F452504

General Info

Members Datasets Scaffolds Average Seq Length
481 235 962 260

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0365242|Ga0501036_0365242_43_840
Length 265
Sequence MAQSIRVENVTKEFTLRYHRTFKQVTVAMLKGRKISDSFNAVDDVSFTVSAGESIGLMGLNGSGKSTLLKMINGVMRPDAGTVRTRGRIAGLIATGAGFHPQLSGQENIRLNAAILGMSEKEINRKYDEIVAFSEIDTKFLQTEVGHYSSGMSARLGFSVAIHVDSEIFLADEVLAVGDRPFKRKCLQKMEEVRDSGRTLFYVSHSAGSVRKMCTRVLVLEKGRLIFDGDVDEGIKILHYDEDKSENEPDRDEEFVQDEELGADI

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
126 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
130 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
211 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
212 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 2643221561 Nocardioides sp. Root151 Isolate Unclassified
219 2643221576 Nocardioides sp. Root614 Isolate Unclassified
220 2643221590 Nocardioides sp. Root682 Isolate Unclassified
221 2643221604 Nocardioides sp. Root190 Isolate Unclassified
222 2643221615 Nocardioides sp. Root224 Isolate Unclassified
223 2643221617 Nocardioides sp. Root79 Isolate Unclassified
224 2643221620 Nocardioides sp. Root240 Isolate Unclassified
225 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
226 2643221696 Nocardioides sp. Root140 Isolate Unclassified
227 2738541305 Nocardioides sp. CF167 Isolate Unclassified
228 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
229 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
230 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
231 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
232 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
233 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
234 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
235 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.84
Metatranscriptomes 0.42
Isolates 3.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.47
Nodule 0.21
Rhizoplane 12.27
Rhizosphere 70.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0365242 3300049572 Bacteria 1205
2 LJQas_1006285 3300000549 Bacteria 1484
3 JGI24735J21928_10018507 3300002067 Bacteria 2146
4 Ga0070658_10054372 3300005327 Bacteria 3251
5 Ga0070683_100000255 3300005329 Bacteria 36630
6 Ga0070683_100023135 3300005329 Bacteria 5556
7 Ga0070683_100044056 3300005329 Bacteria 4114
8 Ga0070683_100070699 3300005329 Bacteria 3256
9 Ga0070682_100057036 3300005337 Bacteria 2459
10 Ga0070682_100072891 3300005337 Bacteria 2202
11 Ga0068868_100126293 3300005338 Bacteria 2090
12 Ga0068868_100143848 3300005338 Bacteria 1960
13 Ga0068868_100666579 3300005338 Bacteria 928
14 Ga0070660_100001151 3300005339 Bacteria 17850
15 Ga0070660_100057864 3300005339 Bacteria 3004
16 Ga0070687_100037057 3300005343 Bacteria 2435
17 Ga0070661_100123053 3300005344 Bacteria 1944
18 Ga0070692_10038588 3300005345 Bacteria 2435
19 Ga0070674_100193067 3300005356 Bacteria 1568
20 Ga0070659_100010693 3300005366 Bacteria 6760
21 Ga0070659_100011705 3300005366 Bacteria 6494
22 Ga0070659_100073163 3300005366 Bacteria 2728
23 Ga0070659_100141357 3300005366 Bacteria 1960
24 Ga0070714_100000592 3300005435 Bacteria 25957
25 Ga0070701_10006720 3300005438 Bacteria 4862
26 Ga0070700_100101494 3300005441 Bacteria 1896
27 Ga0070663_100117696 3300005455 Bacteria 2004
28 Ga0070678_100172350 3300005456 Bacteria 1764
29 Ga0070662_100399485 3300005457 Bacteria 1134
30 Ga0070681_10077698 3300005458 Bacteria 3277
31 Ga0068867_100028929 3300005459 Bacteria 3990
32 Ga0070685_10184675 3300005466 Bacteria 1345
33 Ga0070679_100043485 3300005530 Bacteria 4474
34 Ga0070679_100179149 3300005530 Bacteria 2092
35 Ga0070684_100004575 3300005535 Bacteria 10547
36 Ga0070684_100019524 3300005535 Bacteria 5607
37 Ga0070684_100121289 3300005535 Bacteria 2352
38 Ga0070672_100046208 3300005543 Bacteria 3372
39 Ga0070665_100001640 3300005548 Bacteria 25777
40 Ga0070665_100118334 3300005548 Bacteria 2651
41 Ga0070665_100172030 3300005548 Bacteria 2167
42 Ga0068855_100035186 3300005563 Bacteria 5966
43 Ga0070664_100426771 3300005564 Bacteria 1215
44 Ga0068857_100005847 3300005577 Bacteria 10504
45 Ga0068854_100097324 3300005578 Bacteria 2200
46 Ga0068856_100086328 3300005614 Bacteria 3118
47 Ga0070702_100111027 3300005615 Bacteria 1700
48 Ga0070702_100136496 3300005615 Bacteria 1557
49 Ga0068852_100027042 3300005616 Bacteria 4671
50 Ga0068852_100088078 3300005616 Bacteria 2772
51 Ga0068864_100065467 3300005618 Bacteria 3153
52 Ga0068864_100162291 3300005618 Bacteria 2032
53 Ga0068866_10136839 3300005718 Bacteria 1401
54 Ga0068861_100128883 3300005719 Bacteria 2051
55 Ga0068863_100236717 3300005841 Bacteria 1762
56 Ga0068858_100010218 3300005842 Bacteria 8907
57 Ga0075365_10002390 3300006038 Bacteria 9178
58 Ga0075365_10119173 3300006038 Bacteria 1819
59 Ga0075365_10162427 3300006038 Bacteria 1557
60 Ga0075365_10192296 3300006038 Bacteria 1428
61 Ga0075365_10206068 3300006038 Bacteria 1378
62 Ga0075368_10000233 3300006042 Bacteria 15683
63 Ga0075368_10026583 3300006042 Bacteria 2227
64 Ga0075368_10071266 3300006042 Bacteria 1404
65 Ga0075363_100001659 3300006048 Bacteria 8612
66 Ga0075363_100003899 3300006048 Bacteria 6435
67 Ga0075363_100141805 3300006048 Bacteria 1353
68 Ga0075363_100147130 3300006048 Bacteria 1328
69 Ga0075364_10009113 3300006051 Bacteria 5944
70 Ga0075364_10014320 3300006051 Bacteria 4900
71 Ga0075364_10049628 3300006051 Bacteria 2738
72 Ga0075364_10151359 3300006051 Bacteria 1563
73 Ga0075362_10003130 3300006177 Bacteria 5715
74 Ga0075367_10004034 3300006178 Bacteria 7102
75 Ga0075367_10049559 3300006178 Bacteria 2476
76 Ga0075367_10077691 3300006178 Bacteria 2004
77 Ga0075370_10021214 3300006353 Bacteria 3559
78 Ga0075370_10260950 3300006353 Bacteria 1027
79 Ga0075428_100195854 3300006844 Bacteria 2185
80 Ga0068865_100009530 3300006881 Bacteria 6025
81 Ga0111539_10062709 3300009094 Bacteria 4399
82 Ga0105245_10002342 3300009098 Bacteria 17132
83 Ga0105245_10021113 3300009098 Bacteria 5711
84 Ga0105245_10083662 3300009098 Bacteria 2921
85 Ga0105245_10089634 3300009098 Bacteria 2828
86 Ga0105243_10170029 3300009148 Bacteria 1887
87 Ga0105242_10481634 3300009176 Bacteria 1176
88 Ga0105248_10125214 3300009177 Bacteria 2899
89 Ga0105248_10217540 3300009177 Bacteria 2151
90 Ga0105237_10169336 3300009545 Bacteria 2184
91 Ga0105249_10012458 3300009553 Bacteria 7496
92 Ga0105249_10171965 3300009553 Bacteria 2102
93 Ga0105249_10479976 3300009553 Bacteria 1286
94 Ga0105239_10004561 3300010375 Bacteria 16514
95 Ga0105239_10014136 3300010375 Bacteria 8859
96 Ga0105246_10007528 3300011119 Bacteria 6680
97 Ga0105246_10044837 3300011119 Bacteria 3007
98 Ga0105246_10431728 3300011119 Bacteria 1102
99 Ga0157370_10663891 3300013104 Bacteria 952
100 Ga0157369_10069070 3300013105 Bacteria 3796
101 Ga0157369_10206235 3300013105 Bacteria 2061
102 Ga0157369_10418363 3300013105 Bacteria 1389
103 Ga0157369_10426628 3300013105 Bacteria 1374
104 Ga0157369_10475975 3300013105 Bacteria 1292
105 Ga0157378_10749419 3300013297 Bacteria 999
106 Ga0163162_10755358 3300013306 Bacteria 1091
107 Ga0157372_10023295 3300013307 Bacteria 6711
108 Ga0157372_10039688 3300013307 Bacteria 5197
109 Ga0157372_10107451 3300013307 Bacteria 3193
110 Ga0157372_10979259 3300013307 Bacteria 980
111 Ga0157375_10045472 3300013308 Bacteria 4273
112 Ga0157375_10127635 3300013308 Bacteria 2660
113 Ga0157375_10236945 3300013308 Bacteria 1984
114 Ga0157375_10295635 3300013308 Bacteria 1783
115 Ga0157375_10398179 3300013308 Bacteria 1544
116 Ga0157375_10694854 3300013308 Bacteria 1171
117 Ga0163163_10100480 3300014325 Bacteria 2915
118 Ga0163163_10159481 3300014325 Bacteria 2301
119 Ga0163163_10264906 3300014325 Bacteria 1770
120 Ga0157380_10124911 3300014326 Bacteria 2185
121 Ga0182008_10068443 3300014497 Bacteria 1747
122 Ga0182008_10131163 3300014497 Bacteria 1249
123 Ga0157379_10056534 3300014968 Bacteria 3505
124 Ga0163161_10134891 3300017792 Bacteria 1865
125 Ga0206353_11293323 3300020082 Bacteria 1221
126 Ga0213876_10152155 3300021384 Bacteria 1230
127 Ga0213875_10082587 3300021388 Bacteria 1499
128 Ga0207697_10111653 3300025315 Bacteria 1171
129 Ga0207642_10139310 3300025899 Bacteria 1277
130 Ga0207647_10007904 3300025904 Bacteria 7649
131 Ga0207647_10014047 3300025904 Bacteria 5536
132 Ga0207647_10030453 3300025904 Bacteria 3480
133 Ga0207707_10171442 3300025912 Bacteria 1896
134 Ga0207657_10003077 3300025919 Bacteria 17844
135 Ga0207657_10119897 3300025919 Bacteria 2165
136 Ga0207657_10268772 3300025919 Bacteria 1356
137 Ga0207649_10143489 3300025920 Bacteria 1637
138 Ga0207652_10033701 3300025921 Bacteria 4313
139 Ga0207659_10594108 3300025926 Bacteria 943
140 Ga0207687_10009326 3300025927 Bacteria 6420
141 Ga0207664_10000969 3300025929 Bacteria 19338
142 Ga0207690_10093944 3300025932 Bacteria 2126
143 Ga0207690_10094108 3300025932 Bacteria 2125
144 Ga0207690_10224105 3300025932 Bacteria 1440
145 Ga0207709_10121820 3300025935 Bacteria 1762
146 Ga0207711_10453607 3300025941 Bacteria 1194
147 Ga0207661_10006174 3300025944 Bacteria 8468
148 Ga0207661_10110001 3300025944 Bacteria 2328
149 Ga0207679_10027725 3300025945 Bacteria 3921
150 Ga0207712_10055847 3300025961 Bacteria 2780
151 Ga0207668_10285313 3300025972 Bacteria 1356
152 Ga0207640_10199575 3300025981 Bacteria 1515
153 Ga0207658_10006018 3300025986 Bacteria 8287
154 Ga0207658_10234296 3300025986 Bacteria 1551
155 Ga0207658_10370060 3300025986 Bacteria 1253
156 Ga0207677_10065275 3300026023 Bacteria 2539
157 Ga0207703_10320031 3300026035 Bacteria 1420
158 Ga0207639_10660024 3300026041 Bacteria 968
159 Ga0207678_10174269 3300026067 Bacteria 1837
160 Ga0207678_10301843 3300026067 Bacteria 1376
161 Ga0207708_10142651 3300026075 Bacteria 1880
162 Ga0207708_10398248 3300026075 Bacteria 1138
163 Ga0207702_10087664 3300026078 Bacteria 2718
164 Ga0207641_10169257 3300026088 Bacteria 1993
165 Ga0207648_10032952 3300026089 Bacteria 4572
166 Ga0207676_10103678 3300026095 Bacteria 2364
167 Ga0207674_10007124 3300026116 Bacteria 13065
168 Ga0207674_10466022 3300026116 Bacteria 1221
169 Ga0207675_100005486 3300026118 Bacteria 12152
170 Ga0207675_100080277 3300026118 Bacteria 3058
171 Ga0207683_10262585 3300026121 Bacteria 1577
172 Ga0207683_10795699 3300026121 Bacteria 878
173 Ga0207698_10060851 3300026142 Bacteria 2938
174 Ga0207698_10205666 3300026142 Bacteria 1767
175 Ga0209813_10026972 3300027866 Bacteria 1665
176 Ga0207428_10058682 3300027907 Bacteria 3053
177 Ga0268266_10003007 3300028379 Bacteria 17329
178 Ga0268266_10122146 3300028379 Bacteria 2319
179 Ga0268264_10000193 3300028381 Bacteria 126247
180 Ga0268264_10000402 3300028381 Bacteria 61871
181 Ga0307405_10057874 3300031731 Bacteria 2437
182 Ga0307405_10290830 3300031731 Bacteria 1235
183 Ga0307410_10342805 3300031852 Bacteria 1192
184 Ga0307406_10103105 3300031901 Bacteria 1948
185 Ga0307406_10449304 3300031901 Bacteria 1034
186 Ga0307406_10635253 3300031901 Bacteria 884
187 Ga0307412_10150730 3300031911 Bacteria 1715
188 Ga0307412_10161429 3300031911 Bacteria 1666
189 Ga0307409_100085091 3300031995 Bacteria 2569
190 Ga0307409_100244309 3300031995 Bacteria 1636
191 Ga0307416_100262089 3300032002 Bacteria 1690
192 Ga0307416_100327131 3300032002 Bacteria 1538
193 Ga0307414_10036845 3300032004 Bacteria 3270
194 Ga0307415_100028591 3300032126 Bacteria 3549
195 Ga0307415_100037783 3300032126 Bacteria 3176
196 Ga0307415_100101975 3300032126 Bacteria 2107
197 Ga0307415_100327110 3300032126 Bacteria 1281
198 Ga0373952_0067463 3300035092 Bacteria 888
199 Ga0373931_0403498 3300035691 Bacteria 866
200 Ga0373925_0249169 3300037068 Bacteria 1424
201 Ga0395900_0032515 3300037418 Bacteria 5365
202 Ga0395900_0285838 3300037418 Bacteria 1640
203 Ga0395898_0235985 3300037466 Bacteria 1744
204 Ga0395905_0122977 3300037471 Bacteria 2440
205 Ga0395905_0214376 3300037471 Bacteria 1803
206 Ga0436364_0793971 3300037853 Bacteria 1831
207 Ga0395901_0048465 3300038443 Bacteria 4412
208 Ga0395901_0067507 3300038443 Bacteria 3724
209 Ga0395901_0121795 3300038443 Bacteria 2741
210 Ga0395901_0841165 3300038443 Bacteria 904
211 Ga0242420_018515 3300038996 Bacteria 1227
212 Ga0436365_0032095 3300039437 Bacteria 1275
213 Ga0439436_0070037 3300041404 Bacteria 978
214 Ga0439447_040057 3300041407 Bacteria 1145
215 Ga0451802_1233361 3300041460 Bacteria 1807
216 Ga0439431_0013333 3300041997 Bacteria 1895
217 Ga0439442_001518 3300042002 Bacteria 4561
218 Ga0450907_006419 3300042146 Bacteria 1964
219 Ga0439434_0004119 3300042435 Bacteria 4248
220 Ga0466972_0010054 3300044658 Bacteria 4753
221 Ga0466972_0048359 3300044658 Bacteria 2055
222 Ga0466965_0001240 3300044683 Bacteria 10105
223 Ga0466965_0058824 3300044683 Bacteria 1917
224 Ga0466965_0234135 3300044683 Bacteria 982
225 Ga0466966_0325864 3300044684 Bacteria 923
226 Ga0466961_0033586 3300044693 Bacteria 3295
227 Ga0466961_0082174 3300044693 Bacteria 2038
228 Ga0466961_0129711 3300044693 Bacteria 1580
229 Ga0466961_0144265 3300044693 Bacteria 1489
230 Ga0466963_0003112 3300044694 Bacteria 9405
231 Ga0466963_0024196 3300044694 Bacteria 3866
232 Ga0466963_0033034 3300044694 Bacteria 3356
233 Ga0466963_0040956 3300044694 Bacteria 3037
234 Ga0466963_0068673 3300044694 Bacteria 2381
235 Ga0466963_0125800 3300044694 Bacteria 1767
236 Ga0466963_0148359 3300044694 Bacteria 1628
237 Ga0466963_0160119 3300044694 Bacteria 1566
238 Ga0466963_0255195 3300044694 Bacteria 1231
239 Ga0466963_0377024 3300044694 Bacteria 1000
240 Ga0466964_0012210 3300044706 Bacteria 3250
241 Ga0466964_0028201 3300044706 Bacteria 2210
242 Ga0466964_0066214 3300044706 Bacteria 1516
243 Ga0466971_0010806 3300044719 Bacteria 3993
244 Ga0466971_0117519 3300044719 Bacteria 1230
245 Ga0466968_0063071 3300044735 Bacteria 1602
246 Ga0466970_0001397 3300044765 Bacteria 11657
247 Ga0466970_0023979 3300044765 Bacteria 3189
248 Ga0466970_0170069 3300044765 Bacteria 1207
249 Ga0466957_0008608 3300044842 Bacteria 5805
250 Ga0466957_0017144 3300044842 Bacteria 4239
251 Ga0466957_0045897 3300044842 Bacteria 2651
252 Ga0466957_0065270 3300044842 Bacteria 2241
253 Ga0466957_0087982 3300044842 Bacteria 1943
254 Ga0466960_0000705 3300044901 Bacteria 11644
255 Ga0466960_0000887 3300044901 Bacteria 10567
256 Ga0466960_0003988 3300044901 Bacteria 5736
257 Ga0466960_0015596 3300044901 Bacteria 3279
258 Ga0466960_0041033 3300044901 Bacteria 2191
259 Ga0466958_0014380 3300045836 Bacteria 4520
260 Ga0466967_0002740 3300045976 Bacteria 11147
261 Ga0466967_0016578 3300045976 Bacteria 5816
262 Ga0466967_0022381 3300045976 Bacteria 5155
263 Ga0466967_0061996 3300045976 Bacteria 3318
264 Ga0466967_0070786 3300045976 Bacteria 3121
265 Ga0466967_0104131 3300045976 Bacteria 2597
266 Ga0466967_0255039 3300045976 Bacteria 1677
267 Ga0466967_0302477 3300045976 Bacteria 1539
268 Ga0466967_0336759 3300045976 Bacteria 1458
269 Ga0466967_0767579 3300045976 Bacteria 956
270 Ga0495603_0017099 3300046455 Bacteria 4390
271 Ga0495653_0369331 3300046463 Bacteria 919
272 Ga0495582_0068263 3300046473 Bacteria 1965
273 Ga0495587_0294167 3300046536 Bacteria 909
274 Ga0495635_0255828 3300046663 Bacteria 1180
275 Ga0496100_0117409 3300048903 Bacteria 1857
276 Ga0496100_0233784 3300048903 Bacteria 1353
277 Ga0496101_0045714 3300048904 Bacteria 3137
278 Ga0496101_0099971 3300048904 Bacteria 2169
279 Ga0496101_0427212 3300048904 Bacteria 1044
280 Ga0496101_0467599 3300048904 Bacteria 995
281 Ga0496102_0018512 3300048905 Bacteria 6122
282 Ga0496102_0021297 3300048905 Bacteria 5733
283 Ga0496102_0025917 3300048905 Bacteria 5224
284 Ga0496102_0235042 3300048905 Bacteria 1728
285 Ga0496103_0039000 3300048906 Bacteria 2918
286 Ga0496103_0072499 3300048906 Bacteria 2157
287 Ga0496103_0084146 3300048906 Bacteria 2003
288 Ga0496103_0248463 3300048906 Bacteria 1145
289 Ga0496104_0007462 3300048907 Bacteria 9665
290 Ga0496104_0028500 3300048907 Bacteria 5176
291 Ga0496104_0110441 3300048907 Bacteria 2636
292 Ga0496104_0299470 3300048907 Bacteria 1520
293 Ga0496105_0005589 3300048908 Bacteria 9555
294 Ga0496105_0146446 3300048908 Bacteria 1942
295 Ga0496105_0205231 3300048908 Bacteria 1608
296 Ga0496106_0050387 3300048909 Bacteria 3139
297 Ga0496107_0023461 3300048910 Bacteria 4362
298 Ga0496107_0051756 3300048910 Bacteria 2963
299 Ga0496107_0052771 3300048910 Bacteria 2932
300 Ga0496108_0073061 3300048911 Bacteria 2896
301 Ga0496108_0098582 3300048911 Bacteria 2490
302 Ga0496108_0115418 3300048911 Bacteria 2300
303 Ga0496108_0163941 3300048911 Bacteria 1922
304 Ga0496108_0199096 3300048911 Bacteria 1738
305 Ga0496109_0012316 3300048912 Bacteria 7384
306 Ga0496109_0092092 3300048912 Bacteria 2803
307 Ga0496109_0093020 3300048912 Bacteria 2789
308 Ga0496109_0122572 3300048912 Bacteria 2422
309 Ga0496109_0136155 3300048912 Bacteria 2295
310 Ga0496109_0202916 3300048912 Bacteria 1864
311 Ga0496109_0209727 3300048912 Bacteria 1832
312 Ga0496109_0274691 3300048912 Bacteria 1588
313 Ga0496109_0292385 3300048912 Bacteria 1536
314 Ga0496110_0049011 3300048913 Bacteria 3704
315 Ga0496110_0062367 3300048913 Bacteria 3292
316 Ga0496110_0574682 3300048913 Bacteria 1023
317 Ga0496111_0014764 3300048914 Bacteria 5345
318 Ga0496111_0482909 3300048914 Bacteria 913
319 Ga0496111_0678713 3300048914 Bacteria 750
320 Ga0496112_0031994 3300048915 Bacteria 5107
321 Ga0496113_0171337 3300048916 Bacteria 1719
322 Ga0496113_0204733 3300048916 Bacteria 1569
323 Ga0496114_0003493 3300048917 Bacteria 12071
324 Ga0496114_0007859 3300048917 Bacteria 8438
325 Ga0496114_0011638 3300048917 Bacteria 7036
326 Ga0496114_0014367 3300048917 Bacteria 6352
327 Ga0496114_0057894 3300048917 Bacteria 3236
328 Ga0496114_0191229 3300048917 Bacteria 1791
329 Ga0496114_0238140 3300048917 Bacteria 1600
330 Ga0496115_0037503 3300048918 Bacteria 3841
331 Ga0496115_0057823 3300048918 Bacteria 3119
332 Ga0496115_0294380 3300048918 Bacteria 1331
333 Ga0501299_024978 3300049522 Bacteria 1119
334 Ga0501031_0001511 3300049568 Bacteria 14498
335 Ga0501031_0077221 3300049568 Bacteria 2169
336 Ga0501031_0165368 3300049568 Bacteria 1446
337 Ga0501032_0005290 3300049569 Bacteria 9598
338 Ga0501032_0313012 3300049569 Bacteria 1014
339 Ga0501033_0092183 3300049570 Bacteria 2216
340 Ga0501034_0001740 3300049571 Bacteria 27957
341 Ga0501034_0051391 3300049571 Bacteria 4156
342 Ga0501034_0792139 3300049571 Bacteria 841
343 Ga0501036_0001023 3300049572 Bacteria 21122
344 Ga0501036_0002895 3300049572 Bacteria 13618
345 Ga0501037_0015382 3300049573 Bacteria 5630
346 Ga0501037_0131644 3300049573 Bacteria 1793
347 Ga0501038_0002730 3300049574 Bacteria 16449
348 Ga0501038_0002983 3300049574 Bacteria 15776
349 Ga0501038_0286386 3300049574 Bacteria 1296
350 Ga0501039_0015161 3300049575 Bacteria 5898
351 Ga0501039_0125336 3300049575 Bacteria 2015
352 Ga0501040_0032161 3300049576 Bacteria 3550
353 Ga0501041_0147549 3300049577 Bacteria 1468
354 Ga0501041_0250569 3300049577 Bacteria 1113
355 Ga0501042_0019249 3300049578 Bacteria 4738
356 Ga0501043_0019192 3300049579 Bacteria 5367
357 Ga0501043_0040112 3300049579 Bacteria 3680
358 Ga0501046_0001247 3300049580 Bacteria 24612
359 Ga0501046_0426970 3300049580 Bacteria 955
360 Ga0501047_0023602 3300049581 Bacteria 5903
361 Ga0501047_0103490 3300049581 Bacteria 2727
362 Ga0501048_0002020 3300049582 Bacteria 15407
363 Ga0501048_0287010 3300049582 Bacteria 1170
364 Ga0501048_0356480 3300049582 Bacteria 1043
365 Ga0501067_0000740 3300049583 Bacteria 17563
366 Ga0501067_0008185 3300049583 Bacteria 5807
367 Ga0501067_0011471 3300049583 Bacteria 4908
368 Ga0501067_0121355 3300049583 Bacteria 1454
369 Ga0501068_0009476 3300049584 Bacteria 5451
370 Ga0501068_0019641 3300049584 Bacteria 3927
371 Ga0501068_0112889 3300049584 Bacteria 1691
372 Ga0501068_0180585 3300049584 Bacteria 1334
373 Ga0501069_0015248 3300049585 Bacteria 4119
374 Ga0501069_0019035 3300049585 Bacteria 3709
375 Ga0501069_0181981 3300049585 Bacteria 1215
376 Ga0501070_0002540 3300049586 Bacteria 15987
377 Ga0501070_0019715 3300049586 Bacteria 5656
378 Ga0501070_0020285 3300049586 Bacteria 5575
379 Ga0501070_0503532 3300049586 Bacteria 973
380 Ga0501071_0202148 3300049587 Bacteria 1493
381 Ga0501071_0258704 3300049587 Bacteria 1314
382 Ga0501072_0029676 3300049588 Bacteria 4273
383 Ga0501073_0003948 3300049589 Bacteria 11124
384 Ga0501073_0137661 3300049589 Bacteria 1692
385 Ga0501073_0301594 3300049589 Bacteria 1105
386 Ga0501074_0019325 3300049590 Bacteria 4949
387 Ga0501074_0028274 3300049590 Bacteria 4063
388 Ga0501074_0051477 3300049590 Bacteria 2972
389 Ga0501074_0387515 3300049590 Bacteria 991
390 Ga0501075_0074488 3300049591 Bacteria 2568
391 Ga0501076_0292251 3300049592 Bacteria 1335
392 Ga0501077_0178758 3300049593 Bacteria 1348
393 Ga0501077_0279422 3300049593 Bacteria 1063
394 Ga0501079_0009378 3300049741 Bacteria 7417
395 Ga0501079_0043159 3300049741 Bacteria 3481
396 Ga0501079_0153830 3300049741 Bacteria 1793
397 Ga0501079_0348480 3300049741 Bacteria 1160
398 Ga0501080_0008035 3300049742 Bacteria 9560
399 Ga0501080_0181813 3300049742 Bacteria 1934
400 Ga0501080_0326683 3300049742 Bacteria 1388
401 Ga0501080_0556637 3300049742 Bacteria 1021
402 Ga0501081_0265544 3300049743 Bacteria 1255
403 Ga0501083_0003831 3300049744 Bacteria 10564
404 Ga0501083_0059378 3300049744 Bacteria 2558
405 Ga0501083_0090512 3300049744 Bacteria 2021
406 Ga0501035_0003346 3300049822 Bacteria 15366
407 Ga0501035_0013604 3300049822 Bacteria 7506
408 Ga0501035_0300008 3300049822 Bacteria 1354
409 Ga0501044_0002750 3300049823 Bacteria 20015
410 Ga0501044_0050158 3300049823 Bacteria 4307
411 Ga0501045_0068174 3300049824 Bacteria 2613
412 Ga0501045_0336829 3300049824 Bacteria 1123
413 Ga0501045_0357780 3300049824 Bacteria 1086
414 nmdc:mga03683_130844_c1 3300050489 Bacteria 1122
415 nmdc:mga03n38_1285_c1 3300050490 Bacteria 7068
416 nmdc:mga00v17_129019_c1 3300050491 Bacteria 1615
417 nmdc:mga00v17_273495_c1 3300050491 Bacteria 1096
418 nmdc:mga00v17_4072_c1 3300050491 Bacteria 7556
419 nmdc:mga00v17_4456_c1 3300050491 Bacteria 7291
420 nmdc:mga00v17_57952_c1 3300050491 Bacteria 2371
421 nmdc:mga00v17_60005_c1 3300050491 Bacteria 2335
422 nmdc:mga00v17_8926_c1 3300050491 Bacteria 5408
423 nmdc:mga0yw44_1093_c1 3300050492 Bacteria 10433
424 nmdc:mga0yw44_116442_c1 3300050492 Bacteria 1717
425 nmdc:mga0yw44_126917_c1 3300050492 Bacteria 1648
426 nmdc:mga0yw44_145673_c1 3300050492 Bacteria 1542
427 nmdc:mga0yw44_173177_c1 3300050492 Bacteria 1418
428 nmdc:mga0yw44_241414_c1 3300050492 Bacteria 1201
429 nmdc:mga0yw44_30521_c1 3300050492 Bacteria 3125
430 nmdc:mga0yw44_320119_c1 3300050492 Bacteria 1041
431 nmdc:mga0yw44_345137_c1 3300050492 Bacteria 1002
432 nmdc:mga0yw44_39663_c1 3300050492 Bacteria 2794
433 nmdc:mga0yw44_805_c1 3300050492 Bacteria 11662
434 nmdc:mga0yw44_9413_c1 3300050492 Bacteria 4939
435 nmdc:mga06z11_18965_c1 3300050494 Bacteria 3153
436 nmdc:mga06z11_2055_c1 3300050494 Bacteria 7640
437 nmdc:mga06z11_83537_c1 3300050494 Bacteria 1719
438 nmdc:mga04h51_14970_c1 3300050495 Bacteria 2227
439 nmdc:mga04h51_45846_c1 3300050495 Bacteria 1447
440 nmdc:mga07m45_136796_c1 3300050496 Bacteria 1418
441 nmdc:mga07m45_2536_c1 3300050496 Bacteria 8576
442 nmdc:mga07m45_262502_c1 3300050496 Bacteria 1005
443 nmdc:mga07m45_4785_c1 3300050496 Bacteria 6660
444 nmdc:mga08y16_12621_c1 3300050511 Bacteria 8888
445 Ga0495655_0005070 3300053083 Bacteria 2301
446 Ga0500644_0000177 3300053088 Bacteria 40984
447 Ga0500556_0001134 3300053104 Bacteria 13090
448 Ga0500593_000970 3300053117 Bacteria 10530
449 Ga0500655_035223 3300053133 Bacteria 972
450 Ga0500573_0017758 3300053140 Bacteria 4052
451 Ga0500573_0131801 3300053140 Bacteria 1384
452 Ga0500573_0194538 3300053140 Bacteria 1081
453 Ga0501084_0160934 3300054114 Bacteria 1894
454 Ga0501084_0166160 3300054114 Bacteria 1862
455 Ga0587069_005872 3300059642 Bacteria 1450
456 Ga0501082_0004395 3300060353 Bacteria 12308
457 Ga0501082_0122027 3300060353 Bacteria 2259
458 Ga0501082_0422028 3300060353 Bacteria 1165
459 Ga0466962_0004315 3300061719 Bacteria 6818
460 Ga0466962_0023023 3300061719 Bacteria 2995
461 Ga0466962_0114933 3300061719 Bacteria 1297
462 Ga0530510_0252045 3300061734 Bacteria 1316
463 Ga0530510_0281014 3300061734 Bacteria 1243
464 2643824064 2643221561 Bacteria 4984412
465 2643892551 2643221576 Bacteria 5214352
466 2643961603 2643221590 Bacteria 5214697
467 2644032471 2643221604 Bacteria 5014917
468 2644091858 2643221615 Bacteria 5487866
469 2644102640 2643221617 Bacteria 5139111
470 2644118302 2643221620 Bacteria 5134593
471 2644321661 2643221657 Bacteria 5490246
472 2644533371 2643221696 Bacteria 5431823
473 2738870654 2738541305 Bacteria 4910150
474 2809198208 2808606439 Bacteria 5952208
475 2809226776 2808606447 Bacteria 3572005
476 2812334060 2811994874 Bacteria 5367947
477 2812353121 2811994878 Bacteria 5992952
478 2855389169 2855386786 Bacteria 4752232
479 2891969251 2891968417 Bacteria 5821697
480 3003004426 3002998708 Bacteria 11715108
481 8054614372 8054609563 Bacteria 5170090
482 Ga0501036_0365242
483 LJQas_1006285
484 JGI24735J21928_10018507
485 Ga0070658_10054372
486 Ga0070683_100000255
487 Ga0070683_100023135
488 Ga0070683_100044056
489 Ga0070683_100070699
490 Ga0070682_100057036
491 Ga0070682_100072891
492 Ga0068868_100126293
493 Ga0068868_100143848
494 Ga0068868_100666579
495 Ga0070660_100001151
496 Ga0070660_100057864
497 Ga0070687_100037057
498 Ga0070661_100123053
499 Ga0070692_10038588
500 Ga0070674_100193067
501 Ga0070659_100010693
502 Ga0070659_100011705
503 Ga0070659_100073163
504 Ga0070659_100141357
505 Ga0070714_100000592
506 Ga0070701_10006720
507 Ga0070700_100101494
508 Ga0070663_100117696
509 Ga0070678_100172350
510 Ga0070662_100399485
511 Ga0070681_10077698
512 Ga0068867_100028929
513 Ga0070685_10184675
514 Ga0070679_100043485
515 Ga0070679_100179149
516 Ga0070684_100004575
517 Ga0070684_100019524
518 Ga0070684_100121289
519 Ga0070672_100046208
520 Ga0070665_100001640
521 Ga0070665_100118334
522 Ga0070665_100172030
523 Ga0068855_100035186
524 Ga0070664_100426771
525 Ga0068857_100005847
526 Ga0068854_100097324
527 Ga0068856_100086328
528 Ga0070702_100111027
529 Ga0070702_100136496
530 Ga0068852_100027042
531 Ga0068852_100088078
532 Ga0068864_100065467
533 Ga0068864_100162291
534 Ga0068866_10136839
535 Ga0068861_100128883
536 Ga0068863_100236717
537 Ga0068858_100010218
538 Ga0075365_10002390
539 Ga0075365_10119173
540 Ga0075365_10162427
541 Ga0075365_10192296
542 Ga0075365_10206068
543 Ga0075368_10000233
544 Ga0075368_10026583
545 Ga0075368_10071266
546 Ga0075363_100001659
547 Ga0075363_100003899
548 Ga0075363_100141805
549 Ga0075363_100147130
550 Ga0075364_10009113
551 Ga0075364_10014320
552 Ga0075364_10049628
553 Ga0075364_10151359
554 Ga0075362_10003130
555 Ga0075367_10004034
556 Ga0075367_10049559
557 Ga0075367_10077691
558 Ga0075370_10021214
559 Ga0075370_10260950
560 Ga0075428_100195854
561 Ga0068865_100009530
562 Ga0111539_10062709
563 Ga0105245_10002342
564 Ga0105245_10021113
565 Ga0105245_10083662
566 Ga0105245_10089634
567 Ga0105243_10170029
568 Ga0105242_10481634
569 Ga0105248_10125214
570 Ga0105248_10217540
571 Ga0105237_10169336
572 Ga0105249_10012458
573 Ga0105249_10171965
574 Ga0105249_10479976
575 Ga0105239_10004561
576 Ga0105239_10014136
577 Ga0105246_10007528
578 Ga0105246_10044837
579 Ga0105246_10431728
580 Ga0157370_10663891
581 Ga0157369_10069070
582 Ga0157369_10206235
583 Ga0157369_10418363
584 Ga0157369_10426628
585 Ga0157369_10475975
586 Ga0157378_10749419
587 Ga0163162_10755358
588 Ga0157372_10023295
589 Ga0157372_10039688
590 Ga0157372_10107451
591 Ga0157372_10979259
592 Ga0157375_10045472
593 Ga0157375_10127635
594 Ga0157375_10236945
595 Ga0157375_10295635
596 Ga0157375_10398179
597 Ga0157375_10694854
598 Ga0163163_10100480
599 Ga0163163_10159481
600 Ga0163163_10264906
601 Ga0157380_10124911
602 Ga0182008_10068443
603 Ga0182008_10131163
604 Ga0157379_10056534
605 Ga0163161_10134891
606 Ga0206353_11293323
607 Ga0213876_10152155
608 Ga0213875_10082587
609 Ga0207697_10111653
610 Ga0207642_10139310
611 Ga0207647_10007904
612 Ga0207647_10014047
613 Ga0207647_10030453
614 Ga0207707_10171442
615 Ga0207657_10003077
616 Ga0207657_10119897
617 Ga0207657_10268772
618 Ga0207649_10143489
619 Ga0207652_10033701
620 Ga0207659_10594108
621 Ga0207687_10009326
622 Ga0207664_10000969
623 Ga0207690_10093944
624 Ga0207690_10094108
625 Ga0207690_10224105
626 Ga0207709_10121820
627 Ga0207711_10453607
628 Ga0207661_10006174
629 Ga0207661_10110001
630 Ga0207679_10027725
631 Ga0207712_10055847
632 Ga0207668_10285313
633 Ga0207640_10199575
634 Ga0207658_10006018
635 Ga0207658_10234296
636 Ga0207658_10370060
637 Ga0207677_10065275
638 Ga0207703_10320031
639 Ga0207639_10660024
640 Ga0207678_10174269
641 Ga0207678_10301843
642 Ga0207708_10142651
643 Ga0207708_10398248
644 Ga0207702_10087664
645 Ga0207641_10169257
646 Ga0207648_10032952
647 Ga0207676_10103678
648 Ga0207674_10007124
649 Ga0207674_10466022
650 Ga0207675_100005486
651 Ga0207675_100080277
652 Ga0207683_10262585
653 Ga0207683_10795699
654 Ga0207698_10060851
655 Ga0207698_10205666
656 Ga0209813_10026972
657 Ga0207428_10058682
658 Ga0268266_10003007
659 Ga0268266_10122146
660 Ga0268264_10000193
661 Ga0268264_10000402
662 Ga0307405_10057874
663 Ga0307405_10290830
664 Ga0307410_10342805
665 Ga0307406_10103105
666 Ga0307406_10449304
667 Ga0307406_10635253
668 Ga0307412_10150730
669 Ga0307412_10161429
670 Ga0307409_100085091
671 Ga0307409_100244309
672 Ga0307416_100262089
673 Ga0307416_100327131
674 Ga0307414_10036845
675 Ga0307415_100028591
676 Ga0307415_100037783
677 Ga0307415_100101975
678 Ga0307415_100327110
679 Ga0373952_0067463
680 Ga0373931_0403498
681 Ga0373925_0249169
682 Ga0395900_0032515
683 Ga0395900_0285838
684 Ga0395898_0235985
685 Ga0395905_0122977
686 Ga0395905_0214376
687 Ga0436364_0793971
688 Ga0395901_0048465
689 Ga0395901_0067507
690 Ga0395901_0121795
691 Ga0395901_0841165
692 Ga0242420_018515
693 Ga0436365_0032095
694 Ga0439436_0070037
695 Ga0439447_040057
696 Ga0451802_1233361
697 Ga0439431_0013333
698 Ga0439442_001518
699 Ga0450907_006419
700 Ga0439434_0004119
701 Ga0466972_0010054
702 Ga0466972_0048359
703 Ga0466965_0001240
704 Ga0466965_0058824
705 Ga0466965_0234135
706 Ga0466966_0325864
707 Ga0466961_0033586
708 Ga0466961_0082174
709 Ga0466961_0129711
710 Ga0466961_0144265
711 Ga0466963_0003112
712 Ga0466963_0024196
713 Ga0466963_0033034
714 Ga0466963_0040956
715 Ga0466963_0068673
716 Ga0466963_0125800
717 Ga0466963_0148359
718 Ga0466963_0160119
719 Ga0466963_0255195
720 Ga0466963_0377024
721 Ga0466964_0012210
722 Ga0466964_0028201
723 Ga0466964_0066214
724 Ga0466971_0010806
725 Ga0466971_0117519
726 Ga0466968_0063071
727 Ga0466970_0001397
728 Ga0466970_0023979
729 Ga0466970_0170069
730 Ga0466957_0008608
731 Ga0466957_0017144
732 Ga0466957_0045897
733 Ga0466957_0065270
734 Ga0466957_0087982
735 Ga0466960_0000705
736 Ga0466960_0000887
737 Ga0466960_0003988
738 Ga0466960_0015596
739 Ga0466960_0041033
740 Ga0466958_0014380
741 Ga0466967_0002740
742 Ga0466967_0016578
743 Ga0466967_0022381
744 Ga0466967_0061996
745 Ga0466967_0070786
746 Ga0466967_0104131
747 Ga0466967_0255039
748 Ga0466967_0302477
749 Ga0466967_0336759
750 Ga0466967_0767579
751 Ga0495603_0017099
752 Ga0495653_0369331
753 Ga0495582_0068263
754 Ga0495587_0294167
755 Ga0495635_0255828
756 Ga0496100_0117409
757 Ga0496100_0233784
758 Ga0496101_0045714
759 Ga0496101_0099971
760 Ga0496101_0427212
761 Ga0496101_0467599
762 Ga0496102_0018512
763 Ga0496102_0021297
764 Ga0496102_0025917
765 Ga0496102_0235042
766 Ga0496103_0039000
767 Ga0496103_0072499
768 Ga0496103_0084146
769 Ga0496103_0248463
770 Ga0496104_0007462
771 Ga0496104_0028500
772 Ga0496104_0110441
773 Ga0496104_0299470
774 Ga0496105_0005589
775 Ga0496105_0146446
776 Ga0496105_0205231
777 Ga0496106_0050387
778 Ga0496107_0023461
779 Ga0496107_0051756
780 Ga0496107_0052771
781 Ga0496108_0073061
782 Ga0496108_0098582
783 Ga0496108_0115418
784 Ga0496108_0163941
785 Ga0496108_0199096
786 Ga0496109_0012316
787 Ga0496109_0092092
788 Ga0496109_0093020
789 Ga0496109_0122572
790 Ga0496109_0136155
791 Ga0496109_0202916
792 Ga0496109_0209727
793 Ga0496109_0274691
794 Ga0496109_0292385
795 Ga0496110_0049011
796 Ga0496110_0062367
797 Ga0496110_0574682
798 Ga0496111_0014764
799 Ga0496111_0482909
800 Ga0496111_0678713
801 Ga0496112_0031994
802 Ga0496113_0171337
803 Ga0496113_0204733
804 Ga0496114_0003493
805 Ga0496114_0007859
806 Ga0496114_0011638
807 Ga0496114_0014367
808 Ga0496114_0057894
809 Ga0496114_0191229
810 Ga0496114_0238140
811 Ga0496115_0037503
812 Ga0496115_0057823
813 Ga0496115_0294380
814 Ga0501299_024978
815 Ga0501031_0001511
816 Ga0501031_0077221
817 Ga0501031_0165368
818 Ga0501032_0005290
819 Ga0501032_0313012
820 Ga0501033_0092183
821 Ga0501034_0001740
822 Ga0501034_0051391
823 Ga0501034_0792139
824 Ga0501036_0001023
825 Ga0501036_0002895
826 Ga0501037_0015382
827 Ga0501037_0131644
828 Ga0501038_0002730
829 Ga0501038_0002983
830 Ga0501038_0286386
831 Ga0501039_0015161
832 Ga0501039_0125336
833 Ga0501040_0032161
834 Ga0501041_0147549
835 Ga0501041_0250569
836 Ga0501042_0019249
837 Ga0501043_0019192
838 Ga0501043_0040112
839 Ga0501046_0001247
840 Ga0501046_0426970
841 Ga0501047_0023602
842 Ga0501047_0103490
843 Ga0501048_0002020
844 Ga0501048_0287010
845 Ga0501048_0356480
846 Ga0501067_0000740
847 Ga0501067_0008185
848 Ga0501067_0011471
849 Ga0501067_0121355
850 Ga0501068_0009476
851 Ga0501068_0019641
852 Ga0501068_0112889
853 Ga0501068_0180585
854 Ga0501069_0015248
855 Ga0501069_0019035
856 Ga0501069_0181981
857 Ga0501070_0002540
858 Ga0501070_0019715
859 Ga0501070_0020285
860 Ga0501070_0503532
861 Ga0501071_0202148
862 Ga0501071_0258704
863 Ga0501072_0029676
864 Ga0501073_0003948
865 Ga0501073_0137661
866 Ga0501073_0301594
867 Ga0501074_0019325
868 Ga0501074_0028274
869 Ga0501074_0051477
870 Ga0501074_0387515
871 Ga0501075_0074488
872 Ga0501076_0292251
873 Ga0501077_0178758
874 Ga0501077_0279422
875 Ga0501079_0009378
876 Ga0501079_0043159
877 Ga0501079_0153830
878 Ga0501079_0348480
879 Ga0501080_0008035
880 Ga0501080_0181813
881 Ga0501080_0326683
882 Ga0501080_0556637
883 Ga0501081_0265544
884 Ga0501083_0003831
885 Ga0501083_0059378
886 Ga0501083_0090512
887 Ga0501035_0003346
888 Ga0501035_0013604
889 Ga0501035_0300008
890 Ga0501044_0002750
891 Ga0501044_0050158
892 Ga0501045_0068174
893 Ga0501045_0336829
894 Ga0501045_0357780
895 nmdc:mga03683_130844_c1
896 nmdc:mga03n38_1285_c1
897 nmdc:mga00v17_129019_c1
898 nmdc:mga00v17_273495_c1
899 nmdc:mga00v17_4072_c1
900 nmdc:mga00v17_4456_c1
901 nmdc:mga00v17_57952_c1
902 nmdc:mga00v17_60005_c1
903 nmdc:mga00v17_8926_c1
904 nmdc:mga0yw44_1093_c1
905 nmdc:mga0yw44_116442_c1
906 nmdc:mga0yw44_126917_c1
907 nmdc:mga0yw44_145673_c1
908 nmdc:mga0yw44_173177_c1
909 nmdc:mga0yw44_241414_c1
910 nmdc:mga0yw44_30521_c1
911 nmdc:mga0yw44_320119_c1
912 nmdc:mga0yw44_345137_c1
913 nmdc:mga0yw44_39663_c1
914 nmdc:mga0yw44_805_c1
915 nmdc:mga0yw44_9413_c1
916 nmdc:mga06z11_18965_c1
917 nmdc:mga06z11_2055_c1
918 nmdc:mga06z11_83537_c1
919 nmdc:mga04h51_14970_c1
920 nmdc:mga04h51_45846_c1
921 nmdc:mga07m45_136796_c1
922 nmdc:mga07m45_2536_c1
923 nmdc:mga07m45_262502_c1
924 nmdc:mga07m45_4785_c1
925 nmdc:mga08y16_12621_c1
926 Ga0495655_0005070
927 Ga0500644_0000177
928 Ga0500556_0001134
929 Ga0500593_000970
930 Ga0500655_035223
931 Ga0500573_0017758
932 Ga0500573_0131801
933 Ga0500573_0194538
934 Ga0501084_0160934
935 Ga0501084_0166160
936 Ga0587069_005872
937 Ga0501082_0004395
938 Ga0501082_0122027
939 Ga0501082_0422028
940 Ga0466962_0004315
941 Ga0466962_0023023
942 Ga0466962_0114933
943 Ga0530510_0252045
944 Ga0530510_0281014
945 2643824064
946 2643892551
947 2643961603
948 2644032471
949 2644091858
950 2644102640
951 2644118302
952 2644321661
953 2644533371
954 2738870654
955 2809198208
956 2809226776
957 2812334060
958 2812353121
959 2855389169
960 2891969251
961 3003004426
962 8054614372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

42

176

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dd0-assembly1.cif.gz_C crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.9166 1 242
7dd0-assembly2.cif.gz_D crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.903 1 242
7dd0-assembly1.cif.gz_A crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.9005 1 242
7k2t-assembly1.cif.gz_C mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8934 5 243
8dne-assembly1.cif.gz_C cryoem structure of the a.aeolicus wzmwzt transporter bound to atp 0.8928 5 243
ID Description Score Start End Superfamily
af_P72047_42_272_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9003 41 247 3.40.50.300
af_Q2G2L1_4_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8946 4 244 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8807 1 237 3.40.50.300
af_A0A1D6DXP2_296_452_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8683 88 204 3.40.50.300
af_Q2G2H3_25_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8666 41 243 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6N7ZGK5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9496 1 243 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A7K3WTS4-F1-model_v4 ABC transporter ATP-binding protein 0.9413 1 245 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A2N3APM6-F1-model_v4 ABC transporter ATP-binding protein 0.9367 41 244 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A6N7ZGK5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9342 1 243 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A1B6AK36-F1-model_v4 Putative polysaccharide ABC transporter ATP-binding protein 0.9334 41 219 GO:0005524
GO:0016020
GO:0016887
GO:0140359

Map