F452615

General Info

Members Datasets Scaffolds Average Seq Length
482 270 964 191

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10107971|Ga0163163_101079713
Length 230
Sequence VPGRLLGRRRGRQHDREDGGGPDHLRSSDCCVRTLQYTPMAALIEAIEIKRKMYFEFEGAPYHCIEVEVSRPTARGGQTLVRIKMRNLLTRAVFDKTFKAGEKFAEPDLEMVDAMFQYADSAGYHFMDQETFDTMTLQRDVVGDDRLLLVDNVLVQVQKYNGGPIGLQFPPHVELTVTSTEPGVRGDTASGGVTKSATLETGLEIRVPLFIKEGERVKVHTETREFAGRA

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
149 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
179 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
217 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
218 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
219 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
243 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
244 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 3.53
Rhizosphere 95.44
Stem 0
Stem Tuber 0
Unclassified 10.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10107971 3300014325 Bacteria 2810
2 JGI24743J22301_10054592 3300001991 Unclassified 817
3 Ga0065712_10089603 3300005290 Bacteria 2462
4 Ga0065712_10105732 3300005290 Bacteria 1932
5 Ga0065712_10207174 3300005290 Bacteria 1086
6 Ga0065712_10225856 3300005290 Bacteria 1026
7 Ga0065715_10062924 3300005293 Bacteria 820
8 Ga0065715_10093997 3300005293 Bacteria 4477
9 Ga0065715_10097827 3300005293 Bacteria 3643
10 Ga0065715_10191673 3300005293 Bacteria 1411
11 Ga0065715_10370979 3300005293 Bacteria 921
12 Ga0065707_10007719 3300005295 Bacteria 3090
13 Ga0070676_10065885 3300005328 Bacteria 2163
14 Ga0070683_100030485 3300005329 Bacteria 4898
15 Ga0070690_100120063 3300005330 Bacteria 1763
16 Ga0070690_100282873 3300005330 Bacteria 1184
17 Ga0070690_100506949 3300005330 Bacteria 904
18 Ga0070670_100007960 3300005331 Bacteria 9016
19 Ga0070670_100011426 3300005331 Bacteria 7595
20 Ga0070670_100081112 3300005331 Bacteria 2788
21 Ga0070670_100157179 3300005331 Unclassified 1969
22 Ga0070670_100533383 3300005331 Bacteria 1046
23 Ga0070677_10170588 3300005333 Bacteria 1028
24 Ga0070677_10341612 3300005333 Bacteria 773
25 Ga0068869_100179267 3300005334 Bacteria 1660
26 Ga0070666_10008861 3300005335 Bacteria 6255
27 Ga0070666_10061123 3300005335 Bacteria 2550
28 Ga0070666_10528375 3300005335 Bacteria 857
29 Ga0068868_100170091 3300005338 Bacteria 1804
30 Ga0068868_100307000 3300005338 Bacteria 1349
31 Ga0070660_100409541 3300005339 Bacteria 1122
32 Ga0070689_100082531 3300005340 Bacteria 2525
33 Ga0070689_100082618 3300005340 Bacteria 2523
34 Ga0070689_100508331 3300005340 Bacteria 1033
35 Ga0070687_100002048 3300005343 Bacteria 7406
36 Ga0070687_100013867 3300005343 Bacteria 3605
37 Ga0070668_100056902 3300005347 Bacteria 3021
38 Ga0070668_100106852 3300005347 Bacteria 2224
39 Ga0070668_100774311 3300005347 Bacteria 851
40 Ga0070669_100048727 3300005353 Bacteria 3092
41 Ga0070669_100060642 3300005353 Bacteria 2779
42 Ga0070669_100314805 3300005353 Bacteria 1263
43 Ga0070669_100340272 3300005353 Bacteria 1216
44 Ga0070675_100031458 3300005354 Bacteria 4291
45 Ga0070675_100033754 3300005354 Bacteria 4149
46 Ga0070675_100297889 3300005354 Unclassified 1420
47 Ga0070675_100563483 3300005354 Bacteria 1031
48 Ga0070675_100704231 3300005354 Bacteria 920
49 Ga0070671_100060088 3300005355 Bacteria 3164
50 Ga0070674_100013783 3300005356 Bacteria 5005
51 Ga0070674_100058500 3300005356 Bacteria 2680
52 Ga0070674_100184637 3300005356 Bacteria 1600
53 Ga0070674_100225454 3300005356 Bacteria 1460
54 Ga0070673_100006679 3300005364 Bacteria 7521
55 Ga0070673_100007438 3300005364 Bacteria 7223
56 Ga0070673_100061020 3300005364 Bacteria 2990
57 Ga0070688_100365501 3300005365 Bacteria 1060
58 Ga0070659_100044709 3300005366 Bacteria 3468
59 Ga0070659_100197666 3300005366 Unclassified 1654
60 Ga0070659_100734447 3300005366 Bacteria 855
61 Ga0070667_100215923 3300005367 Bacteria 1706
62 Ga0070709_10122939 3300005434 Unclassified 1762
63 Ga0070713_100021794 3300005436 Unclassified 4939
64 Ga0070701_10190021 3300005438 Bacteria 1208
65 Ga0070711_100668050 3300005439 Unclassified 872
66 Ga0070705_100014323 3300005440 Bacteria 4076
67 Ga0070700_100036982 3300005441 Bacteria 2966
68 Ga0070663_100373057 3300005455 Bacteria 1160
69 Ga0070678_100231406 3300005456 Bacteria 1541
70 Ga0070662_100154190 3300005457 Bacteria 1791
71 Ga0070681_10100525 3300005458 Unclassified 2838
72 Ga0068867_100032194 3300005459 Bacteria 3790
73 Ga0070707_100118056 3300005468 Bacteria 2575
74 Ga0070707_100602615 3300005468 Bacteria 1061
75 Ga0070699_100167952 3300005518 Bacteria 1944
76 Ga0070679_100174209 3300005530 Bacteria 2124
77 Ga0070697_100227607 3300005536 Bacteria 1590
78 Ga0070697_100250974 3300005536 Bacteria 1513
79 Ga0068853_100186690 3300005539 Bacteria 1882
80 Ga0070672_100062912 3300005543 Bacteria 2930
81 Ga0070686_100000861 3300005544 Bacteria 17630
82 Ga0070686_100105677 3300005544 Bacteria 1909
83 Ga0070686_100205067 3300005544 Bacteria 1416
84 Ga0070686_100806800 3300005544 Bacteria 757
85 Ga0070686_101330969 3300005544 Bacteria 601
86 Ga0070665_100064544 3300005548 Bacteria 3672
87 Ga0070665_100734999 3300005548 Bacteria 1000
88 Ga0068855_100023935 3300005563 Bacteria 7313
89 Ga0068855_101324315 3300005563 Bacteria 745
90 Ga0070664_100099756 3300005564 Bacteria 2524
91 Ga0068854_100037251 3300005578 Bacteria 3413
92 Ga0068854_100214670 3300005578 Bacteria 1519
93 Ga0068854_100357309 3300005578 Bacteria 1197
94 Ga0068852_100124400 3300005616 Bacteria 2365
95 Ga0068859_100012920 3300005617 Bacteria 8389
96 Ga0068864_100971884 3300005618 Unclassified 841
97 Ga0068866_10070321 3300005718 Bacteria 1847
98 Ga0068863_100035534 3300005841 Bacteria 4747
99 Ga0068858_100863419 3300005842 Unclassified 884
100 Ga0068860_100128684 3300005843 Bacteria 2428
101 Ga0068860_101014761 3300005843 Unclassified 848
102 Ga0068862_100083520 3300005844 Bacteria 2773
103 Ga0081455_10063248 3300005937 Unclassified 3106
104 Ga0081539_10186229 3300005985 Bacteria 970
105 Ga0070717_10348991 3300006028 Bacteria 1323
106 Ga0070717_11302149 3300006028 Bacteria 661
107 Ga0075365_10012519 3300006038 Bacteria 5042
108 Ga0097621_100453114 3300006237 Bacteria 1156
109 Ga0075428_100017122 3300006844 Bacteria 8006
110 Ga0075428_100031570 3300006844 Bacteria 5853
111 Ga0075428_100062385 3300006844 Bacteria 4081
112 Ga0075430_100020100 3300006846 Bacteria 5682
113 Ga0075430_100024045 3300006846 Bacteria 5187
114 Ga0075431_100011444 3300006847 Bacteria 8941
115 Ga0075431_100089125 3300006847 Bacteria 3185
116 Ga0075431_100358787 3300006847 Bacteria 1464
117 Ga0075431_101229689 3300006847 Bacteria 711
118 Ga0075433_10173806 3300006852 Bacteria 1916
119 Ga0075434_100284845 3300006871 Bacteria 1672
120 Ga0075434_100370190 3300006871 Bacteria 1454
121 Ga0075434_101005621 3300006871 Bacteria 848
122 Ga0075429_100029321 3300006880 Bacteria 4779
123 Ga0075429_100081141 3300006880 Bacteria 2828
124 Ga0075429_100112036 3300006880 Unclassified 2384
125 Ga0068865_100072457 3300006881 Bacteria 2447
126 Ga0075436_100358287 3300006914 Bacteria 1052
127 Ga0097620_100012920 3300006931 Bacteria 8389
128 Ga0075435_100001202 3300007076 Bacteria 16556
129 Ga0075435_100018211 3300007076 Bacteria 5333
130 Ga0075435_100065309 3300007076 Bacteria 2958
131 Ga0075435_100304557 3300007076 Bacteria 1363
132 Ga0105240_10033986 3300009093 Bacteria 6583
133 Ga0105240_10140780 3300009093 Bacteria 2885
134 Ga0111539_10008457 3300009094 Bacteria 13091
135 Ga0111539_10154792 3300009094 Bacteria 2683
136 Ga0111539_10613232 3300009094 Bacteria 1267
137 Ga0105245_10094399 3300009098 Bacteria 2757
138 Ga0105245_10942157 3300009098 Bacteria 906
139 Ga0114129_10006991 3300009147 Bacteria 16065
140 Ga0114129_10042348 3300009147 Bacteria 6412
141 Ga0114129_10140766 3300009147 Bacteria 3307
142 Ga0114129_10959365 3300009147 Bacteria 1079
143 Ga0105243_10107308 3300009148 Bacteria 2329
144 Ga0105243_10465227 3300009148 Unclassified 1190
145 Ga0105243_10615522 3300009148 Bacteria 1047
146 Ga0105241_10130186 3300009174 Bacteria 2036
147 Ga0105241_10640403 3300009174 Bacteria 964
148 Ga0105242_10065590 3300009176 Bacteria 2996
149 Ga0105242_10634877 3300009176 Bacteria 1036
150 Ga0105248_10010125 3300009177 Bacteria 10385
151 Ga0105248_10080963 3300009177 Bacteria 3651
152 Ga0105248_10315476 3300009177 Unclassified 1761
153 Ga0105237_11025230 3300009545 Unclassified 832
154 Ga0105238_10045882 3300009551 Bacteria 4414
155 Ga0105238_10120988 3300009551 Bacteria 2597
156 Ga0105238_10347416 3300009551 Bacteria 1472
157 Ga0105238_10588477 3300009551 Bacteria 1120
158 Ga0105249_10316437 3300009553 Bacteria 1571
159 Ga0105239_10112476 3300010375 Bacteria 3019
160 Ga0157374_10170513 3300013296 Bacteria 2123
161 Ga0157378_10539589 3300013297 Bacteria 1170
162 Ga0157378_11342979 3300013297 Bacteria 757
163 Ga0157375_10060665 3300013308 Bacteria 3752
164 Ga0157375_10069548 3300013308 Bacteria 3527
165 Ga0157380_10243243 3300014326 Bacteria 1624
166 Ga0157380_11090894 3300014326 Bacteria 837
167 Ga0157379_10658957 3300014968 Bacteria 980
168 Ga0157376_10278125 3300014969 Bacteria 1575
169 Ga0157376_11429012 3300014969 Bacteria 724
170 Ga0182007_10133048 3300015262 Bacteria 837
171 Ga0207697_10017224 3300025315 Bacteria 2970
172 Ga0207697_10048004 3300025315 Bacteria 1761
173 Ga0207697_10086970 3300025315 Bacteria 1322
174 Ga0207688_10003560 3300025901 Bacteria 8499
175 Ga0207688_10057803 3300025901 Bacteria 2181
176 Ga0207688_10237371 3300025901 Bacteria 1102
177 Ga0207647_10350436 3300025904 Bacteria 836
178 Ga0207699_10071895 3300025906 Bacteria 2117
179 Ga0207699_10122794 3300025906 Unclassified 1682
180 Ga0207699_10603003 3300025906 Bacteria 800
181 Ga0207645_10017839 3300025907 Bacteria 4680
182 Ga0207654_10058189 3300025911 Bacteria 2249
183 Ga0207707_10470896 3300025912 Bacteria 1074
184 Ga0207695_10166066 3300025913 Bacteria 2136
185 Ga0207695_10742050 3300025913 Bacteria 862
186 Ga0207663_10274261 3300025916 Unclassified 1250
187 Ga0207660_10617908 3300025917 Bacteria 883
188 Ga0207662_10004869 3300025918 Bacteria 7100
189 Ga0207662_10018758 3300025918 Bacteria 3929
190 Ga0207657_10053389 3300025919 Bacteria 3501
191 Ga0207657_10073321 3300025919 Bacteria 2893
192 Ga0207657_10378882 3300025919 Unclassified 1114
193 Ga0207649_10492531 3300025920 Bacteria 931
194 Ga0207646_10076778 3300025922 Unclassified 2986
195 Ga0207681_10033616 3300025923 Bacteria 3364
196 Ga0207681_10248807 3300025923 Bacteria 1387
197 Ga0207681_10420852 3300025923 Bacteria 1082
198 Ga0207694_10168744 3300025924 Bacteria 1771
199 Ga0207650_10023507 3300025925 Bacteria 4371
200 Ga0207650_10032575 3300025925 Bacteria 3770
201 Ga0207650_10040575 3300025925 Bacteria 3407
202 Ga0207650_10285904 3300025925 Bacteria 1344
203 Ga0207650_10329835 3300025925 Bacteria 1251
204 Ga0207650_10592202 3300025925 Bacteria 932
205 Ga0207650_10783639 3300025925 Bacteria 808
206 Ga0207659_10028951 3300025926 Bacteria 3769
207 Ga0207659_10126418 3300025926 Bacteria 1967
208 Ga0207659_10556453 3300025926 Unclassified 975
209 Ga0207659_10573353 3300025926 Bacteria 960
210 Ga0207687_10114703 3300025927 Bacteria 2006
211 Ga0207687_10173029 3300025927 Unclassified 1667
212 Ga0207700_10039262 3300025928 Bacteria 3444
213 Ga0207700_10240136 3300025928 Bacteria 1544
214 Ga0207664_10158485 3300025929 Bacteria 1929
215 Ga0207644_10023069 3300025931 Bacteria 4257
216 Ga0207690_10086414 3300025932 Bacteria 2204
217 Ga0207690_10258725 3300025932 Unclassified 1348
218 Ga0207690_10618931 3300025932 Bacteria 885
219 Ga0207706_10390127 3300025933 Bacteria 1208
220 Ga0207686_10174918 3300025934 Bacteria 1517
221 Ga0207670_10288220 3300025936 Bacteria 1282
222 Ga0207670_10464973 3300025936 Bacteria 1022
223 Ga0207669_10103417 3300025937 Bacteria 1889
224 Ga0207669_10130287 3300025937 Bacteria 1727
225 Ga0207665_10101316 3300025939 Unclassified 2011
226 Ga0207691_10605872 3300025940 Bacteria 927
227 Ga0207711_10018667 3300025941 Bacteria 5767
228 Ga0207711_10194035 3300025941 Bacteria 1852
229 Ga0207711_10433261 3300025941 Unclassified 1223
230 Ga0207689_10171078 3300025942 Bacteria 1791
231 Ga0207689_10193117 3300025942 Bacteria 1680
232 Ga0207679_10056071 3300025945 Unclassified 2908
233 Ga0207679_10206481 3300025945 Bacteria 1645
234 Ga0207679_10768659 3300025945 Bacteria 877
235 Ga0207651_10060856 3300025960 Bacteria 2623
236 Ga0207651_10108573 3300025960 Unclassified 2077
237 Ga0207712_10123333 3300025961 Bacteria 1964
238 Ga0207712_10159140 3300025961 Bacteria 1753
239 Ga0207712_10178186 3300025961 Bacteria 1667
240 Ga0207712_10909095 3300025961 Bacteria 778
241 Ga0207640_10021932 3300025981 Bacteria 3815
242 Ga0207640_10028123 3300025981 Bacteria 3433
243 Ga0207640_10783013 3300025981 Bacteria 825
244 Ga0207658_10139004 3300025986 Bacteria 1963
245 Ga0207677_10321491 3300026023 Bacteria 1286
246 Ga0207703_10204800 3300026035 Unclassified 1755
247 Ga0207703_10205925 3300026035 Bacteria 1751
248 Ga0207703_10543116 3300026035 Bacteria 1095
249 Ga0207678_10110956 3300026067 Bacteria 2340
250 Ga0207678_10454069 3300026067 Bacteria 1114
251 Ga0207708_10002822 3300026075 Bacteria 12768
252 Ga0207708_10090519 3300026075 Bacteria 2358
253 Ga0207641_10051621 3300026088 Bacteria 3483
254 Ga0207641_10963386 3300026088 Bacteria 849
255 Ga0207648_10083369 3300026089 Bacteria 2788
256 Ga0207648_10303849 3300026089 Bacteria 1431
257 Ga0207674_10367206 3300026116 Bacteria 1391
258 Ga0207675_100130549 3300026118 Bacteria 2382
259 Ga0207675_100320179 3300026118 Bacteria 1514
260 Ga0207675_100722862 3300026118 Bacteria 1006
261 Ga0207675_100902876 3300026118 Bacteria 900
262 Ga0207683_10149663 3300026121 Bacteria 2106
263 Ga0207683_10297550 3300026121 Bacteria 1476
264 Ga0207698_10136449 3300026142 Bacteria 2106
265 Ga0207698_10855168 3300026142 Bacteria 915
266 Ga0207428_10040822 3300027907 Bacteria 3759
267 Ga0207428_10230184 3300027907 Bacteria 1387
268 Ga0268266_10220517 3300028379 Bacteria 1743
269 Ga0268266_10233970 3300028379 Bacteria 1693
270 Ga0268265_10034802 3300028380 Bacteria 3675
271 Ga0268265_10430474 3300028380 Bacteria 1227
272 Ga0268265_10943551 3300028380 Bacteria 849
273 Ga0307408_100236685 3300031548 Bacteria 1498
274 Ga0307408_100319259 3300031548 Bacteria 1308
275 Ga0307408_100772454 3300031548 Bacteria 870
276 Ga0307405_10005541 3300031731 Bacteria 6100
277 Ga0307405_10035196 3300031731 Bacteria 2988
278 Ga0307405_10511627 3300031731 Bacteria 964
279 Ga0307410_10042712 3300031852 Bacteria 2998
280 Ga0307410_10622877 3300031852 Bacteria 902
281 Ga0307406_10151367 3300031901 Bacteria 1655
282 Ga0307407_10246947 3300031903 Bacteria 1221
283 Ga0307412_10095382 3300031911 Bacteria 2091
284 Ga0307416_100020352 3300032002 Bacteria 4732
285 Ga0307416_100058654 3300032002 Bacteria 3123
286 Ga0307416_101127783 3300032002 Bacteria 889
287 Ga0307414_10120541 3300032004 Bacteria 2016
288 Ga0307411_10443573 3300032005 Bacteria 1084
289 Ga0373950_0002264 3300034818 Bacteria 2634
290 Ga0373959_0099589 3300034820 Bacteria 690
291 Ga0373938_0002432 3300034957 Bacteria 3002
292 Ga0373926_0035556 3300035083 Bacteria 1768
293 Ga0373929_0103048 3300035085 Bacteria 721
294 Ga0373934_0150164 3300035086 Bacteria 954
295 Ga0373940_0008206 3300035088 Bacteria 2388
296 Ga0373949_0102232 3300035090 Bacteria 786
297 Ga0373951_0000334 3300035091 Bacteria 14616
298 Ga0373923_0014456 3300035111 Unclassified 2966
299 Ga0373923_0131692 3300035111 Unclassified 1124
300 Ga0373932_0001320 3300035112 Bacteria 6977
301 Ga0373936_0049060 3300035113 Bacteria 1705
302 Ga0373939_0004554 3300035114 Bacteria 3280
303 Ga0373941_0003171 3300035115 Bacteria 3693
304 Ga0373941_0039796 3300035115 Bacteria 1447
305 Ga0373954_0174703 3300035118 Unclassified 1053
306 Ga0373960_0001661 3300035121 Bacteria 4970
307 Ga0373943_0029014 3300035170 Bacteria 2611
308 Ga0373946_0006271 3300035171 Bacteria 4309
309 Ga0373955_0008161 3300035172 Bacteria 4847
310 Ga0373942_0000300 3300035207 Bacteria 13537
311 Ga0373961_0000941 3300035241 Bacteria 9710
312 Ga0373962_0005342 3300035242 Bacteria 3108
313 Ga0373924_0006286 3300035410 Bacteria 4249
314 Ga0373931_0293479 3300035691 Bacteria 1002
315 Ga0373935_0020418 3300035692 Bacteria 4048
316 Ga0373935_0120289 3300035692 Bacteria 1753
317 Ga0373947_0021871 3300035725 Bacteria 3706
318 Ga0373937_0002495 3300036401 Bacteria 15289
319 Ga0373937_0074834 3300036401 Bacteria 3126
320 Ga0373937_0317574 3300036401 Bacteria 1474
321 Ga0373925_0007289 3300037068 Bacteria 8082
322 Ga0373925_0274271 3300037068 Bacteria 1357
323 Ga0439439_0042274 3300041406 Bacteria 1184
324 Ga0439462_0045533 3300042015 Bacteria 1175
325 Ga0450898_022124 3300042134 Bacteria 1123
326 Ga0439464_0135586 3300042439 Bacteria 764
327 Ga0466965_0079763 3300044683 Unclassified 1654
328 Ga0466957_0470548 3300044842 Bacteria 868
329 Ga0451576_0028584 3300045051 Bacteria 5970
330 Ga0451576_0229678 3300045051 Bacteria 1938
331 Ga0451576_0392525 3300045051 Bacteria 1455
332 Ga0451576_0402163 3300045051 Bacteria 1436
333 Ga0451576_1168039 3300045051 Bacteria 804
334 Ga0451576_1345529 3300045051 Bacteria 744
335 Ga0495592_0032558 3300046454 Bacteria 3933
336 Ga0495629_0628626 3300046459 Bacteria 716
337 Ga0495651_0081196 3300046462 Bacteria 2448
338 Ga0495580_0085632 3300046472 Bacteria 2195
339 Ga0495582_0288785 3300046473 Unclassified 942
340 Ga0495639_0078308 3300046475 Bacteria 1536
341 Ga0495608_0024636 3300046511 Bacteria 4112
342 Ga0495608_0320830 3300046511 Bacteria 957
343 Ga0495628_0074438 3300046516 Unclassified 2645
344 Ga0495630_0129768 3300046517 Bacteria 1914
345 Ga0495652_0128256 3300046529 Unclassified 2012
346 Ga0495665_0223279 3300046531 Unclassified 974
347 Ga0495586_0267010 3300046535 Bacteria 978
348 Ga0495587_0027441 3300046536 Bacteria 3467
349 Ga0495634_0172008 3300046642 Bacteria 1361
350 Ga0495599_0118639 3300046678 Unclassified 1645
351 Ga0495658_0307121 3300046683 Unclassified 1004
352 Ga0495669_0023736 3300046684 Bacteria 2672
353 Ga0495613_0017722 3300046689 Bacteria 5305
354 Ga0495613_0158637 3300046689 Bacteria 1610
355 Ga0495604_0056542 3300047317 Bacteria 3019
356 Ga0495674_0018807 3300047319 Bacteria 6427
357 Ga0495680_0306379 3300047322 Unclassified 1114
358 Ga0495684_0000424 3300047471 Bacteria 34540
359 Ga0496100_0727505 3300048903 Unclassified 775
360 Ga0496102_0221745 3300048905 Bacteria 1783
361 Ga0496102_0548161 3300048905 Bacteria 1079
362 Ga0496103_0246838 3300048906 Bacteria 1149
363 Ga0496106_0060464 3300048909 Bacteria 2872
364 Ga0496106_0690499 3300048909 Bacteria 814
365 Ga0496106_1064752 3300048909 Bacteria 634
366 Ga0496107_0070696 3300048910 Bacteria 2535
367 Ga0496108_0457335 3300048911 Bacteria 1115
368 Ga0496109_0347992 3300048912 Bacteria 1400
369 Ga0496110_0211137 3300048913 Bacteria 1765
370 Ga0496110_0535518 3300048913 Bacteria 1065
371 Ga0496111_0286423 3300048914 Bacteria 1222
372 Ga0496112_0019050 3300048915 Bacteria 6470
373 Ga0496112_0966666 3300048915 Bacteria 772
374 Ga0496113_0054608 3300048916 Bacteria 2991
375 Ga0496113_0183311 3300048916 Bacteria 1660
376 Ga0501291_027488 3300049514 Bacteria 942
377 Ga0501292_023432 3300049515 Bacteria 1009
378 Ga0501298_002363 3300049521 Bacteria 2848
379 Ga0501299_000502 3300049522 Bacteria 4649
380 Ga0501032_0320440 3300049569 Unclassified 1000
381 Ga0501032_0523449 3300049569 Bacteria 757
382 Ga0501034_0001054 3300049571 Bacteria 39163
383 Ga0501034_0256964 3300049571 Bacteria 1690
384 Ga0501034_1252198 3300049571 Bacteria 619
385 Ga0501036_0097387 3300049572 Bacteria 2486
386 Ga0501036_0230169 3300049572 Bacteria 1555
387 Ga0501036_0439986 3300049572 Bacteria 1086
388 Ga0501037_0019703 3300049573 Bacteria 4976
389 Ga0501038_0111861 3300049574 Bacteria 2261
390 Ga0501038_0204456 3300049574 Unclassified 1583
391 Ga0501039_0160839 3300049575 Bacteria 1765
392 Ga0501040_0632633 3300049576 Bacteria 773
393 Ga0501041_0326652 3300049577 Bacteria 968
394 Ga0501042_0209845 3300049578 Bacteria 1405
395 Ga0501042_0555484 3300049578 Bacteria 834
396 Ga0501043_0000808 3300049579 Bacteria 27811
397 Ga0501043_0049747 3300049579 Bacteria 3295
398 Ga0501046_0011102 3300049580 Bacteria 7712
399 Ga0501046_0187869 3300049580 Bacteria 1542
400 Ga0501047_0000504 3300049581 Bacteria 42147
401 Ga0501047_0002612 3300049581 Bacteria 17155
402 Ga0501048_0011247 3300049582 Bacteria 6674
403 Ga0501048_0079271 3300049582 Bacteria 2317
404 Ga0501048_0610555 3300049582 Bacteria 783
405 Ga0501067_0024705 3300049583 Bacteria 3332
406 Ga0501069_0016811 3300049585 Bacteria 3930
407 Ga0501070_0186305 3300049586 Bacteria 1707
408 Ga0501071_0009875 3300049587 Bacteria 6373
409 Ga0501072_0029054 3300049588 Bacteria 4316
410 Ga0501072_0175196 3300049588 Bacteria 1711
411 Ga0501072_0184219 3300049588 Bacteria 1666
412 Ga0501072_0194499 3300049588 Unclassified 1617
413 Ga0501073_0007017 3300049589 Bacteria 8392
414 Ga0501073_0040567 3300049589 Unclassified 3293
415 Ga0501073_0100238 3300049589 Bacteria 2011
416 Ga0501075_0073440 3300049591 Bacteria 2587
417 Ga0501075_0127928 3300049591 Bacteria 1934
418 Ga0501076_0102622 3300049592 Bacteria 2306
419 Ga0501076_0324910 3300049592 Bacteria 1262
420 Ga0501076_0500211 3300049592 Archaea 1002
421 Ga0501077_0099982 3300049593 Bacteria 1838
422 Ga0501077_0245843 3300049593 Unclassified 1137
423 Ga0501216_002595 3300049660 Bacteria 2579
424 Ga0501233_025595 3300049668 Bacteria 1298
425 Ga0501248_002065 3300049678 Bacteria 1338
426 Ga0501079_0677483 3300049741 Bacteria 812
427 Ga0501080_0002328 3300049742 Bacteria 16581
428 Ga0501080_0121386 3300049742 Bacteria 2421
429 Ga0501081_0232121 3300049743 Unclassified 1344
430 Ga0501083_0067594 3300049744 Bacteria 2378
431 Ga0501083_0148219 3300049744 Bacteria 1536
432 Ga0501083_0739613 3300049744 Bacteria 640
433 Ga0501283_014190 3300049779 Bacteria 1215
434 Ga0501035_0591117 3300049822 Bacteria 905
435 Ga0501044_0003186 3300049823 Bacteria 18516
436 Ga0501044_0489886 3300049823 Unclassified 1131
437 nmdc:mga0yw44_166120_c1 3300050492 Bacteria 1447
438 nmdc:mga0k408_11847_c1 3300050493 Bacteria 4758
439 nmdc:mga05p37_3114_c1 3300050507 Bacteria 19286
440 nmdc:mga05p37_39128_c1 3300050507 Bacteria 5819
441 nmdc:mga05p37_4744_c1 3300050507 Bacteria 15883
442 nmdc:mga05p37_719668_c1 3300050507 Unclassified 1106
443 nmdc:mga09592_207726_c1 3300050508 Unclassified 1696
444 nmdc:mga09592_491969_c1 3300050508 Bacteria 1056
445 nmdc:mga09592_64914_c1 3300050508 Bacteria 3091
446 nmdc:mga09592_77877_c1 3300050508 Bacteria 2821
447 nmdc:mga0qj67_129973_c1 3300050509 Bacteria 2040
448 nmdc:mga0qj67_14076_c1 3300050509 Bacteria 6040
449 nmdc:mga0qj67_24712_c1 3300050509 Bacteria 4635
450 nmdc:mga0qj67_255794_c1 3300050509 Bacteria 1421
451 nmdc:mga0qj67_336370_c1 3300050509 Bacteria 1221
452 nmdc:mga06r32_117021_c1 3300050510 Bacteria 2627
453 nmdc:mga06r32_82466_c1 3300050510 Unclassified 3132
454 nmdc:mga08y16_1028777_c1 3300050511 Bacteria 802
455 nmdc:mga08y16_1785_c1 3300050511 Bacteria 21802
456 nmdc:mga08y16_240065_c1 3300050511 Bacteria 1873
457 nmdc:mga0n895_365076_c1 3300050512 Bacteria 1462
458 nmdc:mga0n895_395509_c1 3300050512 Bacteria 1398
459 nmdc:mga0n895_452143_c1 3300050512 Bacteria 1297
460 nmdc:mga0n895_812217_c1 3300050512 Bacteria 925
461 nmdc:mga0n895_857232_c1 3300050512 Bacteria 896
462 nmdc:mga0rr50_12587_c1 3300050513 Bacteria 5476
463 nmdc:mga0rr50_239411_c1 3300050513 Bacteria 1504
464 nmdc:mga0rr50_489711_c1 3300050513 Bacteria 1045
465 nmdc:mga0rr50_61836_c1 3300050513 Bacteria 2822
466 nmdc:mga0a205_278734_c1 3300050515 Bacteria 1547
467 Ga0495601_0273706 3300053077 Bacteria 1101
468 Ga0495619_0002235 3300053085 Bacteria 12802
469 Ga0495619_0388593 3300053085 Bacteria 964
470 Ga0500628_113048 3300053129 Bacteria 730
471 Ga0500628_119782 3300053129 Bacteria 714
472 Ga0501084_0003084 3300054114 Bacteria 13509
473 Ga0501084_0318447 3300054114 Unclassified 1314
474 Ga0501084_0892849 3300054114 Bacteria 747
475 Ga0590071_002190 3300059421 Bacteria 4966
476 Ga0590074_001974 3300059423 Unclassified 3357
477 Ga0590075_000124 3300059424 Bacteria 19855
478 Ga0501082_0045552 3300060353 Bacteria 3782
479 Ga0501082_0131825 3300060353 Bacteria 2169
480 Ga0501082_0542662 3300060353 Bacteria 1017
481 Ga0501082_0761337 3300060353 Bacteria 847
482 Ga0530510_0822764 3300061734 Bacteria 709
483 Ga0163163_10107971
484 JGI24743J22301_10054592
485 Ga0065712_10089603
486 Ga0065712_10105732
487 Ga0065712_10207174
488 Ga0065712_10225856
489 Ga0065715_10062924
490 Ga0065715_10093997
491 Ga0065715_10097827
492 Ga0065715_10191673
493 Ga0065715_10370979
494 Ga0065707_10007719
495 Ga0070676_10065885
496 Ga0070683_100030485
497 Ga0070690_100120063
498 Ga0070690_100282873
499 Ga0070690_100506949
500 Ga0070670_100007960
501 Ga0070670_100011426
502 Ga0070670_100081112
503 Ga0070670_100157179
504 Ga0070670_100533383
505 Ga0070677_10170588
506 Ga0070677_10341612
507 Ga0068869_100179267
508 Ga0070666_10008861
509 Ga0070666_10061123
510 Ga0070666_10528375
511 Ga0068868_100170091
512 Ga0068868_100307000
513 Ga0070660_100409541
514 Ga0070689_100082531
515 Ga0070689_100082618
516 Ga0070689_100508331
517 Ga0070687_100002048
518 Ga0070687_100013867
519 Ga0070668_100056902
520 Ga0070668_100106852
521 Ga0070668_100774311
522 Ga0070669_100048727
523 Ga0070669_100060642
524 Ga0070669_100314805
525 Ga0070669_100340272
526 Ga0070675_100031458
527 Ga0070675_100033754
528 Ga0070675_100297889
529 Ga0070675_100563483
530 Ga0070675_100704231
531 Ga0070671_100060088
532 Ga0070674_100013783
533 Ga0070674_100058500
534 Ga0070674_100184637
535 Ga0070674_100225454
536 Ga0070673_100006679
537 Ga0070673_100007438
538 Ga0070673_100061020
539 Ga0070688_100365501
540 Ga0070659_100044709
541 Ga0070659_100197666
542 Ga0070659_100734447
543 Ga0070667_100215923
544 Ga0070709_10122939
545 Ga0070713_100021794
546 Ga0070701_10190021
547 Ga0070711_100668050
548 Ga0070705_100014323
549 Ga0070700_100036982
550 Ga0070663_100373057
551 Ga0070678_100231406
552 Ga0070662_100154190
553 Ga0070681_10100525
554 Ga0068867_100032194
555 Ga0070707_100118056
556 Ga0070707_100602615
557 Ga0070699_100167952
558 Ga0070679_100174209
559 Ga0070697_100227607
560 Ga0070697_100250974
561 Ga0068853_100186690
562 Ga0070672_100062912
563 Ga0070686_100000861
564 Ga0070686_100105677
565 Ga0070686_100205067
566 Ga0070686_100806800
567 Ga0070686_101330969
568 Ga0070665_100064544
569 Ga0070665_100734999
570 Ga0068855_100023935
571 Ga0068855_101324315
572 Ga0070664_100099756
573 Ga0068854_100037251
574 Ga0068854_100214670
575 Ga0068854_100357309
576 Ga0068852_100124400
577 Ga0068859_100012920
578 Ga0068864_100971884
579 Ga0068866_10070321
580 Ga0068863_100035534
581 Ga0068858_100863419
582 Ga0068860_100128684
583 Ga0068860_101014761
584 Ga0068862_100083520
585 Ga0081455_10063248
586 Ga0081539_10186229
587 Ga0070717_10348991
588 Ga0070717_11302149
589 Ga0075365_10012519
590 Ga0097621_100453114
591 Ga0075428_100017122
592 Ga0075428_100031570
593 Ga0075428_100062385
594 Ga0075430_100020100
595 Ga0075430_100024045
596 Ga0075431_100011444
597 Ga0075431_100089125
598 Ga0075431_100358787
599 Ga0075431_101229689
600 Ga0075433_10173806
601 Ga0075434_100284845
602 Ga0075434_100370190
603 Ga0075434_101005621
604 Ga0075429_100029321
605 Ga0075429_100081141
606 Ga0075429_100112036
607 Ga0068865_100072457
608 Ga0075436_100358287
609 Ga0097620_100012920
610 Ga0075435_100001202
611 Ga0075435_100018211
612 Ga0075435_100065309
613 Ga0075435_100304557
614 Ga0105240_10033986
615 Ga0105240_10140780
616 Ga0111539_10008457
617 Ga0111539_10154792
618 Ga0111539_10613232
619 Ga0105245_10094399
620 Ga0105245_10942157
621 Ga0114129_10006991
622 Ga0114129_10042348
623 Ga0114129_10140766
624 Ga0114129_10959365
625 Ga0105243_10107308
626 Ga0105243_10465227
627 Ga0105243_10615522
628 Ga0105241_10130186
629 Ga0105241_10640403
630 Ga0105242_10065590
631 Ga0105242_10634877
632 Ga0105248_10010125
633 Ga0105248_10080963
634 Ga0105248_10315476
635 Ga0105237_11025230
636 Ga0105238_10045882
637 Ga0105238_10120988
638 Ga0105238_10347416
639 Ga0105238_10588477
640 Ga0105249_10316437
641 Ga0105239_10112476
642 Ga0157374_10170513
643 Ga0157378_10539589
644 Ga0157378_11342979
645 Ga0157375_10060665
646 Ga0157375_10069548
647 Ga0157380_10243243
648 Ga0157380_11090894
649 Ga0157379_10658957
650 Ga0157376_10278125
651 Ga0157376_11429012
652 Ga0182007_10133048
653 Ga0207697_10017224
654 Ga0207697_10048004
655 Ga0207697_10086970
656 Ga0207688_10003560
657 Ga0207688_10057803
658 Ga0207688_10237371
659 Ga0207647_10350436
660 Ga0207699_10071895
661 Ga0207699_10122794
662 Ga0207699_10603003
663 Ga0207645_10017839
664 Ga0207654_10058189
665 Ga0207707_10470896
666 Ga0207695_10166066
667 Ga0207695_10742050
668 Ga0207663_10274261
669 Ga0207660_10617908
670 Ga0207662_10004869
671 Ga0207662_10018758
672 Ga0207657_10053389
673 Ga0207657_10073321
674 Ga0207657_10378882
675 Ga0207649_10492531
676 Ga0207646_10076778
677 Ga0207681_10033616
678 Ga0207681_10248807
679 Ga0207681_10420852
680 Ga0207694_10168744
681 Ga0207650_10023507
682 Ga0207650_10032575
683 Ga0207650_10040575
684 Ga0207650_10285904
685 Ga0207650_10329835
686 Ga0207650_10592202
687 Ga0207650_10783639
688 Ga0207659_10028951
689 Ga0207659_10126418
690 Ga0207659_10556453
691 Ga0207659_10573353
692 Ga0207687_10114703
693 Ga0207687_10173029
694 Ga0207700_10039262
695 Ga0207700_10240136
696 Ga0207664_10158485
697 Ga0207644_10023069
698 Ga0207690_10086414
699 Ga0207690_10258725
700 Ga0207690_10618931
701 Ga0207706_10390127
702 Ga0207686_10174918
703 Ga0207670_10288220
704 Ga0207670_10464973
705 Ga0207669_10103417
706 Ga0207669_10130287
707 Ga0207665_10101316
708 Ga0207691_10605872
709 Ga0207711_10018667
710 Ga0207711_10194035
711 Ga0207711_10433261
712 Ga0207689_10171078
713 Ga0207689_10193117
714 Ga0207679_10056071
715 Ga0207679_10206481
716 Ga0207679_10768659
717 Ga0207651_10060856
718 Ga0207651_10108573
719 Ga0207712_10123333
720 Ga0207712_10159140
721 Ga0207712_10178186
722 Ga0207712_10909095
723 Ga0207640_10021932
724 Ga0207640_10028123
725 Ga0207640_10783013
726 Ga0207658_10139004
727 Ga0207677_10321491
728 Ga0207703_10204800
729 Ga0207703_10205925
730 Ga0207703_10543116
731 Ga0207678_10110956
732 Ga0207678_10454069
733 Ga0207708_10002822
734 Ga0207708_10090519
735 Ga0207641_10051621
736 Ga0207641_10963386
737 Ga0207648_10083369
738 Ga0207648_10303849
739 Ga0207674_10367206
740 Ga0207675_100130549
741 Ga0207675_100320179
742 Ga0207675_100722862
743 Ga0207675_100902876
744 Ga0207683_10149663
745 Ga0207683_10297550
746 Ga0207698_10136449
747 Ga0207698_10855168
748 Ga0207428_10040822
749 Ga0207428_10230184
750 Ga0268266_10220517
751 Ga0268266_10233970
752 Ga0268265_10034802
753 Ga0268265_10430474
754 Ga0268265_10943551
755 Ga0307408_100236685
756 Ga0307408_100319259
757 Ga0307408_100772454
758 Ga0307405_10005541
759 Ga0307405_10035196
760 Ga0307405_10511627
761 Ga0307410_10042712
762 Ga0307410_10622877
763 Ga0307406_10151367
764 Ga0307407_10246947
765 Ga0307412_10095382
766 Ga0307416_100020352
767 Ga0307416_100058654
768 Ga0307416_101127783
769 Ga0307414_10120541
770 Ga0307411_10443573
771 Ga0373950_0002264
772 Ga0373959_0099589
773 Ga0373938_0002432
774 Ga0373926_0035556
775 Ga0373929_0103048
776 Ga0373934_0150164
777 Ga0373940_0008206
778 Ga0373949_0102232
779 Ga0373951_0000334
780 Ga0373923_0014456
781 Ga0373923_0131692
782 Ga0373932_0001320
783 Ga0373936_0049060
784 Ga0373939_0004554
785 Ga0373941_0003171
786 Ga0373941_0039796
787 Ga0373954_0174703
788 Ga0373960_0001661
789 Ga0373943_0029014
790 Ga0373946_0006271
791 Ga0373955_0008161
792 Ga0373942_0000300
793 Ga0373961_0000941
794 Ga0373962_0005342
795 Ga0373924_0006286
796 Ga0373931_0293479
797 Ga0373935_0020418
798 Ga0373935_0120289
799 Ga0373947_0021871
800 Ga0373937_0002495
801 Ga0373937_0074834
802 Ga0373937_0317574
803 Ga0373925_0007289
804 Ga0373925_0274271
805 Ga0439439_0042274
806 Ga0439462_0045533
807 Ga0450898_022124
808 Ga0439464_0135586
809 Ga0466965_0079763
810 Ga0466957_0470548
811 Ga0451576_0028584
812 Ga0451576_0229678
813 Ga0451576_0392525
814 Ga0451576_0402163
815 Ga0451576_1168039
816 Ga0451576_1345529
817 Ga0495592_0032558
818 Ga0495629_0628626
819 Ga0495651_0081196
820 Ga0495580_0085632
821 Ga0495582_0288785
822 Ga0495639_0078308
823 Ga0495608_0024636
824 Ga0495608_0320830
825 Ga0495628_0074438
826 Ga0495630_0129768
827 Ga0495652_0128256
828 Ga0495665_0223279
829 Ga0495586_0267010
830 Ga0495587_0027441
831 Ga0495634_0172008
832 Ga0495599_0118639
833 Ga0495658_0307121
834 Ga0495669_0023736
835 Ga0495613_0017722
836 Ga0495613_0158637
837 Ga0495604_0056542
838 Ga0495674_0018807
839 Ga0495680_0306379
840 Ga0495684_0000424
841 Ga0496100_0727505
842 Ga0496102_0221745
843 Ga0496102_0548161
844 Ga0496103_0246838
845 Ga0496106_0060464
846 Ga0496106_0690499
847 Ga0496106_1064752
848 Ga0496107_0070696
849 Ga0496108_0457335
850 Ga0496109_0347992
851 Ga0496110_0211137
852 Ga0496110_0535518
853 Ga0496111_0286423
854 Ga0496112_0019050
855 Ga0496112_0966666
856 Ga0496113_0054608
857 Ga0496113_0183311
858 Ga0501291_027488
859 Ga0501292_023432
860 Ga0501298_002363
861 Ga0501299_000502
862 Ga0501032_0320440
863 Ga0501032_0523449
864 Ga0501034_0001054
865 Ga0501034_0256964
866 Ga0501034_1252198
867 Ga0501036_0097387
868 Ga0501036_0230169
869 Ga0501036_0439986
870 Ga0501037_0019703
871 Ga0501038_0111861
872 Ga0501038_0204456
873 Ga0501039_0160839
874 Ga0501040_0632633
875 Ga0501041_0326652
876 Ga0501042_0209845
877 Ga0501042_0555484
878 Ga0501043_0000808
879 Ga0501043_0049747
880 Ga0501046_0011102
881 Ga0501046_0187869
882 Ga0501047_0000504
883 Ga0501047_0002612
884 Ga0501048_0011247
885 Ga0501048_0079271
886 Ga0501048_0610555
887 Ga0501067_0024705
888 Ga0501069_0016811
889 Ga0501070_0186305
890 Ga0501071_0009875
891 Ga0501072_0029054
892 Ga0501072_0175196
893 Ga0501072_0184219
894 Ga0501072_0194499
895 Ga0501073_0007017
896 Ga0501073_0040567
897 Ga0501073_0100238
898 Ga0501075_0073440
899 Ga0501075_0127928
900 Ga0501076_0102622
901 Ga0501076_0324910
902 Ga0501076_0500211
903 Ga0501077_0099982
904 Ga0501077_0245843
905 Ga0501216_002595
906 Ga0501233_025595
907 Ga0501248_002065
908 Ga0501079_0677483
909 Ga0501080_0002328
910 Ga0501080_0121386
911 Ga0501081_0232121
912 Ga0501083_0067594
913 Ga0501083_0148219
914 Ga0501083_0739613
915 Ga0501283_014190
916 Ga0501035_0591117
917 Ga0501044_0003186
918 Ga0501044_0489886
919 nmdc:mga0yw44_166120_c1
920 nmdc:mga0k408_11847_c1
921 nmdc:mga05p37_3114_c1
922 nmdc:mga05p37_39128_c1
923 nmdc:mga05p37_4744_c1
924 nmdc:mga05p37_719668_c1
925 nmdc:mga09592_207726_c1
926 nmdc:mga09592_491969_c1
927 nmdc:mga09592_64914_c1
928 nmdc:mga09592_77877_c1
929 nmdc:mga0qj67_129973_c1
930 nmdc:mga0qj67_14076_c1
931 nmdc:mga0qj67_24712_c1
932 nmdc:mga0qj67_255794_c1
933 nmdc:mga0qj67_336370_c1
934 nmdc:mga06r32_117021_c1
935 nmdc:mga06r32_82466_c1
936 nmdc:mga08y16_1028777_c1
937 nmdc:mga08y16_1785_c1
938 nmdc:mga08y16_240065_c1
939 nmdc:mga0n895_365076_c1
940 nmdc:mga0n895_395509_c1
941 nmdc:mga0n895_452143_c1
942 nmdc:mga0n895_812217_c1
943 nmdc:mga0n895_857232_c1
944 nmdc:mga0rr50_12587_c1
945 nmdc:mga0rr50_239411_c1
946 nmdc:mga0rr50_489711_c1
947 nmdc:mga0rr50_61836_c1
948 nmdc:mga0a205_278734_c1
949 Ga0495601_0273706
950 Ga0495619_0002235
951 Ga0495619_0388593
952 Ga0500628_113048
953 Ga0500628_119782
954 Ga0501084_0003084
955 Ga0501084_0318447
956 Ga0501084_0892849
957 Ga0590071_002190
958 Ga0590074_001974
959 Ga0590075_000124
960 Ga0501082_0045552
961 Ga0501082_0131825
962 Ga0501082_0542662
963 Ga0501082_0761337
964 Ga0530510_0822764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

173

229

0.99

PF01132

EFP

Elongation factor P (EF-P) OB domain

112

165

0.97

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

45

104

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a5z-assembly1.cif.gz_B crystal structure of escherichia coli genx in complex with elongation factor p 0.9065 6 131
3tre-assembly1.cif.gz_A structure of a translation elongation factor p (efp) from coxiella burnetii 0.891 6 131
6s8z-assembly1.cif.gz_A elongation factor p from corynebacterium glutamicum 0.8894 5 191
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.8762 5 63
6s8z-assembly1.cif.gz_A elongation factor p from corynebacterium glutamicum 0.876 5 191
ID Description Score Start End Superfamily
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9566 70 131 2.40.50.140
5j3bA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9536 134 191 2.40.50.140
3oyyB01 Mainly Beta;Roll;SH3 type barrels.; 0.9531 6 67 2.30.30.30
af_I1JVU1_192_244_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9455 134 191 2.40.50.140
af_I1L709_116_178_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9401 69 131 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7C6EIA7-F1-model_v4 Elongation factor P 0.9623 2 131 GO:0003746
GO:0005737
AF-A0A7C9N6X9-F1-model_v4 Elongation factor P (EF-P) 0.9596 3 191 GO:0003746
GO:0005737
GO:0043043
AF-A0A7C9N6X9-F1-model_v4 Elongation factor P (EF-P) 0.9496 3 191 GO:0003746
GO:0005737
GO:0043043
AF-A0A6I7NM69-F1-model_v4 Elongation factor P (EF-P) 0.9357 5 191 GO:0003746
GO:0005737
GO:0043043
AF-A0A7C5YWC1-F1-model_v4 Elongation factor P (EF-P) 0.9342 5 191 GO:0003746
GO:0005737
GO:0043043

Map