F452501

General Info

Members Datasets Scaffolds Average Seq Length
481 271 962 123

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0003477|Ga0501031_0003477_4765_5196
Length 143
Sequence MLASLDHVQLAAPPGSEDLLRAYYAGVLGMTEVPKPPVLAARGGCWFAAGAVRLHLGVAEDFHPARKAHPGLRVTGIEAYAARLAARGARVTWDDTLPGHRRFYSEDPVGNRLEFLEPTTTGPAPLTANGTKASVHTTAHNQP

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
56 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
57 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
74 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
75 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
76 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
77 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
78 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
81 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
82 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
83 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
84 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
162 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
209 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
210 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
211 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
214 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
215 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
216 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
217 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
218 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
221 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
222 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
223 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
226 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
227 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
228 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
229 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
234 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
235 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
236 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
237 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
238 2643221578 Streptomyces sp. Root63 Isolate Unclassified
239 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
240 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
241 2643221714 Streptomyces sp. Root264 Isolate Unclassified
242 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
243 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
244 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
245 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
246 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
247 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
248 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
249 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
250 2862574272 Streptomyces sp. AcE210 Isolate Nodule
251 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
252 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
253 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
254 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
255 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
256 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
257 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
258 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
259 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
260 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
261 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
262 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
263 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
264 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
265 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
266 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
267 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
268 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
269 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
270 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
271 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.85
Metatranscriptomes 1.04
Isolates 8.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.24
Nodule 0.42
Rhizoplane 1.46
Rhizosphere 78.59
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0003477 3300049568 Bacteria 10109
2 JGI24739J22299_10057895 3300001989 Bacteria 1232
3 JGI24737J22298_10033604 3300001990 Bacteria 1593
4 JGI24735J21928_10050975 3300002067 Bacteria 1195
5 rootL2_10003625 3300003322 Bacteria 1485
6 rootH1_10268078 3300003323 Bacteria 1535
7 Ga0006562J51391_1016268 3300003578 Bacteria 12520
8 Ga0006562J51391_1016273 3300003578 Bacteria 7870
9 Ga0006562J51391_1133996 3300003578 Bacteria 1736
10 Ga0006562J51391_1133998 3300003578 Bacteria 2550
11 Ga0065707_10324136 3300005295 Bacteria 961
12 Ga0070689_100329296 3300005340 Bacteria 1277
13 Ga0070688_100950284 3300005365 Bacteria 680
14 Ga0070685_10037057 3300005466 Bacteria 2760
15 Ga0070672_100249403 3300005543 Bacteria 1495
16 Ga0070686_100764945 3300005544 Bacteria 776
17 Ga0070665_100135018 3300005548 Bacteria 2469
18 Ga0070665_101013583 3300005548 Bacteria 842
19 Ga0070665_101604352 3300005548 Bacteria 658
20 Ga0070704_100692571 3300005549 Bacteria 903
21 Ga0068855_100924370 3300005563 Bacteria 920
22 Ga0068857_100125353 3300005577 Bacteria 2314
23 Ga0068854_100443314 3300005578 Bacteria 1083
24 Ga0068852_102022830 3300005616 Bacteria 598
25 Ga0068859_100903330 3300005617 Unclassified 968
26 Ga0068859_101835546 3300005617 Unclassified 669
27 Ga0068858_101480556 3300005842 Bacteria 669
28 Ga0075365_10290522 3300006038 Bacteria 1150
29 Ga0075368_10011612 3300006042 Bacteria 3207
30 Ga0075434_100491127 3300006871 Bacteria 1248
31 Ga0068865_101063510 3300006881 Bacteria 711
32 Ga0075436_101402649 3300006914 Bacteria 530
33 Ga0097620_100903420 3300006931 Unclassified 968
34 Ga0097620_101835680 3300006931 Unclassified 669
35 Ga0099826_10038431 3300006948 Bacteria 3362
36 Ga0105251_10020046 3300009011 Bacteria 3519
37 Ga0111539_10157431 3300009094 Bacteria 2658
38 Ga0111539_10197891 3300009094 Unclassified 2344
39 Ga0105245_10106431 3300009098 Bacteria 2602
40 Ga0105245_11068276 3300009098 Bacteria 853
41 Ga0105247_10501194 3300009101 Bacteria 885
42 Ga0105243_10353152 3300009148 Bacteria 1351
43 Ga0105243_10669340 3300009148 Bacteria 1008
44 Ga0105248_10233589 3300009177 Bacteria 2070
45 Ga0105246_10001087 3300011119 Bacteria 15722
46 Ga0105246_10172620 3300011119 Bacteria 1657
47 Ga0105246_11570110 3300011119 Bacteria 621
48 Ga0157372_10424449 3300013307 Bacteria 1550
49 Ga0182008_10000608 3300014497 Bacteria 26318
50 Ga0157377_10908824 3300014745 Bacteria 659
51 Ga0182007_10183042 3300015262 Bacteria 725
52 Ga0209758_1006156 3300025297 Bacteria 8789
53 Ga0207710_10246577 3300025900 Bacteria 892
54 Ga0207647_10005250 3300025904 Bacteria 9535
55 Ga0207662_10039782 3300025918 Bacteria 2760
56 Ga0207687_11022743 3300025927 Bacteria 709
57 Ga0207709_10283246 3300025935 Bacteria 1225
58 Ga0207670_10895149 3300025936 Bacteria 743
59 Ga0207691_10248280 3300025940 Bacteria 1537
60 Ga0207667_10457901 3300025949 Bacteria 1296
61 Ga0207703_10510052 3300026035 Bacteria 1130
62 Ga0207639_10140282 3300026041 Bacteria 2013
63 Ga0207641_11808482 3300026088 Unclassified 613
64 Ga0268266_10052078 3300028379 Bacteria 3515
65 Ga0268266_10480545 3300028379 Bacteria 1184
66 Ga0268266_10936551 3300028379 Bacteria 838
67 Ga0307517_10003673 3300028786 Bacteria 23852
68 Ga0307517_10369077 3300028786 Bacteria 772
69 Ga0307515_10000054 3300028794 Bacteria 265489
70 Ga0307515_10270817 3300028794 Bacteria 1420
71 Ga0307515_10331197 3300028794 Bacteria 1181
72 Ga0307511_10000467 3300030521 Bacteria 43772
73 Ga0307511_10084657 3300030521 Bacteria 2199
74 Ga0307511_10153401 3300030521 Bacteria 1315
75 Ga0307511_10181662 3300030521 Bacteria 1132
76 Ga0307512_10003385 3300030522 Bacteria 18659
77 Ga0316180_1043228 3300030736 Bacteria 618
78 Ga0307513_10110284 3300031456 Bacteria 2747
79 Ga0307513_10343164 3300031456 Bacteria 1243
80 Ga0307509_10019115 3300031507 Bacteria 7832
81 Ga0307509_10102868 3300031507 Bacteria 2886
82 Ga0307509_10172969 3300031507 Bacteria 2036
83 Ga0307509_10303188 3300031507 Bacteria 1344
84 Ga0307508_10040204 3300031616 Bacteria 4199
85 Ga0307508_10043709 3300031616 Bacteria 4012
86 Ga0307508_10141396 3300031616 Bacteria 2011
87 Ga0307508_10550520 3300031616 Bacteria 752
88 Ga0307514_10070626 3300031649 Bacteria 2621
89 Ga0307514_10145638 3300031649 Bacteria 1601
90 Ga0307514_10176361 3300031649 Bacteria 1385
91 Ga0307516_10006133 3300031730 Bacteria 14171
92 Ga0307516_10022400 3300031730 Bacteria 6488
93 Ga0307516_10051032 3300031730 Bacteria 4056
94 Ga0307405_11354380 3300031731 Bacteria 621
95 Ga0307518_10057983 3300031838 Bacteria 2813
96 Ga0307518_10079704 3300031838 Bacteria 2365
97 Ga0307518_10090246 3300031838 Bacteria 2205
98 Ga0307518_10219831 3300031838 Bacteria 1241
99 Ga0307518_10453932 3300031838 Bacteria 684
100 Ga0307416_101542061 3300032002 Bacteria 770
101 Ga0307507_10141291 3300033179 Bacteria 1845
102 Ga0307507_10148190 3300033179 Bacteria 1775
103 Ga0307510_10009333 3300033180 Bacteria 11688
104 Ga0307510_10021482 3300033180 Bacteria 7521
105 Ga0307510_10091511 3300033180 Bacteria 2883
106 Ga0307510_10552241 3300033180 Bacteria 598
107 Ga0373939_0090735 3300035114 Bacteria 1032
108 Ga0395900_0587729 3300037418 Bacteria 1055
109 Ga0395898_0004515 3300037466 Bacteria 15209
110 Ga0395898_0031261 3300037466 Bacteria 5321
111 Ga0395898_1016532 3300037466 Bacteria 764
112 Ga0395901_0125860 3300038443 Bacteria 2693
113 Ga0395901_0231067 3300038443 Bacteria 1931
114 Ga0395901_1089779 3300038443 Bacteria 770
115 Ga0436365_1475293 3300039437 Unclassified 550
116 Ga0451789_0866280 3300041443 Bacteria 798
117 Ga0451807_0024945 3300041486 Bacteria 501
118 Ga0451833_1040416 3300041491 Bacteria 528
119 Ga0451837_1813928 3300041494 Bacteria 500
120 Ga0451849_0063123 3300041505 Bacteria 602
121 Ga0451843_0202884 3300041509 Bacteria 557
122 Ga0451853_1573216 3300041512 Bacteria 917
123 Ga0439448_0211050 3300042005 Bacteria 682
124 Ga0439432_024789 3300042006 Bacteria 1971
125 Ga0439449_0047637 3300042007 Bacteria 1587
126 Ga0439449_0072565 3300042007 Bacteria 1268
127 Ga0450903_000345 3300042138 Bacteria 10222
128 Ga0450903_046034 3300042138 Bacteria 642
129 Ga0439458_0003191 3300042157 Bacteria 3885
130 Ga0439458_0073569 3300042157 Bacteria 865
131 Ga0466972_0000961 3300044658 Bacteria 13842
132 Ga0466972_0019633 3300044658 Bacteria 3379
133 Ga0466972_0024107 3300044658 Bacteria 3020
134 Ga0466972_0026471 3300044658 Bacteria 2875
135 Ga0453683_0275081 3300044673 Bacteria 1075
136 Ga0466965_0000189 3300044683 Bacteria 19146
137 Ga0466965_0174567 3300044683 Bacteria 1132
138 Ga0466965_0267469 3300044683 Bacteria 920
139 Ga0466966_0006497 3300044684 Bacteria 7736
140 Ga0466966_0477434 3300044684 Bacteria 750
141 Ga0466961_0000701 3300044693 Bacteria 21109
142 Ga0466961_0003834 3300044693 Bacteria 9407
143 Ga0466961_0005317 3300044693 Bacteria 8101
144 Ga0466961_0174986 3300044693 Bacteria 1334
145 Ga0466963_0000593 3300044694 Bacteria 17261
146 Ga0466963_0035103 3300044694 Bacteria 3265
147 Ga0466964_0008496 3300044706 Bacteria 3860
148 Ga0466964_0161107 3300044706 Bacteria 1049
149 Ga0466971_0001210 3300044719 Bacteria 10730
150 Ga0466971_0034436 3300044719 Bacteria 2269
151 Ga0466971_0042906 3300044719 Bacteria 2033
152 Ga0466968_0149643 3300044735 Bacteria 1072
153 Ga0466970_0004354 3300044765 Bacteria 6973
154 Ga0466970_0042670 3300044765 Bacteria 2412
155 Ga0466970_0216707 3300044765 Bacteria 1068
156 Ga0466957_0000672 3300044842 Bacteria 17423
157 Ga0466957_0483388 3300044842 Bacteria 857
158 Ga0466960_0028276 3300044901 Bacteria 2565
159 Ga0466960_0726445 3300044901 Bacteria 597
160 Ga0466959_0002649 3300045049 Bacteria 11490
161 Ga0466959_0003547 3300045049 Bacteria 10254
162 Ga0466959_0035116 3300045049 Bacteria 3709
163 Ga0466959_0241678 3300045049 Bacteria 1247
164 Ga0466959_0801359 3300045049 Bacteria 630
165 Ga0466958_0000356 3300045836 Bacteria 18444
166 Ga0466967_0002784 3300045976 Bacteria 11083
167 Ga0466967_0023000 3300045976 Bacteria 5099
168 Ga0466967_0039500 3300045976 Bacteria 4058
169 Ga0466967_0178988 3300045976 Bacteria 1999
170 Ga0495627_024329 3300046453 Bacteria 1975
171 Ga0495592_0046671 3300046454 Bacteria 3228
172 Ga0495592_0099778 3300046454 Bacteria 2070
173 Ga0495603_0021567 3300046455 Bacteria 3901
174 Ga0495603_0047585 3300046455 Bacteria 2553
175 Ga0495603_0073443 3300046455 Bacteria 2009
176 Ga0495603_0105736 3300046455 Bacteria 1642
177 Ga0495629_0009306 3300046459 Bacteria 7190
178 Ga0495629_0011327 3300046459 Bacteria 6478
179 Ga0495629_0020294 3300046459 Bacteria 4744
180 Ga0495629_0032836 3300046459 Bacteria 3673
181 Ga0495629_0073809 3300046459 Bacteria 2382
182 Ga0495629_0192236 3300046459 Bacteria 1412
183 Ga0495629_0287065 3300046459 Bacteria 1128
184 Ga0495641_0122231 3300046461 Bacteria 1162
185 Ga0495651_0002115 3300046462 Bacteria 15334
186 Ga0495651_0018425 3300046462 Bacteria 5408
187 Ga0495651_0535502 3300046462 Bacteria 746
188 Ga0495653_0003771 3300046463 Bacteria 12260
189 Ga0495580_0011767 3300046472 Bacteria 6755
190 Ga0495582_0054523 3300046473 Bacteria 2204
191 Ga0495639_0501528 3300046475 Bacteria 620
192 Ga0495662_0001917 3300046476 Bacteria 10440
193 Ga0495662_0010745 3300046476 Bacteria 4476
194 Ga0495662_0016682 3300046476 Bacteria 3558
195 Ga0495662_0037818 3300046476 Bacteria 2331
196 Ga0495662_0098411 3300046476 Bacteria 1430
197 Ga0495662_0511930 3300046476 Bacteria 588
198 Ga0495664_0004009 3300046477 Bacteria 8038
199 Ga0495664_0004144 3300046477 Bacteria 7913
200 Ga0495664_0420327 3300046477 Bacteria 802
201 Ga0495664_0643400 3300046477 Bacteria 629
202 Ga0495585_0012380 3300046492 Bacteria 5028
203 Ga0495594_0036673 3300046499 Bacteria 2674
204 Ga0495594_0086457 3300046499 Bacteria 1754
205 Ga0495594_0248091 3300046499 Bacteria 1014
206 Ga0495594_0338748 3300046499 Bacteria 856
207 Ga0495607_0068865 3300046501 Bacteria 1983
208 Ga0495583_0053445 3300046506 Bacteria 1833
209 Ga0495608_0003002 3300046511 Bacteria 12057
210 Ga0495618_0092556 3300046514 Bacteria 1933
211 Ga0495628_0081902 3300046516 Bacteria 2506
212 Ga0495628_0122121 3300046516 Bacteria 1997
213 Ga0495628_0126665 3300046516 Bacteria 1956
214 Ga0495630_0348996 3300046517 Bacteria 1132
215 Ga0495630_1321010 3300046517 Bacteria 543
216 Ga0495643_0004924 3300046522 Bacteria 9173
217 Ga0495643_0079435 3300046522 Bacteria 1710
218 Ga0495648_0318468 3300046524 Bacteria 722
219 Ga0495666_0002795 3300046526 Bacteria 8727
220 Ga0495666_0083015 3300046526 Bacteria 1515
221 Ga0495652_0008027 3300046529 Bacteria 9677
222 Ga0495652_0008044 3300046529 Bacteria 9661
223 Ga0495640_0001993 3300046533 Bacteria 16280
224 Ga0495640_0003894 3300046533 Bacteria 11942
225 Ga0495640_0012096 3300046533 Bacteria 6610
226 Ga0495640_0150581 3300046533 Bacteria 1495
227 Ga0495586_0039722 3300046535 Bacteria 2530
228 Ga0495587_0001112 3300046536 Bacteria 17620
229 Ga0495587_0012112 3300046536 Bacteria 5444
230 Ga0495587_0024622 3300046536 Bacteria 3687
231 Ga0495609_0456354 3300046538 Bacteria 507
232 Ga0495597_0162881 3300046542 Bacteria 909
233 Ga0495645_0085624 3300046543 Bacteria 2256
234 Ga0495645_0091428 3300046543 Bacteria 2173
235 Ga0495645_0093456 3300046543 Bacteria 2146
236 Ga0495645_0153689 3300046543 Bacteria 1596
237 Ga0495622_0122644 3300046557 Bacteria 1186
238 Ga0495622_0231100 3300046557 Bacteria 817
239 Ga0495633_0044412 3300046558 Bacteria 2106
240 Ga0495667_0053932 3300046559 Bacteria 2646
241 Ga0495667_0520966 3300046559 Bacteria 744
242 Ga0495656_0731439 3300046615 Bacteria 533
243 Ga0495634_0002311 3300046642 Bacteria 15949
244 Ga0495634_0063415 3300046642 Bacteria 2452
245 Ga0495611_0026429 3300046648 Bacteria 2533
246 Ga0495611_0222489 3300046648 Bacteria 878
247 Ga0495625_0067406 3300046660 Bacteria 2518
248 Ga0495625_0278961 3300046660 Bacteria 1076
249 Ga0495635_0021032 3300046663 Bacteria 4547
250 Ga0495635_0034459 3300046663 Bacteria 3511
251 Ga0495635_0081004 3300046663 Bacteria 2221
252 Ga0495661_0244842 3300046665 Bacteria 918
253 Ga0495588_0002204 3300046674 Bacteria 8340
254 Ga0495588_0027163 3300046674 Bacteria 2860
255 Ga0495588_0148369 3300046674 Bacteria 1239
256 Ga0495657_0001809 3300046675 Bacteria 18279
257 Ga0495657_0004704 3300046675 Bacteria 10874
258 Ga0495657_0011842 3300046675 Bacteria 6501
259 Ga0495657_0133716 3300046675 Bacteria 1551
260 Ga0495599_0059586 3300046678 Bacteria 2388
261 Ga0495599_0117350 3300046678 Bacteria 1655
262 Ga0495646_0004109 3300046680 Bacteria 9132
263 Ga0495646_0004926 3300046680 Bacteria 8431
264 Ga0495658_0136618 3300046683 Bacteria 1496
265 Ga0495613_0000988 3300046689 Bacteria 21626
266 Ga0495613_0012754 3300046689 Bacteria 6248
267 Ga0495613_0019380 3300046689 Bacteria 5070
268 Ga0495613_0123589 3300046689 Bacteria 1857
269 Ga0495613_0144145 3300046689 Bacteria 1700
270 Ga0495624_0064774 3300046690 Bacteria 2284
271 Ga0495624_0087059 3300046690 Bacteria 1929
272 Ga0495624_0881822 3300046690 Bacteria 527
273 Ga0495670_0006348 3300046691 Bacteria 5807
274 Ga0495670_0423769 3300046691 Bacteria 720
275 Ga0495671_0003809 3300046692 Bacteria 9170
276 Ga0495649_0025145 3300046694 Bacteria 3317
277 Ga0495649_0142840 3300046694 Bacteria 1259
278 Ga0495649_0197173 3300046694 Bacteria 1046
279 Ga0495649_0551034 3300046694 Bacteria 571
280 Ga0495589_0010969 3300046794 Bacteria 4704
281 Ga0495589_0014689 3300046794 Bacteria 4029
282 Ga0495589_0035546 3300046794 Bacteria 2498
283 Ga0495589_0082882 3300046794 Bacteria 1559
284 Ga0495600_0017021 3300046809 Bacteria 4620
285 Ga0495600_0062485 3300046809 Bacteria 2433
286 Ga0495660_0003248 3300046810 Bacteria 10107
287 Ga0495660_0181508 3300046810 Bacteria 1018
288 Ga0495581_0024122 3300047315 Bacteria 3524
289 Ga0495581_0057690 3300047315 Bacteria 2241
290 Ga0495581_0244889 3300047315 Bacteria 1048
291 Ga0495604_0000674 3300047317 Bacteria 28915
292 Ga0495604_0001761 3300047317 Bacteria 17716
293 Ga0495604_0007554 3300047317 Bacteria 8599
294 Ga0495604_0181703 3300047317 Bacteria 1471
295 Ga0495636_0000831 3300047318 Bacteria 11393
296 Ga0495636_0003966 3300047318 Bacteria 5781
297 Ga0495636_0013429 3300047318 Bacteria 3251
298 Ga0495636_0050940 3300047318 Bacteria 1734
299 Ga0495674_0755198 3300047319 Bacteria 759
300 Ga0495676_0003583 3300047321 Bacteria 14090
301 Ga0495676_0014148 3300047321 Bacteria 7144
302 Ga0495676_0023048 3300047321 Bacteria 5409
303 Ga0495676_0232640 3300047321 Bacteria 1265
304 Ga0495680_0064342 3300047322 Bacteria 2813
305 Ga0495687_001773 3300047443 Bacteria 19035
306 Ga0495687_012218 3300047443 Bacteria 4554
307 Ga0495687_018774 3300047443 Bacteria 3409
308 Ga0495687_111960 3300047443 Bacteria 1001
309 Ga0495675_0004739 3300047444 Bacteria 8259
310 Ga0495675_0020821 3300047444 Bacteria 4174
311 Ga0495675_0023516 3300047444 Bacteria 3926
312 Ga0495675_0030569 3300047444 Bacteria 3436
313 Ga0495675_0084095 3300047444 Bacteria 2003
314 Ga0495679_027366 3300047446 Bacteria 1882
315 Ga0495685_000960 3300047447 Bacteria 8712
316 Ga0495685_001033 3300047447 Bacteria 8474
317 Ga0495685_003653 3300047447 Bacteria 4917
318 Ga0495685_017086 3300047447 Bacteria 2482
319 Ga0495681_0003658 3300047470 Bacteria 10681
320 Ga0495681_0006819 3300047470 Bacteria 7425
321 Ga0495681_0077906 3300047470 Bacteria 1487
322 Ga0495681_0122056 3300047470 Bacteria 1117
323 Ga0495684_0006221 3300047471 Bacteria 9278
324 Ga0495684_0122629 3300047471 Bacteria 1956
325 Ga0495686_0025921 3300047472 Bacteria 3839
326 Ga0495686_0045365 3300047472 Bacteria 2781
327 Ga0495593_0000340 3300047673 Bacteria 25830
328 Ga0495593_0215218 3300047673 Bacteria 964
329 Ga0495593_0520172 3300047673 Bacteria 597
330 Ga0495602_0037321 3300048088 Bacteria 4512
331 Ga0495602_0040899 3300048088 Bacteria 4240
332 Ga0495614_0025680 3300048089 Bacteria 2540
333 Ga0495614_0047724 3300048089 Bacteria 1836
334 Ga0495614_0061391 3300048089 Bacteria 1615
335 Ga0495615_0110187 3300048090 Bacteria 787
336 Ga0495626_0110854 3300048091 Bacteria 1188
337 Ga0496104_1297919 3300048907 Bacteria 631
338 Ga0496108_0160717 3300048911 Bacteria 1941
339 Ga0496109_1132547 3300048912 Bacteria 719
340 Ga0496110_0225983 3300048913 Bacteria 1702
341 Ga0501323_028639 3300049539 Bacteria 772
342 Ga0501031_0004394 3300049568 Bacteria 9135
343 Ga0501031_0016895 3300049568 Bacteria 4740
344 Ga0501031_0483449 3300049568 Bacteria 799
345 Ga0501031_0914370 3300049568 Bacteria 561
346 Ga0501032_0000839 3300049569 Bacteria 24970
347 Ga0501032_0005320 3300049569 Bacteria 9575
348 Ga0501032_0241865 3300049569 Bacteria 1172
349 Ga0501033_0030930 3300049570 Bacteria 4023
350 Ga0501033_0035757 3300049570 Bacteria 3723
351 Ga0501033_0700346 3300049570 Bacteria 689
352 Ga0501034_0004538 3300049571 Bacteria 15431
353 Ga0501034_0023290 3300049571 Bacteria 6310
354 Ga0501034_0029264 3300049571 Bacteria 5600
355 Ga0501034_0110451 3300049571 Bacteria 2740
356 Ga0501034_0208957 3300049571 Bacteria 1908
357 Ga0501036_0030894 3300049572 Bacteria 4526
358 Ga0501036_0075178 3300049572 Bacteria 2857
359 Ga0501036_0081129 3300049572 Bacteria 2741
360 Ga0501037_0006646 3300049573 Bacteria 8458
361 Ga0501037_0032330 3300049573 Bacteria 3863
362 Ga0501037_0180788 3300049573 Bacteria 1496
363 Ga0501038_0023739 3300049574 Bacteria 5479
364 Ga0501038_0051940 3300049574 Bacteria 3535
365 Ga0501038_0071192 3300049574 Bacteria 2950
366 Ga0501038_0133325 3300049574 Bacteria 2037
367 Ga0501039_0033892 3300049575 Bacteria 3939
368 Ga0501039_0067832 3300049575 Bacteria 2770
369 Ga0501040_0003799 3300049576 Bacteria 9793
370 Ga0501041_0001628 3300049577 Bacteria 12539
371 Ga0501042_0044637 3300049578 Bacteria 3158
372 Ga0501042_0157087 3300049578 Bacteria 1640
373 Ga0501043_0002202 3300049579 Bacteria 16611
374 Ga0501046_0010520 3300049580 Bacteria 7936
375 Ga0501046_0020733 3300049580 Bacteria 5431
376 Ga0501047_0000048 3300049581 Bacteria 167850
377 Ga0501047_0002881 3300049581 Bacteria 16314
378 Ga0501047_0017507 3300049581 Bacteria 6864
379 Ga0501047_0026218 3300049581 Bacteria 5606
380 Ga0501047_0861977 3300049581 Bacteria 719
381 Ga0501048_0010393 3300049582 Bacteria 6950
382 Ga0501048_0014390 3300049582 Bacteria 5859
383 Ga0501048_0318496 3300049582 Bacteria 1108
384 Ga0501067_0000870 3300049583 Bacteria 16214
385 Ga0501068_0000677 3300049584 Bacteria 17420
386 Ga0501069_0021798 3300049585 Bacteria 3479
387 Ga0501070_0030281 3300049586 Bacteria 4534
388 Ga0501071_0000823 3300049587 Bacteria 16556
389 Ga0501072_0007750 3300049588 Bacteria 8153
390 Ga0501073_0134492 3300049589 Bacteria 1713
391 Ga0501074_0016027 3300049590 Bacteria 5446
392 Ga0501076_0054986 3300049592 Bacteria 3156
393 Ga0501079_0048681 3300049741 Bacteria 3270
394 Ga0501080_0128673 3300049742 Bacteria 2344
395 Ga0501083_0003941 3300049744 Bacteria 10430
396 Ga0501083_0850622 3300049744 Bacteria 594
397 Ga0501035_0001352 3300049822 Bacteria 25241
398 Ga0501035_0009584 3300049822 Bacteria 9005
399 Ga0501035_0023294 3300049822 Bacteria 5679
400 Ga0501035_0129483 3300049822 Bacteria 2201
401 Ga0501035_0559504 3300049822 Bacteria 936
402 Ga0501035_1402083 3300049822 Bacteria 535
403 Ga0501044_0001734 3300049823 Bacteria 25480
404 Ga0501044_0028618 3300049823 Bacteria 5881
405 Ga0501044_0153325 3300049823 Bacteria 2285
406 Ga0501044_0263830 3300049823 Bacteria 1660
407 Ga0501044_0443665 3300049823 Bacteria 1205
408 nmdc:mga0yw44_245466_c1 3300050492 Bacteria 1191
409 nmdc:mga08y16_992337_c1 3300050511 Bacteria 820
410 nmdc:mga08x19_754779_c1 3300050514 Bacteria 691
411 Ga0500610_0241339 3300053079 Bacteria 840
412 Ga0495655_0082174 3300053083 Bacteria 923
413 Ga0495655_0161387 3300053083 Bacteria 711
414 Ga0500578_0057239 3300053086 Bacteria 2492
415 Ga0500640_052250 3300053095 Bacteria 1785
416 Ga0500654_005221 3300053099 Bacteria 9189
417 Ga0500660_211370 3300053100 Bacteria 652
418 Ga0500556_0183468 3300053104 Bacteria 827
419 Ga0500560_001517 3300053107 Bacteria 4070
420 Ga0500560_219256 3300053107 Bacteria 607
421 Ga0500569_000425 3300053109 Bacteria 6895
422 Ga0500572_050197 3300053111 Bacteria 1241
423 Ga0500614_005599 3300053123 Bacteria 2635
424 Ga0500621_255843 3300053126 Bacteria 585
425 Ga0500628_000581 3300053129 Bacteria 6673
426 Ga0500658_0110288 3300053134 Bacteria 1210
427 Ga0500561_0000923 3300053137 Bacteria 4700
428 Ga0500573_0020538 3300053140 Bacteria 3784
429 Ga0500573_0303950 3300053140 Bacteria 796
430 Ga0500579_058892 3300053143 Bacteria 2295
431 Ga0500600_0026760 3300053149 Bacteria 3421
432 Ga0500600_0294039 3300053149 Bacteria 700
433 Ga0500616_0018136 3300053153 Bacteria 3982
434 Ga0500633_0001177 3300053160 Bacteria 4765
435 Ga0500634_0039599 3300053161 Bacteria 2561
436 Ga0500636_0089379 3300053177 Bacteria 1766
437 Ga0500656_000145 3300053732 Bacteria 4345
438 Ga0500587_000596 3300053739 Bacteria 4511
439 Ga0501084_0001951 3300054114 Bacteria 16471
440 Ga0501082_0015094 3300060353 Bacteria 6654
441 Ga0466962_0006410 3300061719 Bacteria 5650
442 Ga0530510_0013096 3300061734 Bacteria 5833
443 2554258086 2554235005 Bacteria 6457341
444 2585300152 2582581312 Bacteria 7308206
445 2585318794 2582581314 Bacteria 11452267
446 2616904024 2616644941 Bacteria 8510691
447 2643898569 2643221578 Bacteria 9213798
448 2644406486 2643221673 Bacteria 9196637
449 2644436948 2643221678 Bacteria 9540101
450 2644628678 2643221714 Bacteria 9015452
451 2804847250 2802429296 Bacteria 7227771
452 2808841842 2808606359 Bacteria 9866990
453 2808920387 2808606375 Bacteria 9466072
454 2812358409 2811994879 Bacteria 9313447
455 2852636904 2852635781 Bacteria 8251373
456 2862179588 2862178590 Bacteria 8583590
457 2862285451 2862281513 Bacteria 9621493
458 2862514593 2862507626 Bacteria 9425308
459 2862579424 2862574272 Bacteria 10567477
460 2863404937 2863404153 Bacteria 9672205
461 2875394345 2875391855 Bacteria 7600475
462 2919469714 2919468124 Bacteria 9133025
463 2935392599 2935390628 Bacteria 7043367
464 2946050259 2946045630 Bacteria 8527308
465 2946067470 2946064051 Bacteria 8957905
466 2946075722 2946072368 Bacteria 8999607
467 2947229533 2947224130 Bacteria 9938529
468 2990090369 2990088156 Bacteria 6657676
469 2995467487 2995463766 Bacteria 8577691
470 2995468380 2995463766 Bacteria 8577691
471 2997454570 2997451912 Bacteria 8492419
472 3006394556 3006393351 Bacteria 6615579
473 3006489335 3006486233 Bacteria 8157040
474 8025415941 8025413630 Bacteria 7014048
475 8025536647 8025530807 Bacteria 8495698
476 8033689092 8033684223 Bacteria 6906479
477 8047896648 8047893842 Bacteria 11723082
478 8048362287 8048356638 Bacteria 11044339
479 8048373661 8048369669 Bacteria 11666822
480 8048384581 8048379754 Bacteria 11877923
481 8056833703 8056829672 Bacteria 9045328
482 Ga0501031_0003477
483 JGI24739J22299_10057895
484 JGI24737J22298_10033604
485 JGI24735J21928_10050975
486 rootL2_10003625
487 rootH1_10268078
488 Ga0006562J51391_1016268
489 Ga0006562J51391_1016273
490 Ga0006562J51391_1133996
491 Ga0006562J51391_1133998
492 Ga0065707_10324136
493 Ga0070689_100329296
494 Ga0070688_100950284
495 Ga0070685_10037057
496 Ga0070672_100249403
497 Ga0070686_100764945
498 Ga0070665_100135018
499 Ga0070665_101013583
500 Ga0070665_101604352
501 Ga0070704_100692571
502 Ga0068855_100924370
503 Ga0068857_100125353
504 Ga0068854_100443314
505 Ga0068852_102022830
506 Ga0068859_100903330
507 Ga0068859_101835546
508 Ga0068858_101480556
509 Ga0075365_10290522
510 Ga0075368_10011612
511 Ga0075434_100491127
512 Ga0068865_101063510
513 Ga0075436_101402649
514 Ga0097620_100903420
515 Ga0097620_101835680
516 Ga0099826_10038431
517 Ga0105251_10020046
518 Ga0111539_10157431
519 Ga0111539_10197891
520 Ga0105245_10106431
521 Ga0105245_11068276
522 Ga0105247_10501194
523 Ga0105243_10353152
524 Ga0105243_10669340
525 Ga0105248_10233589
526 Ga0105246_10001087
527 Ga0105246_10172620
528 Ga0105246_11570110
529 Ga0157372_10424449
530 Ga0182008_10000608
531 Ga0157377_10908824
532 Ga0182007_10183042
533 Ga0209758_1006156
534 Ga0207710_10246577
535 Ga0207647_10005250
536 Ga0207662_10039782
537 Ga0207687_11022743
538 Ga0207709_10283246
539 Ga0207670_10895149
540 Ga0207691_10248280
541 Ga0207667_10457901
542 Ga0207703_10510052
543 Ga0207639_10140282
544 Ga0207641_11808482
545 Ga0268266_10052078
546 Ga0268266_10480545
547 Ga0268266_10936551
548 Ga0307517_10003673
549 Ga0307517_10369077
550 Ga0307515_10000054
551 Ga0307515_10270817
552 Ga0307515_10331197
553 Ga0307511_10000467
554 Ga0307511_10084657
555 Ga0307511_10153401
556 Ga0307511_10181662
557 Ga0307512_10003385
558 Ga0316180_1043228
559 Ga0307513_10110284
560 Ga0307513_10343164
561 Ga0307509_10019115
562 Ga0307509_10102868
563 Ga0307509_10172969
564 Ga0307509_10303188
565 Ga0307508_10040204
566 Ga0307508_10043709
567 Ga0307508_10141396
568 Ga0307508_10550520
569 Ga0307514_10070626
570 Ga0307514_10145638
571 Ga0307514_10176361
572 Ga0307516_10006133
573 Ga0307516_10022400
574 Ga0307516_10051032
575 Ga0307405_11354380
576 Ga0307518_10057983
577 Ga0307518_10079704
578 Ga0307518_10090246
579 Ga0307518_10219831
580 Ga0307518_10453932
581 Ga0307416_101542061
582 Ga0307507_10141291
583 Ga0307507_10148190
584 Ga0307510_10009333
585 Ga0307510_10021482
586 Ga0307510_10091511
587 Ga0307510_10552241
588 Ga0373939_0090735
589 Ga0395900_0587729
590 Ga0395898_0004515
591 Ga0395898_0031261
592 Ga0395898_1016532
593 Ga0395901_0125860
594 Ga0395901_0231067
595 Ga0395901_1089779
596 Ga0436365_1475293
597 Ga0451789_0866280
598 Ga0451807_0024945
599 Ga0451833_1040416
600 Ga0451837_1813928
601 Ga0451849_0063123
602 Ga0451843_0202884
603 Ga0451853_1573216
604 Ga0439448_0211050
605 Ga0439432_024789
606 Ga0439449_0047637
607 Ga0439449_0072565
608 Ga0450903_000345
609 Ga0450903_046034
610 Ga0439458_0003191
611 Ga0439458_0073569
612 Ga0466972_0000961
613 Ga0466972_0019633
614 Ga0466972_0024107
615 Ga0466972_0026471
616 Ga0453683_0275081
617 Ga0466965_0000189
618 Ga0466965_0174567
619 Ga0466965_0267469
620 Ga0466966_0006497
621 Ga0466966_0477434
622 Ga0466961_0000701
623 Ga0466961_0003834
624 Ga0466961_0005317
625 Ga0466961_0174986
626 Ga0466963_0000593
627 Ga0466963_0035103
628 Ga0466964_0008496
629 Ga0466964_0161107
630 Ga0466971_0001210
631 Ga0466971_0034436
632 Ga0466971_0042906
633 Ga0466968_0149643
634 Ga0466970_0004354
635 Ga0466970_0042670
636 Ga0466970_0216707
637 Ga0466957_0000672
638 Ga0466957_0483388
639 Ga0466960_0028276
640 Ga0466960_0726445
641 Ga0466959_0002649
642 Ga0466959_0003547
643 Ga0466959_0035116
644 Ga0466959_0241678
645 Ga0466959_0801359
646 Ga0466958_0000356
647 Ga0466967_0002784
648 Ga0466967_0023000
649 Ga0466967_0039500
650 Ga0466967_0178988
651 Ga0495627_024329
652 Ga0495592_0046671
653 Ga0495592_0099778
654 Ga0495603_0021567
655 Ga0495603_0047585
656 Ga0495603_0073443
657 Ga0495603_0105736
658 Ga0495629_0009306
659 Ga0495629_0011327
660 Ga0495629_0020294
661 Ga0495629_0032836
662 Ga0495629_0073809
663 Ga0495629_0192236
664 Ga0495629_0287065
665 Ga0495641_0122231
666 Ga0495651_0002115
667 Ga0495651_0018425
668 Ga0495651_0535502
669 Ga0495653_0003771
670 Ga0495580_0011767
671 Ga0495582_0054523
672 Ga0495639_0501528
673 Ga0495662_0001917
674 Ga0495662_0010745
675 Ga0495662_0016682
676 Ga0495662_0037818
677 Ga0495662_0098411
678 Ga0495662_0511930
679 Ga0495664_0004009
680 Ga0495664_0004144
681 Ga0495664_0420327
682 Ga0495664_0643400
683 Ga0495585_0012380
684 Ga0495594_0036673
685 Ga0495594_0086457
686 Ga0495594_0248091
687 Ga0495594_0338748
688 Ga0495607_0068865
689 Ga0495583_0053445
690 Ga0495608_0003002
691 Ga0495618_0092556
692 Ga0495628_0081902
693 Ga0495628_0122121
694 Ga0495628_0126665
695 Ga0495630_0348996
696 Ga0495630_1321010
697 Ga0495643_0004924
698 Ga0495643_0079435
699 Ga0495648_0318468
700 Ga0495666_0002795
701 Ga0495666_0083015
702 Ga0495652_0008027
703 Ga0495652_0008044
704 Ga0495640_0001993
705 Ga0495640_0003894
706 Ga0495640_0012096
707 Ga0495640_0150581
708 Ga0495586_0039722
709 Ga0495587_0001112
710 Ga0495587_0012112
711 Ga0495587_0024622
712 Ga0495609_0456354
713 Ga0495597_0162881
714 Ga0495645_0085624
715 Ga0495645_0091428
716 Ga0495645_0093456
717 Ga0495645_0153689
718 Ga0495622_0122644
719 Ga0495622_0231100
720 Ga0495633_0044412
721 Ga0495667_0053932
722 Ga0495667_0520966
723 Ga0495656_0731439
724 Ga0495634_0002311
725 Ga0495634_0063415
726 Ga0495611_0026429
727 Ga0495611_0222489
728 Ga0495625_0067406
729 Ga0495625_0278961
730 Ga0495635_0021032
731 Ga0495635_0034459
732 Ga0495635_0081004
733 Ga0495661_0244842
734 Ga0495588_0002204
735 Ga0495588_0027163
736 Ga0495588_0148369
737 Ga0495657_0001809
738 Ga0495657_0004704
739 Ga0495657_0011842
740 Ga0495657_0133716
741 Ga0495599_0059586
742 Ga0495599_0117350
743 Ga0495646_0004109
744 Ga0495646_0004926
745 Ga0495658_0136618
746 Ga0495613_0000988
747 Ga0495613_0012754
748 Ga0495613_0019380
749 Ga0495613_0123589
750 Ga0495613_0144145
751 Ga0495624_0064774
752 Ga0495624_0087059
753 Ga0495624_0881822
754 Ga0495670_0006348
755 Ga0495670_0423769
756 Ga0495671_0003809
757 Ga0495649_0025145
758 Ga0495649_0142840
759 Ga0495649_0197173
760 Ga0495649_0551034
761 Ga0495589_0010969
762 Ga0495589_0014689
763 Ga0495589_0035546
764 Ga0495589_0082882
765 Ga0495600_0017021
766 Ga0495600_0062485
767 Ga0495660_0003248
768 Ga0495660_0181508
769 Ga0495581_0024122
770 Ga0495581_0057690
771 Ga0495581_0244889
772 Ga0495604_0000674
773 Ga0495604_0001761
774 Ga0495604_0007554
775 Ga0495604_0181703
776 Ga0495636_0000831
777 Ga0495636_0003966
778 Ga0495636_0013429
779 Ga0495636_0050940
780 Ga0495674_0755198
781 Ga0495676_0003583
782 Ga0495676_0014148
783 Ga0495676_0023048
784 Ga0495676_0232640
785 Ga0495680_0064342
786 Ga0495687_001773
787 Ga0495687_012218
788 Ga0495687_018774
789 Ga0495687_111960
790 Ga0495675_0004739
791 Ga0495675_0020821
792 Ga0495675_0023516
793 Ga0495675_0030569
794 Ga0495675_0084095
795 Ga0495679_027366
796 Ga0495685_000960
797 Ga0495685_001033
798 Ga0495685_003653
799 Ga0495685_017086
800 Ga0495681_0003658
801 Ga0495681_0006819
802 Ga0495681_0077906
803 Ga0495681_0122056
804 Ga0495684_0006221
805 Ga0495684_0122629
806 Ga0495686_0025921
807 Ga0495686_0045365
808 Ga0495593_0000340
809 Ga0495593_0215218
810 Ga0495593_0520172
811 Ga0495602_0037321
812 Ga0495602_0040899
813 Ga0495614_0025680
814 Ga0495614_0047724
815 Ga0495614_0061391
816 Ga0495615_0110187
817 Ga0495626_0110854
818 Ga0496104_1297919
819 Ga0496108_0160717
820 Ga0496109_1132547
821 Ga0496110_0225983
822 Ga0501323_028639
823 Ga0501031_0004394
824 Ga0501031_0016895
825 Ga0501031_0483449
826 Ga0501031_0914370
827 Ga0501032_0000839
828 Ga0501032_0005320
829 Ga0501032_0241865
830 Ga0501033_0030930
831 Ga0501033_0035757
832 Ga0501033_0700346
833 Ga0501034_0004538
834 Ga0501034_0023290
835 Ga0501034_0029264
836 Ga0501034_0110451
837 Ga0501034_0208957
838 Ga0501036_0030894
839 Ga0501036_0075178
840 Ga0501036_0081129
841 Ga0501037_0006646
842 Ga0501037_0032330
843 Ga0501037_0180788
844 Ga0501038_0023739
845 Ga0501038_0051940
846 Ga0501038_0071192
847 Ga0501038_0133325
848 Ga0501039_0033892
849 Ga0501039_0067832
850 Ga0501040_0003799
851 Ga0501041_0001628
852 Ga0501042_0044637
853 Ga0501042_0157087
854 Ga0501043_0002202
855 Ga0501046_0010520
856 Ga0501046_0020733
857 Ga0501047_0000048
858 Ga0501047_0002881
859 Ga0501047_0017507
860 Ga0501047_0026218
861 Ga0501047_0861977
862 Ga0501048_0010393
863 Ga0501048_0014390
864 Ga0501048_0318496
865 Ga0501067_0000870
866 Ga0501068_0000677
867 Ga0501069_0021798
868 Ga0501070_0030281
869 Ga0501071_0000823
870 Ga0501072_0007750
871 Ga0501073_0134492
872 Ga0501074_0016027
873 Ga0501076_0054986
874 Ga0501079_0048681
875 Ga0501080_0128673
876 Ga0501083_0003941
877 Ga0501083_0850622
878 Ga0501035_0001352
879 Ga0501035_0009584
880 Ga0501035_0023294
881 Ga0501035_0129483
882 Ga0501035_0559504
883 Ga0501035_1402083
884 Ga0501044_0001734
885 Ga0501044_0028618
886 Ga0501044_0153325
887 Ga0501044_0263830
888 Ga0501044_0443665
889 nmdc:mga0yw44_245466_c1
890 nmdc:mga08y16_992337_c1
891 nmdc:mga08x19_754779_c1
892 Ga0500610_0241339
893 Ga0495655_0082174
894 Ga0495655_0161387
895 Ga0500578_0057239
896 Ga0500640_052250
897 Ga0500654_005221
898 Ga0500660_211370
899 Ga0500556_0183468
900 Ga0500560_001517
901 Ga0500560_219256
902 Ga0500569_000425
903 Ga0500572_050197
904 Ga0500614_005599
905 Ga0500621_255843
906 Ga0500628_000581
907 Ga0500658_0110288
908 Ga0500561_0000923
909 Ga0500573_0020538
910 Ga0500573_0303950
911 Ga0500579_058892
912 Ga0500600_0026760
913 Ga0500600_0294039
914 Ga0500616_0018136
915 Ga0500633_0001177
916 Ga0500634_0039599
917 Ga0500636_0089379
918 Ga0500656_000145
919 Ga0500587_000596
920 Ga0501084_0001951
921 Ga0501082_0015094
922 Ga0466962_0006410
923 Ga0530510_0013096
924 2554258086
925 2585300152
926 2585318794
927 2616904024
928 2643898569
929 2644406486
930 2644436948
931 2644628678
932 2804847250
933 2808841842
934 2808920387
935 2812358409
936 2852636904
937 2862179588
938 2862285451
939 2862514593
940 2862579424
941 2863404937
942 2875394345
943 2919469714
944 2935392599
945 2946050259
946 2946067470
947 2946075722
948 2947229533
949 2990090369
950 2995467487
951 2995468380
952 2997454570
953 3006394556
954 3006489335
955 8025415941
956 8025536647
957 8033689092
958 8047896648
959 8048362287
960 8048373661
961 8048384581
962 8056833703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

15

116

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.9303 1 127
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.901 1 127
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.7914 2 124
2zhp-assembly1.cif.gz_B crystal structure of bleomycin-binding protein from streptoalloteichus hindustanus complexed with bleomycin derivative 0.7865 1 124
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.7732 2 124
ID Description Score Start End Superfamily
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9258 6 123 3.10.180.10
2qqzB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8942 6 123 3.10.180.10
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8284 76 127 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8244 77 127 3.30.720.110
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7891 2 124 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W9NX43-F1-model_v4 deleted 0.9752 1 128
AF-A0A0N0MVF8-F1-model_v4 Glyoxalase-like domain containing protein 0.9694 1 127
AF-A0A2A3JBF0-F1-model_v4 VOC domain-containing protein 0.9692 1 127
AF-A0A1I2FW31-F1-model_v4 VOC domain-containing protein 0.9684 1 126
AF-A0A7W9V0L2-F1-model_v4 VOC domain-containing protein 0.9622 1 128

Map