037418 Bacteria 7793
220 Ga0395900_0092621 3300037418 Bacteria 3105
221 Ga0395900_0134180 3300037418 Bacteria 2536
222 Ga0395898_0017310 3300037466 Bacteria 7362
223 Ga0395898_0055726 3300037466 Bacteria 3856
224 Ga0395898_0295523 3300037466 Bacteria 1545
225 Ga0316581_0168560 3300037588 Bacteria 675
226 Ga0436364_0319525 3300037853 Bacteria 1166
227 Ga0395901_0019961 3300038443 Bacteria 6856
228 Ga0395901_0121902 3300038443 Bacteria 2740
229 Ga0395901_0326787 3300038443 Bacteria 1586
230 Ga0436365_0140754 3300039437 Bacteria 3326
231 Ga0436365_1858573 3300039437 Bacteria 1192
232 Ga0436363_1056244 3300039450 Bacteria 674
233 Ga0436363_1287207 3300039450 Bacteria 1538
234 Ga0436362_0027881 3300039453 Bacteria 16485
235 Ga0436362_0714077 3300039453 Bacteria 600
236 Ga0439453_0021132 3300041408 Bacteria 1171
237 Ga0451802_1766009 3300041460 Bacteria 772
238 Ga0439441_014333 3300042001 Bacteria 1389
239 Ga0439446_0128563 3300042156 Bacteria 820
240 Ga0439435_0054498 3300042436 Bacteria 1151
241 Ga0439440_0106808 3300042993 Bacteria 767
242 Ga0466969_0142536 3300044656 Bacteria 1107
243 Ga0466961_0162617 3300044693 Bacteria 1391
244 Ga0466961_0345343 3300044693 Bacteria 906
245 Ga0466963_0014198 3300044694 Bacteria 4907
246 Ga0466963_0108632 3300044694 Bacteria 1903
247 Ga0466963_0488926 3300044694 Bacteria 869
248 Ga0466971_0067543 3300044719 Bacteria 1621
249 Ga0466968_0253881 3300044735 Bacteria 836
250 Ga0466957_0010865 3300044842 Bacteria 5235
251 Ga0466957_0042945 3300044842 Bacteria 2736
252 Ga0466957_0063435 3300044842 Bacteria 2271
253 Ga0466957_0094054 3300044842 Bacteria 1882
254 Ga0466957_0249751 3300044842 Bacteria 1179
255 Ga0466957_0298617 3300044842 Bacteria 1082
256 Ga0466959_0322204 3300045049 Bacteria 1056
257 Ga0466958_0228623 3300045836 Bacteria 1187
258 Ga0466967_0170646 3300045976 Bacteria 2046
259 Ga0466967_0218962 3300045976 Bacteria 1808
260 Ga0495592_0086842 3300046454 Bacteria 2252
261 Ga0495629_0394583 3300046459 Bacteria 941
262 Ga0495638_0495074 3300046460 Bacteria 617
263 Ga0495580_0066808 3300046472 Bacteria 2516
264 Ga0495605_0063648 3300046474 Bacteria 1759
265 Ga0495639_0011952 3300046475 Bacteria 3744
266 Ga0495662_0001661 3300046476 Bacteria 11081
267 Ga0495664_0000068 3300046477 Bacteria 49687
268 Ga0495618_0002490 3300046514 Bacteria 11817
269 Ga0495618_0059298 3300046514 Bacteria 2425
270 Ga0495618_0180315 3300046514 Bacteria 1342
271 Ga0495630_0005326 3300046517 Bacteria 9078
272 Ga0495630_0007442 3300046517 Bacteria 7824
273 Ga0495666_0028628 3300046526 Bacteria 2741
274 Ga0495666_0108317 3300046526 Bacteria 1306
275 Ga0495652_0018812 3300046529 Bacteria 6156
276 Ga0495665_0010449 3300046531 Bacteria 5023
277 Ga0495665_0040237 3300046531 Bacteria 2489
278 Ga0495665_0048419 3300046531 Bacteria 2254
279 Ga0495665_0474925 3300046531 Bacteria 631
280 Ga0495640_0010448 3300046533 Bacteria 7171
281 Ga0495640_0044373 3300046533 Bacteria 3091
282 Ga0495586_0005394 3300046535 Bacteria 6836
283 Ga0495598_0179154 3300046537 Bacteria 755
284 Ga0495645_0001974 3300046543 Bacteria 13940
285 Ga0495634_0001076 3300046642 Bacteria 25489
286 Ga0495634_0039827 3300046642 Bacteria 3198
287 Ga0495635_0001029 3300046663 Bacteria 18449
288 Ga0495635_0248936 3300046663 Bacteria 1198
289 Ga0495659_0169355 3300046664 Bacteria 885
290 Ga0495646_0120371 3300046680 Bacteria 1486
291 Ga0495647_0060188 3300046681 Bacteria 1496
292 Ga0495613_0042635 3300046689 Bacteria 3357
293 Ga0495624_0010737 3300046690 Bacteria 6310
294 Ga0495624_0472351 3300046690 Bacteria 751
295 Ga0495600_0083277 3300046809 Bacteria 2088
296 Ga0495581_0032919 3300047315 Bacteria 3000
297 Ga0495581_0059187 3300047315 Bacteria 2213
298 Ga0495581_0075794 3300047315 Bacteria 1946
299 Ga0495636_0094684 3300047318 Bacteria 1300
300 Ga0495674_0011857 3300047319 Bacteria 8217
301 Ga0495676_0035027 3300047321 Bacteria 4204
302 Ga0495684_0001463 3300047471 Bacteria 18899
303 Ga0495684_0005781 3300047471 Bacteria 9623
304 Ga0495684_0006246 3300047471 Bacteria 9258
305 Ga0495593_0225076 3300047673 Bacteria 941
306 Ga0496100_0032683 3300048903 Bacteria 3248
307 Ga0496102_0031866 3300048905 Bacteria 4732
308 Ga0496103_0292245 3300048906 Bacteria 1048
309 Ga0496104_0000637 3300048907 Bacteria 30053
310 Ga0496105_0001647 3300048908 Bacteria 15908
311 Ga0496108_0000408 3300048911 Bacteria 35275
312 Ga0496109_0131459 3300048912 Bacteria 2336
313 Ga0496110_0135321 3300048913 Bacteria 2226
314 Ga0496110_0415054 3300048913 Bacteria 1227
315 Ga0496110_0475042 3300048913 Bacteria 1139
316 Ga0496111_0006568 3300048914 Bacteria 7563
317 Ga0496112_0001429 3300048915 Bacteria 18305
318 Ga0496113_0009356 3300048916 Bacteria 6424
319 Ga0496114_0064902 3300048917 Bacteria 3059
320 Ga0496115_0001958 3300048918 Bacteria 14699
321 Ga0496126_0280298 3300048929 Bacteria 1381
322 Ga0501031_0321711 3300049568 Bacteria 1002
323 Ga0501031_0467637 3300049568 Bacteria 814
324 Ga0501032_0010038 3300049569 Bacteria 6836
325 Ga0501032_0045661 3300049569 Bacteria 2962
326 Ga0501032_0115586 3300049569 Bacteria 1774
327 Ga0501032_0289572 3300049569 Bacteria 1059
328 Ga0501032_0320705 3300049569 Bacteria 1000
329 Ga0501033_0039434 3300049570 Bacteria 3528
330 Ga0501033_0079405 3300049570 Bacteria 2407
331 Ga0501033_0083680 3300049570 Bacteria 2338
332 Ga0501033_0345599 3300049570 Bacteria 1042
333 Ga0501033_0381920 3300049570 Bacteria 984
334 Ga0501033_1069281 3300049570 Bacteria 537
335 Ga0501034_0000230 3300049571 Bacteria 105001
336 Ga0501034_0009593 3300049571 Bacteria 10128
337 Ga0501034_0041386 3300049571 Bacteria 4661
338 Ga0501034_0045773 3300049571 Bacteria 4420
339 Ga0501034_0055124 3300049571 Bacteria 4001
340 Ga0501034_0135483 3300049571 Bacteria 2443
341 Ga0501034_0174264 3300049571 Bacteria 2117
342 Ga0501034_0628088 3300049571 Bacteria 978
343 Ga0501034_0878971 3300049571 Bacteria 785
344 Ga0501034_0957571 3300049571 Bacteria 741
345 Ga0501036_0011440 3300049572 Bacteria 7346
346 Ga0501036_0089295 3300049572 Bacteria 2604
347 Ga0501036_0400178 3300049572 Bacteria 1145
348 Ga0501037_0013166 3300049573 Bacteria 6097
349 Ga0501037_0068405 3300049573 Bacteria 2585
350 Ga0501037_0122081 3300049573 Bacteria 1872
351 Ga0501037_0228596 3300049573 Bacteria 1306
352 Ga0501037_0358592 3300049573 Bacteria 1005
353 Ga0501038_0016142 3300049574 Bacteria 6776
354 Ga0501038_0223203 3300049574 Bacteria 1502
355 Ga0501038_0459898 3300049574 Bacteria 977
356 Ga0501039_0013351 3300049575 Bacteria 6278
357 Ga0501039_0030042 3300049575 Bacteria 4187
358 Ga0501039_0342156 3300049575 Bacteria 1175
359 Ga0501040_0287433 3300049576 Bacteria 1175
360 Ga0501041_0381914 3300049577 Bacteria 891
361 Ga0501043_0021697 3300049579 Bacteria 5034
362 Ga0501043_0025539 3300049579 Bacteria 4635
363 Ga0501043_0029674 3300049579 Bacteria 4297
364 Ga0501043_0070158 3300049579 Bacteria 2752
365 Ga0501043_0114280 3300049579 Bacteria 2119
366 Ga0501043_0458215 3300049579 Bacteria 957
367 Ga0501046_0013278 3300049580 Bacteria 6979
368 Ga0501046_0119856 3300049580 Bacteria 2002
369 Ga0501046_0140011 3300049580 Bacteria 1831
370 Ga0501046_0351355 3300049580 Bacteria 1070
371 Ga0501047_0016107 3300049581 Bacteria 7130
372 Ga0501047_0028667 3300049581 Bacteria 5369
373 Ga0501047_0060832 3300049581 Bacteria 3643
374 Ga0501047_0081316 3300049581 Bacteria 3114
375 Ga0501047_0185502 3300049581 Bacteria 1945
376 Ga0501047_0202006 3300049581 Bacteria 1849
377 Ga0501048_0011685 3300049582 Bacteria 6549
378 Ga0501048_0727936 3300049582 Bacteria 712
379 Ga0501067_0009573 3300049583 Bacteria 5367
380 Ga0501067_0110399 3300049583 Bacteria 1529
381 Ga0501067_0140353 3300049583 Bacteria 1345
382 Ga0501068_0011980 3300049584 Bacteria 4905
383 Ga0501068_0017372 3300049584 Bacteria 4160
384 Ga0501068_0670490 3300049584 Bacteria 677
385 Ga0501069_0006266 3300049585 Bacteria 6218
386 Ga0501069_0076350 3300049585 Bacteria 1883
387 Ga0501070_0022303 3300049586 Bacteria 5305
388 Ga0501070_0022726 3300049586 Bacteria 5250
389 Ga0501070_0076485 3300049586 Bacteria 2771
390 Ga0501070_0192409 3300049586 Bacteria 1676
391 Ga0501070_0195030 3300049586 Bacteria 1663
392 Ga0501070_0256163 3300049586 Bacteria 1431
393 Ga0501070_0571631 3300049586 Bacteria 903
394 Ga0501071_0041312 3300049587 Bacteria 3303
395 Ga0501071_0315471 3300049587 Bacteria 1186
396 Ga0501071_0637801 3300049587 Bacteria 819
397 Ga0501072_0482624 3300049588 Bacteria 981
398 Ga0501073_0007286 3300049589 Bacteria 8233
399 Ga0501073_0025323 3300049589 Bacteria 4256
400 Ga0501073_0136387 3300049589 Bacteria 1701
401 Ga0501073_0139709 3300049589 Bacteria 1678
402 Ga0501073_0917643 3300049589 Bacteria 603
403 Ga0501074_0035152 3300049590 Bacteria 3630
404 Ga0501074_0078578 3300049590 Bacteria 2368
405 Ga0501074_0099067 3300049590 Bacteria 2086
406 Ga0501074_0114398 3300049590 Bacteria 1930
407 Ga0501076_0085337 3300049592 Bacteria 2537
408 Ga0501076_0855509 3300049592 Bacteria 750
409 Ga0501079_0045918 3300049741 Bacteria 3371
410 Ga0501079_0075943 3300049741 Bacteria 2599
411 Ga0501079_0359774 3300049741 Bacteria 1140
412 Ga0501080_0017834 3300049742 Bacteria 6571
413 Ga0501080_0048640 3300049742 Bacteria 3946
414 Ga0501080_0111777 3300049742 Bacteria 2532
415 Ga0501080_0189179 3300049742 Bacteria 1892
416 Ga0501080_0190096 3300049742 Bacteria 1887
417 Ga0501080_0306924 3300049742 Bacteria 1438
418 Ga0501080_0432606 3300049742 Bacteria 1181
419 Ga0501080_0774449 3300049742 Bacteria 843
420 Ga0501083_0019719 3300049744 Bacteria 4694
421 Ga0501083_0020163 3300049744 Bacteria 4639
422 Ga0501083_0101179 3300049744 Bacteria 1900
423 Ga0501083_0104424 3300049744 Bacteria 1867
424 Ga0501035_0089004 3300049822 Bacteria 2719
425 Ga0501035_0100253 3300049822 Bacteria 2542
426 Ga0501035_0144761 3300049822 Bacteria 2064
427 Ga0501035_0192795 3300049822 Bacteria 1751
428 Ga0501035_0314592 3300049822 Bacteria 1317
429 Ga0501035_0561533 3300049822 Bacteria 934
430 Ga0501044_0000243 3300049823 Bacteria 68966
431 Ga0501044_0030887 3300049823 Bacteria 5642
432 Ga0501044_0096746 3300049823 Bacteria 2973
433 Ga0501044_0146267 3300049823 Bacteria 2348
434 Ga0501044_0185350 3300049823 Bacteria 2046
435 Ga0501044_0224982 3300049823 Bacteria 1826
436 Ga0501044_0304883 3300049823 Bacteria 1520
437 Ga0501044_0416600 3300049823 Bacteria 1254
438 Ga0501044_0538629 3300049823 Bacteria 1066
439 Ga0501044_0730126 3300049823 Bacteria 874
440 Ga0501044_0753502 3300049823 Bacteria 856
441 Ga0501045_0023330 3300049824 Bacteria 4435
442 Ga0501045_0237143 3300049824 Bacteria 1358
443 nmdc:mga0k408_223829_c1 3300050493 Bacteria 1123
444 nmdc:mga0k408_81961_c1 3300050493 Bacteria 1890
445 nmdc:mga08y16_245243_c1 3300050511 Bacteria 1851
446 nmdc:mga08y16_25017_c1 3300050511 Bacteria 6298
447 nmdc:mga0n895_1076914_c1 3300050512 Bacteria 782
448 Ga0495601_0003852 3300053077 Bacteria 8636
449 Ga0495601_0076323 3300053077 Bacteria 2146
450 Ga0495612_0000522 3300053078 Bacteria 15458
451 Ga0495595_0226198 3300053084 Bacteria 934
452 Ga0495619_0001804 3300053085 Bacteria 14242
453 Ga0495619_0277589 3300053085 Bacteria 1161
454 Ga0495619_0569411 3300053085 Bacteria 776
455 Ga0500643_031945 3300053087 Bacteria 1601
456 Ga0500643_073926 3300053087 Bacteria 943
457 Ga0500644_0000661 3300053088 Bacteria 12701
458 Ga0500651_0704434 3300053093 Bacteria 539
459 Ga0500566_0055855 3300053094 Bacteria 2247
460 Ga0500641_0002620 3300053096 Bacteria 6346
461 Ga0500595_000006 3300053119 Bacteria 300857
462 Ga0500642_0305693 3300053130 Bacteria 717
463 Ga0500652_089370 3300053131 Bacteria 1286
464 Ga0500652_176108 3300053131 Bacteria 878
465 Ga0500577_0404300 3300053142 Bacteria 597
466 Ga0500616_0000001 3300053153 Bacteria 1986011
467 Ga0500616_0314194 3300053153 Bacteria 647
468 Ga0500645_000743 3300053730 Bacteria 20024
469 Ga0501084_0118720 3300054114 Bacteria 2223
470 Ga0501084_0175980 3300054114 Bacteria 1806
471 Ga0501084_0187418 3300054114 Bacteria 1746
472 Ga0501084_0355278 3300054114 Bacteria 1238
473 Ga0501084_0605716 3300054114 Bacteria 925
474 Ga0501084_0894159 3300054114 Bacteria 747
475 Ga0587114_031723 3300059655 Bacteria 812
476 Ga0501082_0000306 3300060353 Bacteria 43493
477 Ga0501082_0048004 3300060353 Bacteria 3679
478 Ga0501082_0115620 3300060353 Bacteria 2323
479 Ga0501082_0124227 3300060353 Bacteria 2238
480 Ga0501082_0131542 3300060353 Bacteria 2171
481 Ga0501082_1159617 3300060353 Bacteria 675
482 Ga0466962_0116737 3300061719 Bacteria 1286
483 Ga0373926_0070537
484 JGI24751J29686_10056195
485 JGI25153J46596_10008159
486 JGI25404J52841_10020160
487 Ga0065712_10356693
488 Ga0070658_10118467
489 Ga0070658_10490730
490 Ga0070658_10529662
491 Ga0070676_10146047
492 Ga0070670_100347850
493 Ga0068869_100106516
494 Ga0068869_100359785
495 Ga0070680_100016815
496 Ga0070680_100026107
497 Ga0068868_101247476
498 Ga0070660_100025186
499 Ga0070661_100112873
500 Ga0070669_100446256
501 Ga0070674_100284970
502 Ga0070659_100436689
503 Ga0070714_100090791
504 Ga0070714_100157319
505 Ga0070714_101280668
506 Ga0070710_10313926
507 Ga0070681_10079521
508 Ga0070681_10179071
509 Ga0070681_10232802
510 Ga0070699_101296220
511 Ga0070679_100050724
512 Ga0070679_100054287
513 Ga0070684_100237514
514 Ga0068853_100688510
515 Ga0070665_100321783
516 Ga0068855_101106312
517 Ga0070664_101337996
518 Ga0068857_100057201
519 Ga0068857_100945900
520 Ga0068856_100819910
521 Ga0068859_100476635
522 Ga0068864_100081481
523 Ga0068861_101228869
524 Ga0068870_10044225
525 Ga0068863_101267473
526 Ga0068858_100267606
527 Ga0068862_100812591
528 Ga0081540_1000054
529 Ga0081539_10013620
530 Ga0070717_10049259
531 Ga0070717_10732281
532 Ga0070717_11088788
533 Ga0075365_10124249
534 Ga0075365_10884988
535 Ga0075432_10394897
536 Ga0070716_101128363
537 Ga0070712_100001221
538 Ga0070712_100011722
539 Ga0075362_10361559
540 Ga0075366_10031057
541 Ga0075366_10034161
542 Ga0075370_10005821
543 Ga0075428_101210440
544 Ga0075434_101976115
545 Ga0075429_100307925
546 Ga0068865_100310535
547 Ga0097620_100476676
548 Ga0105240_10744992
549 Ga0111539_10015064
550 Ga0111539_11063271
551 Ga0105245_10337610
552 Ga0105247_10046837
553 Ga0114129_11555061
554 Ga0105243_10074000
555 Ga0105243_11055149
556 Ga0105241_10711915
557 Ga0105238_10467994
558 Ga0105238_10786763
559 Ga0105238_12537096
560 Ga0105249_10239062
561 Ga0157371_10336771
562 Ga0157370_10379661
563 Ga0157370_10929623
564 Ga0157369_11314321
565 Ga0157374_11645546
566 Ga0163162_10579501
567 Ga0163162_11897789
568 Ga0157372_12269488
569 Ga0163163_10022803
570 Ga0157380_10387367
571 Ga0157380_10567499
572 Ga0157376_11287118
573 Ga0182005_1051003
574 Ga0163161_10433896
575 Ga0206356_10122878
576 Ga0206356_10422222
577 Ga0206354_10205483
578 Ga0206353_10185415
579 Ga0206353_11666496
580 Ga0213873_10048276
581 Ga0213876_10020288
582 Ga0213875_10003821
583 Ga0224712_10170860
584 Ga0224712_10504490
585 Ga0228598_1007333
586 Ga0228598_1081122
587 Ga0209758_1000382
588 Ga0207692_10070614
589 Ga0207692_10340203
590 Ga0207692_11016653
591 Ga0207710_10020497
592 Ga0207688_10357489
593 Ga0207699_10941654
594 Ga0207645_10150624
595 Ga0207643_10028918
596 Ga0207705_10207096
597 Ga0207705_10417477
598 Ga0207705_10455166
599 Ga0207707_10032493
600 Ga0207707_10207479
601 Ga0207707_10246720
602 Ga0207695_11407724
603 Ga0207693_10002161
604 Ga0207693_10034679
605 Ga0207693_10062818
606 Ga0207693_10649085
607 Ga0207663_11243987
608 Ga0207660_10331694
609 Ga0207662_10149872
610 Ga0207657_10009131
611 Ga0207657_10037453
612 Ga0207649_10147906
613 Ga0207652_10028774
614 Ga0207652_10035704
615 Ga0207652_10057234
616 Ga0207652_10615611
617 Ga0207694_10478784
618 Ga0207694_10781980
619 Ga0207650_10624276
620 Ga0207659_10255324
621 Ga0207687_10542463
622 Ga0207700_10680523
623 Ga0207664_10137110
624 Ga0207664_10186933
625 Ga0207664_10556721
626 Ga0207690_10338587
627 Ga0207709_10751617
628 Ga0207669_10531779
629 Ga0207669_11074674
630 Ga0207665_10408027
631 Ga0207691_10128282
632 Ga0207689_10017121
633 Ga0207679_11260120
634 Ga0207667_11291347
635 Ga0207668_11322822
636 Ga0207658_11115115
637 Ga0207677_11606870
638 Ga0207678_10385788
639 Ga0207702_10386796
640 Ga0207702_10718988
641 Ga0207648_10172670
642 Ga0207676_10085844
643 Ga0207674_10931832
644 Ga0207675_101156167
645 Ga0207675_102251085
646 Ga0207698_10040979
647 Ga0207698_11363156
648 Ga0207428_10228455
649 Ga0268266_10556405
650 Ga0268266_11547650
651 Ga0268265_10364787
652 Ga0268265_10612809
653 Ga0265338_10137562
654 Ga0265763_1017529
655 Ga0265773_1004659
656 Ga0265760_10050519
657 Ga0265325_10000254
658 Ga0265325_10038439
659 Ga0265325_10040788
660 Ga0265339_10000016
661 Ga0265316_10244267
662 Ga0307408_101243614
663 Ga0265313_10000060
664 Ga0265313_10036467
665 Ga0265313_10043293
666 Ga0265342_10000464
667 Ga0307407_10827085
668 Ga0307412_10881755
669 Ga0307409_102379695
670 Ga0307416_102306345
671 Ga0316583_10264563
672 Ga0373944_0010355
673 Ga0373923_0078935
674 Ga0373923_0213477
675 Ga0373941_0001010
676 Ga0373945_0012067
677 Ga0373945_0062790
678 Ga0373943_0000078
679 Ga0373943_0009794
680 Ga0373946_0040718
681 Ga0373961_0002339
682 Ga0373924_0037412
683 Ga0373924_0520906
684 Ga0373935_0001829
685 Ga0373935_0058217
686 Ga0373935_0505018
687 Ga0373927_0030476
688 Ga0373927_0035127
689 Ga0373947_0000876
690 Ga0373947_0022273
691 Ga0373947_0028015
692 Ga0373947_0072026
693 Ga0373937_0396045
694 Ga0373937_0940445
695 Ga0373925_0005935
696 Ga0373925_0045735
697 Ga0373925_0050050
698 Ga0395899_0038411
699 Ga0395899_0180767
700 Ga0395900_0003699
701 Ga0395900_0015404
702 Ga0395900_0092621
703 Ga0395900_0134180
704 Ga0395898_0017310
705 Ga0395898_0055726
706 Ga0395898_0295523
707 Ga0316581_0168560
708 Ga0436364_0319525
709 Ga0395901_0019961
710 Ga0395901_0121902
711 Ga0395901_0326787
712 Ga0436365_0140754
713 Ga0436365_1858573
714 Ga0436363_1056244
715 Ga0436363_1287207
716 Ga0436362_0027881
717 Ga0436362_0714077
718 Ga0439453_0021132
719 Ga0451802_1766009
720 Ga0439441_014333
721 Ga0439446_0128563
722 Ga0439435_0054498
723 Ga0439440_0106808
724 Ga0466969_0142536
725 Ga0466961_0162617
726 Ga0466961_0345343
727 Ga0466963_0014198
728 Ga0466963_0108632
729 Ga0466963_0488926
730 Ga0466971_0067543
731 Ga0466968_0253881
732 Ga0466957_0010865
733 Ga0466957_0042945
734 Ga0466957_0063435
735 Ga0466957_0094054
736 Ga0466957_0249751
737 Ga0466957_0298617
738 Ga0466959_0322204
739 Ga0466958_0228623
740 Ga0466967_0170646
741 Ga0466967_0218962
742 Ga0495592_0086842
743 Ga0495629_0394583
744 Ga0495638_0495074
745 Ga0495580_0066808
746 Ga0495605_0063648
747 Ga0495639_0011952
748 Ga0495662_0001661
749 Ga0495664_0000068
750 Ga0495618_0002490
751 Ga0495618_0059298
752 Ga0495618_0180315
753 Ga0495630_0005326
754 Ga0495630_0007442
755 Ga0495666_0028628
756 Ga0495666_0108317
757 Ga0495652_0018812
758 Ga0495665_0010449
759 Ga0495665_0040237
760 Ga0495665_0048419
761 Ga0495665_0474925
762 Ga0495640_0010448
763 Ga0495640_0044373
764 Ga0495586_0005394
765 Ga0495598_0179154
766 Ga0495645_0001974
767 Ga0495634_0001076
768 Ga0495634_0039827
769 Ga0495635_0001029
770 Ga0495635_0248936
771 Ga0495659_0169355
772 Ga0495646_0120371
773 Ga0495647_0060188
774 Ga0495613_0042635
775 Ga0495624_0010737
776 Ga0495624_0472351
777 Ga0495600_0083277
778 Ga0495581_0032919
779 Ga0495581_0059187
780 Ga0495581_0075794
781 Ga0495636_0094684
782 Ga0495674_0011857
783 Ga0495676_0035027
784 Ga0495684_0001463
785 Ga0495684_0005781
786 Ga0495684_0006246
787 Ga0495593_0225076
788 Ga0496100_0032683
789 Ga0496102_0031866
790 Ga0496103_0292245
791 Ga0496104_0000637
792 Ga0496105_0001647
793 Ga0496108_0000408
794 Ga0496109_0131459
795 Ga0496110_0135321
796 Ga0496110_0415054
797 Ga0496110_0475042
798 Ga0496111_0006568
799 Ga0496112_0001429
800 Ga0496113_0009356
801 Ga0496114_0064902
802 Ga0496115_0001958
803 Ga0496126_0280298
804 Ga0501031_0321711
805 Ga0501031_0467637
806 Ga0501032_0010038
807 Ga0501032_0045661
808 Ga0501032_0115586
809 Ga0501032_0289572
810 Ga0501032_0320705
811 Ga0501033_0039434
812 Ga0501033_0079405
813 Ga0501033_0083680
814 Ga0501033_0345599
815 Ga0501033_0381920
816 Ga0501033_1069281
817 Ga0501034_0000230
818 Ga0501034_0009593
819 Ga0501034_0041386
820 Ga0501034_0045773
821 Ga0501034_0055124
822 Ga0501034_0135483
823 Ga0501034_0174264
824 Ga0501034_0628088
825 Ga0501034_0878971
826 Ga0501034_0957571
827 Ga0501036_0011440
828 Ga0501036_0089295
829 Ga0501036_0400178
830 Ga0501037_0013166
831 Ga0501037_0068405
832 Ga0501037_0122081
833 Ga0501037_0228596
834 Ga0501037_0358592
835 Ga0501038_0016142
836 Ga0501038_0223203
837 Ga0501038_0459898
838 Ga0501039_0013351
839 Ga0501039_0030042
840 Ga0501039_0342156
841 Ga0501040_0287433
842 Ga0501041_0381914
843 Ga0501043_0021697
844 Ga0501043_0025539
845 Ga0501043_0029674
846 Ga0501043_0070158
847 Ga0501043_0114280
848 Ga0501043_0458215
849 Ga0501046_0013278
850 Ga0501046_0119856
851 Ga0501046_0140011
852 Ga0501046_0351355
853 Ga0501047_0016107
854 Ga0501047_0028667
855 Ga0501047_0060832
856 Ga0501047_0081316
857 Ga0501047_0185502
858 Ga0501047_0202006
859 Ga0501048_0011685
860 Ga0501048_0727936
861 Ga0501067_0009573
862 Ga0501067_0110399
863 Ga0501067_0140353
864 Ga0501068_0011980
865 Ga0501068_0017372
866 Ga0501068_0670490
867 Ga0501069_0006266
868 Ga0501069_0076350
869 Ga0501070_0022303
870 Ga0501070_0022726
871 Ga0501070_0076485
872 Ga0501070_0192409
873 Ga0501070_0195030
874 Ga0501070_0256163
875 Ga0501070_0571631
876 Ga0501071_0041312
877 Ga0501071_0315471
878 Ga0501071_0637801
879 Ga0501072_0482624
880 Ga0501073_0007286
881 Ga0501073_0025323
882 Ga0501073_0136387
883 Ga0501073_0139709
884 Ga0501073_0917643
885 Ga0501074_0035152
886 Ga0501074_0078578
887 Ga0501074_0099067
888 Ga0501074_0114398
889 Ga0501076_0085337
890 Ga0501076_0855509
891 Ga0501079_0045918
892 Ga0501079_0075943
893 Ga0501079_0359774
894 Ga0501080_0017834
895 Ga0501080_0048640
896 Ga0501080_0111777
897 Ga0501080_0189179
898 Ga0501080_0190096
899 Ga0501080_0306924
900 Ga0501080_0432606
901 Ga0501080_0774449
902 Ga0501083_0019719
903 Ga0501083_0020163
904 Ga0501083_0101179
905 Ga0501083_0104424
906 Ga0501035_0089004
907 Ga0501035_0100253
908 Ga0501035_0144761
909 Ga0501035_0192795
910 Ga0501035_0314592
911 Ga0501035_0561533
912 Ga0501044_0000243
913 Ga0501044_0030887
914 Ga0501044_0096746
915 Ga0501044_0146267
916 Ga0501044_0185350
917 Ga0501044_0224982
918 Ga0501044_0304883
919 Ga0501044_0416600
920 Ga0501044_0538629
921 Ga0501044_0730126
922 Ga0501044_0753502
923 Ga0501045_0023330
924 Ga0501045_0237143
925 nmdc:mga0k408_223829_c1
926 nmdc:mga0k408_81961_c1
927 nmdc:mga08y16_245243_c1
928 nmdc:mga08y16_25017_c1
929 nmdc:mga0n895_1076914_c1
930 Ga0495601_0003852
931 Ga0495601_0076323
932 Ga0495612_0000522
933 Ga0495595_0226198
934 Ga0495619_0001804
935 Ga0495619_0277589
936 Ga0495619_0569411
937 Ga0500643_031945
938 Ga0500643_073926
939 Ga0500644_0000661
940 Ga0500651_0704434
941 Ga0500566_0055855
942 Ga0500641_0002620
943 Ga0500595_000006
944 Ga0500642_0305693
945 Ga0500652_089370
946 Ga0500652_176108
947 Ga0500577_0404300
948 Ga0500616_0000001
949 Ga0500616_0314194
950 Ga0500645_000743
951 Ga0501084_0118720
952 Ga0501084_0175980
953 Ga0501084_0187418
954 Ga0501084_0355278
955 Ga0501084_0605716
956 Ga0501084_0894159
957 Ga0587114_031723
958 Ga0501082_0000306
959 Ga0501082_0048004
960 Ga0501082_0115620
961 Ga0501082_0124227
962 Ga0501082_0131542
963 Ga0501082_1159617
964 Ga0466962_0116737

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

22

175

0.93

PF00578

AhpC-TSA

AhpC/TSA family

23

157

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uma-assembly3.cif.gz_C crystal structure of a hypothetical peroxiredoxin protein frm sinorhizobium meliloti 0.9713 1 161
5k2j-assembly4.cif.gz_H crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus 0.9655 3 160
3uma-assembly3.cif.gz_C crystal structure of a hypothetical peroxiredoxin protein frm sinorhizobium meliloti 0.9655 1 161
5k2j-assembly3.cif.gz_F crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus 0.9647 3 160
4f82-assembly1.cif.gz_B x-ray crystal structure of a putative thioredoxin reductase from burkholderia cenocepacia 0.9596 1 161
ID Description Score Start End Superfamily
3umaA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9621 1 161 3.40.30.10
4f82B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9596 1 161 3.40.30.10
af_Q54N76_3_172_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9561 1 161 3.40.30.10
4f82B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9538 1 161 3.40.30.10
af_Q54N76_3_172_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9503 1 161 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7Y9TEC9-F1-model_v4 deleted 0.9913 1 161
AF-A0A143PW28-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.9893 1 159 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A6N7GRI7-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.9887 1 161 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A539CSW6-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.988 1 161 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A7W9CUT7-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.9879 1 161 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454

Map