F452432

General Info

Members Datasets Scaffolds Average Seq Length
481 270 962 79

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10007251|Ga0265334_100072515
Length 79
Sequence MALDPKLLEILACPEDKGPLLYFQDEDTLYNPRLKRRYRVLDGDIADMLIDDAETVDDAEHARLTKKAETDGIEPNFAG

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 0
Rhizoplane 7.07
Rhizosphere 86.69
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10007251 3300028573 Bacteria 4757
2 Ga0065715_10345390 3300005293 Bacteria 960
3 Ga0070690_100324886 3300005330 Bacteria 1110
4 Ga0068869_100715756 3300005334 Bacteria 855
5 Ga0068869_101590588 3300005334 Bacteria 582
6 Ga0068869_101805271 3300005334 Bacteria 547
7 Ga0068868_100160747 3300005338 Bacteria 1855
8 Ga0070675_100111913 3300005354 Bacteria 2311
9 Ga0070671_100005895 3300005355 Bacteria 9763
10 Ga0070673_100495949 3300005364 Bacteria 1104
11 Ga0070673_102229025 3300005364 Bacteria 521
12 Ga0070688_101277072 3300005365 Bacteria 592
13 Ga0070659_101435922 3300005366 Bacteria 614
14 Ga0070714_100280106 3300005435 Bacteria 1549
15 Ga0070713_100068554 3300005436 Bacteria 2989
16 Ga0070713_100463389 3300005436 Bacteria 1192
17 Ga0070713_101848588 3300005436 Bacteria 586
18 Ga0070710_10710934 3300005437 Bacteria 710
19 Ga0070701_10651633 3300005438 Bacteria 703
20 Ga0070701_10980940 3300005438 Bacteria 588
21 Ga0070711_101280159 3300005439 Bacteria 636
22 Ga0070705_100402674 3300005440 Bacteria 1014
23 Ga0070694_100409542 3300005444 Bacteria 1063
24 Ga0070694_101260452 3300005444 Bacteria 621
25 Ga0070708_100109763 3300005445 Bacteria 2534
26 Ga0070708_102119478 3300005445 Bacteria 520
27 Ga0070681_12018062 3300005458 Bacteria 505
28 Ga0068867_101084671 3300005459 Bacteria 730
29 Ga0068867_102201382 3300005459 Bacteria 523
30 Ga0070685_10237852 3300005466 Bacteria 1201
31 Ga0070706_100050958 3300005467 Bacteria 3819
32 Ga0070706_100375894 3300005467 Bacteria 1323
33 Ga0070707_100410978 3300005468 Bacteria 1314
34 Ga0070698_100037703 3300005471 Bacteria 4983
35 Ga0070698_100320916 3300005471 Bacteria 1479
36 Ga0070699_100367373 3300005518 Bacteria 1298
37 Ga0070699_100672151 3300005518 Bacteria 946
38 Ga0070697_100025551 3300005536 Bacteria 4711
39 Ga0068853_102117288 3300005539 Bacteria 545
40 Ga0070672_100057696 3300005543 Bacteria 3048
41 Ga0070686_100148971 3300005544 Bacteria 1637
42 Ga0070696_101838815 3300005546 Bacteria 524
43 Ga0070665_100252866 3300005548 Bacteria 1763
44 Ga0070665_100755952 3300005548 Bacteria 985
45 Ga0070665_101764548 3300005548 Bacteria 626
46 Ga0070665_101796623 3300005548 Bacteria 620
47 Ga0070704_100424053 3300005549 Bacteria 1140
48 Ga0070704_102200170 3300005549 Unclassified 513
49 Ga0070664_101673650 3300005564 Bacteria 603
50 Ga0068854_100464135 3300005578 Bacteria 1060
51 Ga0070702_101510466 3300005615 Bacteria 553
52 Ga0068859_101886068 3300005617 Bacteria 660
53 Ga0068866_10546224 3300005718 Bacteria 774
54 Ga0068861_101595138 3300005719 Bacteria 643
55 Ga0068861_102670487 3300005719 Bacteria 504
56 Ga0068863_102196204 3300005841 Bacteria 562
57 Ga0068858_100279030 3300005842 Bacteria 1591
58 Ga0068858_101848769 3300005842 Bacteria 597
59 Ga0081455_10100487 3300005937 Bacteria 2324
60 Ga0081455_10102062 3300005937 Bacteria 2301
61 Ga0081455_10201943 3300005937 Bacteria 1488
62 Ga0081455_11019653 3300005937 Bacteria 512
63 Ga0081538_10138172 3300005981 Bacteria 1130
64 Ga0081539_10055158 3300005985 Bacteria 2213
65 Ga0075368_10278741 3300006042 Bacteria 718
66 Ga0075368_10341287 3300006042 Bacteria 651
67 Ga0075363_100918015 3300006048 Bacteria 537
68 Ga0075364_10315862 3300006051 Bacteria 1064
69 Ga0070716_100606558 3300006173 Bacteria 824
70 Ga0070712_100039243 3300006175 Bacteria 3240
71 Ga0070712_101128395 3300006175 Bacteria 681
72 Ga0075362_10079579 3300006177 Bacteria 1509
73 Ga0075367_10181139 3300006178 Bacteria 1314
74 Ga0075367_11096573 3300006178 Bacteria 509
75 Ga0097621_102196664 3300006237 Bacteria 528
76 Ga0075370_10310403 3300006353 Bacteria 939
77 Ga0075428_100045500 3300006844 Bacteria 4822
78 Ga0075428_100257764 3300006844 Bacteria 1878
79 Ga0075428_100280265 3300006844 Bacteria 1793
80 Ga0075430_100156035 3300006846 Bacteria 1900
81 Ga0075430_100271524 3300006846 Bacteria 1403
82 Ga0075430_100668422 3300006846 Bacteria 856
83 Ga0075430_101743910 3300006846 Bacteria 511
84 Ga0075431_100029973 3300006847 Bacteria 5603
85 Ga0075431_100136680 3300006847 Bacteria 2527
86 Ga0075431_100422250 3300006847 Bacteria 1333
87 Ga0075431_100746150 3300006847 Bacteria 954
88 Ga0075431_101575012 3300006847 Bacteria 615
89 Ga0075433_10020441 3300006852 Bacteria 5535
90 Ga0075434_100021081 3300006871 Bacteria 6332
91 Ga0075434_100916746 3300006871 Bacteria 891
92 Ga0075434_101993565 3300006871 Bacteria 586
93 Ga0075429_100012733 3300006880 Bacteria 7296
94 Ga0075429_100453446 3300006880 Bacteria 1124
95 Ga0075436_100128494 3300006914 Bacteria 1776
96 Ga0097620_101886221 3300006931 Bacteria 660
97 Ga0075435_100005764 3300007076 Bacteria 8698
98 Ga0111539_10069269 3300009094 Bacteria 4166
99 Ga0111539_10320965 3300009094 Bacteria 1802
100 Ga0111539_11444463 3300009094 Bacteria 798
101 Ga0111539_12182950 3300009094 Bacteria 642
102 Ga0111539_12790764 3300009094 Bacteria 566
103 Ga0105245_10091585 3300009098 Bacteria 2798
104 Ga0105245_10113390 3300009098 Bacteria 2524
105 Ga0105245_10182929 3300009098 Bacteria 2004
106 Ga0105245_10656429 3300009098 Bacteria 1079
107 Ga0105245_11016491 3300009098 Bacteria 874
108 Ga0105245_11922516 3300009098 Bacteria 645
109 Ga0105245_13254239 3300009098 Unclassified 503
110 Ga0114129_10024481 3300009147 Bacteria 8554
111 Ga0114129_10117817 3300009147 Bacteria 3658
112 Ga0114129_10526777 3300009147 Bacteria 1540
113 Ga0114129_12174276 3300009147 Bacteria 668
114 Ga0105243_10972100 3300009148 Bacteria 850
115 Ga0105243_12574462 3300009148 Bacteria 548
116 Ga0105241_12670364 3300009174 Bacteria 502
117 Ga0105242_10515694 3300009176 Bacteria 1140
118 Ga0105242_10721448 3300009176 Bacteria 978
119 Ga0105242_10854158 3300009176 Bacteria 906
120 Ga0105242_11778186 3300009176 Bacteria 654
121 Ga0105242_12250674 3300009176 Bacteria 591
122 Ga0105242_12951973 3300009176 Unclassified 526
123 Ga0105249_11956269 3300009553 Bacteria 659
124 Ga0105249_12927557 3300009553 Bacteria 548
125 Ga0105249_13198743 3300009553 Bacteria 526
126 Ga0105028_141293 3300009993 Bacteria 520
127 Ga0105239_10175055 3300010375 Bacteria 2400
128 Ga0105246_11374777 3300011119 Bacteria 658
129 Ga0105246_11892851 3300011119 Bacteria 572
130 Ga0157316_1048988 3300012510 Bacteria 577
131 Ga0157378_10407103 3300013297 Bacteria 1342
132 Ga0157378_12312468 3300013297 Bacteria 589
133 Ga0157378_12868109 3300013297 Bacteria 534
134 Ga0163162_11837746 3300013306 Bacteria 693
135 Ga0163162_13094624 3300013306 Bacteria 534
136 Ga0157375_11185427 3300013308 Bacteria 895
137 Ga0157375_11391082 3300013308 Bacteria 826
138 Ga0157375_12324639 3300013308 Bacteria 639
139 Ga0157375_12620907 3300013308 Bacteria 602
140 Ga0157375_13431326 3300013308 Bacteria 528
141 Ga0163163_11281100 3300014325 Bacteria 795
142 Ga0157380_10351731 3300014326 Bacteria 1379
143 Ga0157380_11704943 3300014326 Bacteria 688
144 Ga0157380_12457247 3300014326 Bacteria 587
145 Ga0182008_10957045 3300014497 Bacteria 508
146 Ga0157377_10901286 3300014745 Bacteria 661
147 Ga0157379_11201831 3300014968 Bacteria 729
148 Ga0157379_11317955 3300014968 Bacteria 698
149 Ga0157379_11381584 3300014968 Bacteria 682
150 Ga0157379_11885202 3300014968 Bacteria 589
151 Ga0157376_11192492 3300014969 Bacteria 789
152 Ga0157376_11716651 3300014969 Bacteria 663
153 Ga0206356_11009265 3300020070 Bacteria 632
154 Ga0206352_11071152 3300020078 Bacteria 601
155 Ga0213873_10130371 3300021358 Bacteria 744
156 Ga0207642_10284083 3300025899 Bacteria 953
157 Ga0207699_10307021 3300025906 Bacteria 1109
158 Ga0207645_10514594 3300025907 Bacteria 811
159 Ga0207643_10475406 3300025908 Bacteria 797
160 Ga0207684_10194781 3300025910 Bacteria 1748
161 Ga0207707_11631057 3300025912 Bacteria 507
162 Ga0207693_10415231 3300025915 Bacteria 1052
163 Ga0207693_10762077 3300025915 Bacteria 747
164 Ga0207693_11369190 3300025915 Bacteria 527
165 Ga0207663_10054478 3300025916 Bacteria 2505
166 Ga0207663_11581719 3300025916 Bacteria 528
167 Ga0207662_10466080 3300025918 Bacteria 866
168 Ga0207662_11118270 3300025918 Bacteria 560
169 Ga0207649_11203210 3300025920 Bacteria 599
170 Ga0207652_10598892 3300025921 Bacteria 988
171 Ga0207646_10947869 3300025922 Bacteria 762
172 Ga0207659_10159896 3300025926 Bacteria 1767
173 Ga0207659_10345713 3300025926 Bacteria 1233
174 Ga0207687_10146716 3300025927 Bacteria 1796
175 Ga0207687_10182941 3300025927 Bacteria 1625
176 Ga0207700_10054995 3300025928 Bacteria 2990
177 Ga0207700_10204903 3300025928 Bacteria 1664
178 Ga0207664_10698845 3300025929 Bacteria 912
179 Ga0207644_10018488 3300025931 Bacteria 4716
180 Ga0207686_10876756 3300025934 Bacteria 723
181 Ga0207709_10391427 3300025935 Bacteria 1060
182 Ga0207709_11236153 3300025935 Bacteria 616
183 Ga0207709_11459884 3300025935 Unclassified 567
184 Ga0207670_10930565 3300025936 Bacteria 729
185 Ga0207669_10331858 3300025937 Bacteria 1168
186 Ga0207704_10522929 3300025938 Bacteria 960
187 Ga0207665_10085326 3300025939 Bacteria 2180
188 Ga0207691_10244974 3300025940 Bacteria 1548
189 Ga0207689_10730607 3300025942 Bacteria 835
190 Ga0207689_11818075 3300025942 Bacteria 503
191 Ga0207661_12081107 3300025944 Archaea 514
192 Ga0207679_12015414 3300025945 Bacteria 525
193 Ga0207651_11437004 3300025960 Bacteria 621
194 Ga0207651_11441406 3300025960 Bacteria 620
195 Ga0207712_11968228 3300025961 Bacteria 523
196 Ga0207640_10577956 3300025981 Bacteria 948
197 Ga0207677_10092604 3300026023 Bacteria 2201
198 Ga0207703_10248327 3300026035 Bacteria 1603
199 Ga0207639_11344772 3300026041 Bacteria 670
200 Ga0207678_10340752 3300026067 Bacteria 1292
201 Ga0207678_10367679 3300026067 Bacteria 1242
202 Ga0207708_11963978 3300026075 Bacteria 512
203 Ga0207648_10767047 3300026089 Bacteria 896
204 Ga0207675_100452952 3300026118 Bacteria 1272
205 Ga0207675_100907536 3300026118 Bacteria 897
206 Ga0207683_10641406 3300026121 Bacteria 984
207 Ga0209813_10235866 3300027866 Bacteria 690
208 Ga0209813_10251123 3300027866 Bacteria 672
209 Ga0207428_10026443 3300027907 Bacteria 4844
210 Ga0207428_10039105 3300027907 Bacteria 3851
211 Ga0268266_10153066 3300028379 Bacteria 2081
212 Ga0268266_10268482 3300028379 Bacteria 1583
213 Ga0268266_11869126 3300028379 Bacteria 575
214 Ga0268266_12106050 3300028379 Bacteria 537
215 Ga0265336_10196707 3300028666 Bacteria 599
216 Ga0265338_10002397 3300028800 Bacteria 28204
217 Ga0265325_10000681 3300031241 Bacteria 24723
218 Ga0265339_10012906 3300031249 Bacteria 5079
219 Ga0265327_10014688 3300031251 Bacteria 5107
220 Ga0265327_10046777 3300031251 Bacteria 2287
221 Ga0265316_10654990 3300031344 Unclassified 742
222 Ga0307513_10595660 3300031456 Bacteria 815
223 Ga0307513_10631565 3300031456 Bacteria 779
224 Ga0265313_10000515 3300031595 Bacteria 40522
225 Ga0265314_10086495 3300031711 Bacteria 2052
226 Ga0265342_10597381 3300031712 Bacteria 557
227 Ga0307413_11272057 3300031824 Bacteria 642
228 Ga0307406_11349361 3300031901 Bacteria 624
229 Ga0307406_11449162 3300031901 Bacteria 603
230 Ga0307409_101448025 3300031995 Bacteria 714
231 Ga0307416_103671641 3300032002 Bacteria 514
232 Ga0307411_12297627 3300032005 Bacteria 507
233 Ga0373939_0535285 3300035114 Bacteria 505
234 Ga0373960_0115581 3300035121 Bacteria 885
235 Ga0373960_0454107 3300035121 Bacteria 503
236 Ga0373946_0083279 3300035171 Bacteria 1405
237 Ga0373931_0222814 3300035691 Bacteria 1136
238 Ga0373931_0507520 3300035691 Bacteria 779
239 Ga0373927_0825169 3300035695 Bacteria 612
240 Ga0373933_0757916 3300035724 Bacteria 639
241 Ga0373947_0045855 3300035725 Bacteria 2616
242 Ga0373937_0322035 3300036401 Bacteria 1463
243 Ga0373937_0649849 3300036401 Bacteria 1000
244 Ga0373925_0130627 3300037068 Bacteria 1958
245 Ga0373925_0460623 3300037068 Bacteria 1042
246 Ga0373925_1466137 3300037068 Bacteria 559
247 Ga0395898_0932116 3300037466 Bacteria 806
248 Ga0400483_031608 3300039062 Bacteria 3800
249 Ga0400483_276435 3300039062 Bacteria 2504
250 Ga0436362_0176349 3300039453 Bacteria 637
251 Ga0436362_0287028 3300039453 Bacteria 2516
252 Ga0436362_0789299 3300039453 Bacteria 532
253 Ga0451798_0706485 3300041458 Bacteria 646
254 Ga0451807_1531633 3300041486 Bacteria 522
255 Ga0451845_0731326 3300041501 Bacteria 692
256 Ga0451853_2034670 3300041512 Bacteria 638
257 Ga0451853_3858008 3300041512 Bacteria 579
258 Ga0453684_2393437 3300044712 Bacteria 523
259 Ga0466957_0143537 3300044842 Bacteria 1540
260 Ga0466967_0494339 3300045976 Bacteria 1200
261 Ga0495629_0707283 3300046459 Archaea 669
262 Ga0495653_0780574 3300046463 Bacteria 575
263 Ga0495653_0805421 3300046463 Bacteria 564
264 Ga0495580_1040248 3300046472 Bacteria 520
265 Ga0495582_0071066 3300046473 Bacteria 1926
266 Ga0495639_0137155 3300046475 Bacteria 1174
267 Ga0495662_0161607 3300046476 Bacteria 1104
268 Ga0495584_0366072 3300046491 Bacteria 732
269 Ga0495594_0659147 3300046499 Bacteria 592
270 Ga0495596_0075428 3300046500 Bacteria 1310
271 Ga0495583_0299612 3300046506 Bacteria 639
272 Ga0495608_0873380 3300046511 Bacteria 528
273 Ga0495616_0312885 3300046513 Bacteria 661
274 Ga0495618_0331081 3300046514 Bacteria 942
275 Ga0495618_0543423 3300046514 Bacteria 696
276 Ga0495628_0669209 3300046516 Bacteria 736
277 Ga0495630_0116621 3300046517 Bacteria 2024
278 Ga0495630_0503558 3300046517 Bacteria 929
279 Ga0495630_0842829 3300046517 Bacteria 699
280 Ga0495631_0347866 3300046518 Bacteria 631
281 Ga0495666_0296478 3300046526 Bacteria 732
282 Ga0495665_0151159 3300046531 Bacteria 1212
283 Ga0495586_0256311 3300046535 Bacteria 999
284 Ga0495586_0522956 3300046535 Bacteria 685
285 Ga0495587_0331809 3300046536 Bacteria 849
286 Ga0495598_0239872 3300046537 Bacteria 668
287 Ga0495645_0302251 3300046543 Bacteria 1045
288 Ga0495667_0338093 3300046559 Bacteria 952
289 Ga0495656_0179965 3300046615 Bacteria 1039
290 Ga0495656_0762726 3300046615 Bacteria 522
291 Ga0495668_0614060 3300046616 Bacteria 601
292 Ga0495634_0649397 3300046642 Bacteria 609
293 Ga0495659_0069929 3300046664 Bacteria 1314
294 Ga0495588_0208980 3300046674 Bacteria 1031
295 Ga0495599_0197665 3300046678 Bacteria 1236
296 Ga0495647_0084501 3300046681 Bacteria 1292
297 Ga0495647_0270152 3300046681 Bacteria 761
298 Ga0495658_0101804 3300046683 Bacteria 1716
299 Ga0495658_0719216 3300046683 Bacteria 640
300 Ga0495613_0090627 3300046689 Bacteria 2215
301 Ga0495613_0934763 3300046689 Bacteria 560
302 Ga0495670_0617720 3300046691 Bacteria 591
303 Ga0495589_0508866 3300046794 Bacteria 550
304 Ga0495581_0218646 3300047315 Bacteria 1114
305 Ga0495581_0776816 3300047315 Bacteria 550
306 Ga0495604_0424996 3300047317 Archaea 872
307 Ga0495604_0808401 3300047317 Bacteria 590
308 Ga0495636_0456302 3300047318 Bacteria 614
309 Ga0495674_0438371 3300047319 Bacteria 1051
310 Ga0495674_0678947 3300047319 Bacteria 810
311 Ga0495674_1002830 3300047319 Bacteria 640
312 Ga0495672_0002557 3300047320 Bacteria 16575
313 Ga0495676_0046659 3300047321 Bacteria 3514
314 Ga0495676_0793251 3300047321 Bacteria 610
315 Ga0495680_0482667 3300047322 Bacteria 844
316 Ga0495602_0162960 3300048088 Bacteria 1739
317 Ga0495614_0265229 3300048089 Bacteria 788
318 Ga0496100_0007183 3300048903 Bacteria 6121
319 Ga0496100_0622579 3300048903 Bacteria 839
320 Ga0496100_1278632 3300048903 Bacteria 579
321 Ga0496101_0019614 3300048904 Bacteria 4619
322 Ga0496101_0145495 3300048904 Bacteria 1809
323 Ga0496102_0016033 3300048905 Bacteria 6540
324 Ga0496102_0205937 3300048905 Bacteria 1855
325 Ga0496102_0363372 3300048905 Bacteria 1363
326 Ga0496103_0116313 3300048906 Bacteria 1701
327 Ga0496103_1028754 3300048906 Bacteria 512
328 Ga0496104_0009966 3300048907 Bacteria 8482
329 Ga0496104_0074589 3300048907 Bacteria 3229
330 Ga0496104_0493269 3300048907 Bacteria 1136
331 Ga0496104_1228312 3300048907 Bacteria 653
332 Ga0496105_0038229 3300048908 Bacteria 3953
333 Ga0496105_0038825 3300048908 Bacteria 3923
334 Ga0496105_0289035 3300048908 Bacteria 1320
335 Ga0496105_0809126 3300048908 Bacteria 712
336 Ga0496106_0658767 3300048909 Bacteria 836
337 Ga0496107_0172701 3300048910 Bacteria 1604
338 Ga0496108_0104448 3300048911 Bacteria 2418
339 Ga0496108_0119984 3300048911 Bacteria 2255
340 Ga0496109_0201332 3300048912 Bacteria 1872
341 Ga0496109_1637787 3300048912 Bacteria 578
342 Ga0496110_0547251 3300048913 Bacteria 1052
343 Ga0496110_1261916 3300048913 Bacteria 648
344 Ga0496110_1899440 3300048913 Bacteria 505
345 Ga0496111_0463991 3300048914 Bacteria 934
346 Ga0496112_1371220 3300048915 Bacteria 622
347 Ga0496114_0298750 3300048917 Bacteria 1421
348 Ga0496114_1101850 3300048917 Bacteria 679
349 Ga0496115_0003640 3300048918 Bacteria 11092
350 Ga0501031_0672523 3300049568 Bacteria 665
351 Ga0501032_0340177 3300049569 Bacteria 967
352 Ga0501032_0519836 3300049569 Bacteria 760
353 Ga0501034_0000888 3300049571 Bacteria 43830
354 Ga0501034_0113053 3300049571 Bacteria 2705
355 Ga0501034_0665710 3300049571 Bacteria 942
356 Ga0501036_0668351 3300049572 Bacteria 859
357 Ga0501036_0679427 3300049572 Bacteria 851
358 Ga0501036_0837994 3300049572 Bacteria 756
359 Ga0501037_0021209 3300049573 Bacteria 4800
360 Ga0501037_0800646 3300049573 Bacteria 622
361 Ga0501039_0430085 3300049575 Bacteria 1037
362 Ga0501039_1347653 3300049575 Bacteria 550
363 Ga0501040_1419835 3300049576 Bacteria 504
364 Ga0501041_0139375 3300049577 Bacteria 1512
365 Ga0501042_0695211 3300049578 Bacteria 739
366 Ga0501043_0030277 3300049579 Bacteria 4253
367 Ga0501043_0249994 3300049579 Bacteria 1366
368 Ga0501046_0019701 3300049580 Bacteria 5592
369 Ga0501047_0227510 3300049581 Bacteria 1719
370 Ga0501047_1116969 3300049581 Bacteria 602
371 Ga0501067_0012407 3300049583 Bacteria 4727
372 Ga0501067_0112926 3300049583 Bacteria 1511
373 Ga0501068_0000026 3300049584 Bacteria 54959
374 Ga0501068_0002847 3300049584 Bacteria 9206
375 Ga0501068_0216436 3300049584 Bacteria 1217
376 Ga0501068_0379683 3300049584 Bacteria 910
377 Ga0501068_0711971 3300049584 Bacteria 657
378 Ga0501068_0842118 3300049584 Bacteria 602
379 Ga0501069_0001068 3300049585 Bacteria 13154
380 Ga0501070_0000507 3300049586 Bacteria 35570
381 Ga0501070_0026996 3300049586 Bacteria 4816
382 Ga0501070_0143900 3300049586 Bacteria 1968
383 Ga0501070_0333824 3300049586 Bacteria 1232
384 Ga0501071_0013984 3300049587 Bacteria 5481
385 Ga0501071_0017832 3300049587 Bacteria 4905
386 Ga0501071_0207750 3300049587 Bacteria 1472
387 Ga0501071_1560216 3300049587 Bacteria 510
388 Ga0501072_0003707 3300049588 Bacteria 11525
389 Ga0501072_0014315 3300049588 Bacteria 6080
390 Ga0501072_0351709 3300049588 Bacteria 1170
391 Ga0501072_0671717 3300049588 Bacteria 815
392 Ga0501072_0808338 3300049588 Bacteria 734
393 Ga0501073_0002114 3300049589 Bacteria 14886
394 Ga0501073_0004564 3300049589 Bacteria 10413
395 Ga0501073_0139696 3300049589 Bacteria 1679
396 Ga0501073_0140741 3300049589 Bacteria 1672
397 Ga0501073_0426668 3300049589 Bacteria 916
398 Ga0501073_0523805 3300049589 Bacteria 819
399 Ga0501074_0007018 3300049590 Bacteria 8131
400 Ga0501074_0046734 3300049590 Bacteria 3130
401 Ga0501074_0153579 3300049590 Bacteria 1645
402 Ga0501074_0200376 3300049590 Bacteria 1423
403 Ga0501074_0803147 3300049590 Bacteria 663
404 Ga0501075_0054015 3300049591 Bacteria 3021
405 Ga0501075_1117394 3300049591 Bacteria 598
406 Ga0501076_0064956 3300049592 Bacteria 2909
407 Ga0501076_1658025 3300049592 Bacteria 525
408 Ga0501077_0590897 3300049593 Bacteria 713
409 Ga0501079_0046191 3300049741 Bacteria 3360
410 Ga0501079_1351537 3300049741 Bacteria 561
411 Ga0501080_0011316 3300049742 Bacteria 8167
412 Ga0501080_0067227 3300049742 Bacteria 3333
413 Ga0501080_0178481 3300049742 Bacteria 1955
414 Ga0501080_0202947 3300049742 Bacteria 1820
415 Ga0501080_1122736 3300049742 Bacteria 678
416 Ga0501080_1283382 3300049742 Bacteria 627
417 Ga0501080_1524785 3300049742 Bacteria 567
418 Ga0501081_0273848 3300049743 Bacteria 1235
419 Ga0501083_0000693 3300049744 Bacteria 21950
420 Ga0501083_0026068 3300049744 Bacteria 4044
421 Ga0501083_0312950 3300049744 Bacteria 1021
422 Ga0501083_0314127 3300049744 Bacteria 1019
423 Ga0501083_0403182 3300049744 Bacteria 890
424 Ga0501035_1297779 3300049822 Bacteria 561
425 Ga0501044_0079818 3300049823 Bacteria 3315
426 Ga0501045_0005778 3300049824 Bacteria 8561
427 nmdc:mga03n38_248186_c1 3300050490 Bacteria 939
428 nmdc:mga03n38_25194_c1 3300050490 Bacteria 2440
429 nmdc:mga03n38_769275_c1 3300050490 Bacteria 559
430 nmdc:mga0yw44_404654_c1 3300050492 Bacteria 923
431 nmdc:mga0yw44_457385_c1 3300050492 Bacteria 865
432 nmdc:mga06z11_127325_c1 3300050494 Bacteria 1426
433 nmdc:mga06z11_307519_c1 3300050494 Bacteria 943
434 nmdc:mga04h51_244080_c1 3300050495 Bacteria 718
435 nmdc:mga04h51_266322_c1 3300050495 Bacteria 690
436 nmdc:mga07m45_387185_c1 3300050496 Bacteria 812
437 nmdc:mga05p37_1550898_c1 3300050507 Bacteria 656
438 nmdc:mga05p37_296284_c1 3300050507 Bacteria 1923
439 nmdc:mga05p37_418904_c1 3300050507 Bacteria 1559
440 nmdc:mga09592_191197_c1 3300050508 Bacteria 1772
441 nmdc:mga09592_676370_c1 3300050508 Bacteria 880
442 nmdc:mga0qj67_1360703_c1 3300050509 Bacteria 549
443 nmdc:mga0qj67_262050_c1 3300050509 Bacteria 1402
444 nmdc:mga0qj67_541388_c1 3300050509 Bacteria 934
445 nmdc:mga0qj67_55976_c1 3300050509 Bacteria 3126
446 nmdc:mga06r32_1712550_c1 3300050510 Bacteria 565
447 nmdc:mga06r32_17838_c1 3300050510 Bacteria 6487
448 nmdc:mga06r32_204781_c1 3300050510 Bacteria 1961
449 nmdc:mga06r32_502975_c1 3300050510 Bacteria 1189
450 nmdc:mga08y16_43623_c1 3300050511 Bacteria 4701
451 nmdc:mga08y16_50024_c1 3300050511 Bacteria 4373
452 nmdc:mga08y16_616726_c1 3300050511 Bacteria 1092
453 nmdc:mga0n895_1500201_c1 3300050512 Bacteria 640
454 nmdc:mga0n895_249685_c1 3300050512 Bacteria 1801
455 nmdc:mga0n895_763709_c1 3300050512 Bacteria 959
456 nmdc:mga0rr50_126855_c1 3300050513 Bacteria 2039
457 nmdc:mga0rr50_145799_c1 3300050513 Bacteria 1909
458 nmdc:mga08x19_486275_c1 3300050514 Bacteria 871
459 nmdc:mga0a205_5963_c1 3300050515 Bacteria 10981
460 Ga0495601_0090746 3300053077 Bacteria 1966
461 Ga0495601_0153950 3300053077 Bacteria 1501
462 Ga0495601_0613845 3300053077 Bacteria 697
463 Ga0495601_0657106 3300053077 Bacteria 670
464 Ga0495595_0262475 3300053084 Bacteria 866
465 Ga0495595_0367754 3300053084 Archaea 727
466 Ga0495619_0201071 3300053085 Bacteria 1379
467 Ga0495619_0840822 3300053085 Bacteria 619
468 Ga0500554_135942 3300053102 Bacteria 831
469 Ga0500568_0000018 3300053139 Bacteria 196030
470 Ga0500616_0013648 3300053153 Bacteria 4707
471 Ga0501084_0000396 3300054114 Bacteria 33489
472 Ga0501084_0297545 3300054114 Bacteria 1363
473 Ga0501084_0438359 3300054114 Bacteria 1104
474 Ga0501084_0474321 3300054114 Bacteria 1058
475 Ga0501084_1300605 3300054114 Bacteria 609
476 Ga0501082_0022989 3300060353 Bacteria 5375
477 Ga0501082_0220765 3300060353 Bacteria 1649
478 Ga0501082_0301800 3300060353 Bacteria 1394
479 Ga0501082_0609162 3300060353 Bacteria 956
480 Ga0530510_0021602 3300061734 Bacteria 4579
481 Ga0530510_1240352 3300061734 Bacteria 572
482 Ga0265334_10007251
483 Ga0065715_10345390
484 Ga0070690_100324886
485 Ga0068869_100715756
486 Ga0068869_101590588
487 Ga0068869_101805271
488 Ga0068868_100160747
489 Ga0070675_100111913
490 Ga0070671_100005895
491 Ga0070673_100495949
492 Ga0070673_102229025
493 Ga0070688_101277072
494 Ga0070659_101435922
495 Ga0070714_100280106
496 Ga0070713_100068554
497 Ga0070713_100463389
498 Ga0070713_101848588
499 Ga0070710_10710934
500 Ga0070701_10651633
501 Ga0070701_10980940
502 Ga0070711_101280159
503 Ga0070705_100402674
504 Ga0070694_100409542
505 Ga0070694_101260452
506 Ga0070708_100109763
507 Ga0070708_102119478
508 Ga0070681_12018062
509 Ga0068867_101084671
510 Ga0068867_102201382
511 Ga0070685_10237852
512 Ga0070706_100050958
513 Ga0070706_100375894
514 Ga0070707_100410978
515 Ga0070698_100037703
516 Ga0070698_100320916
517 Ga0070699_100367373
518 Ga0070699_100672151
519 Ga0070697_100025551
520 Ga0068853_102117288
521 Ga0070672_100057696
522 Ga0070686_100148971
523 Ga0070696_101838815
524 Ga0070665_100252866
525 Ga0070665_100755952
526 Ga0070665_101764548
527 Ga0070665_101796623
528 Ga0070704_100424053
529 Ga0070704_102200170
530 Ga0070664_101673650
531 Ga0068854_100464135
532 Ga0070702_101510466
533 Ga0068859_101886068
534 Ga0068866_10546224
535 Ga0068861_101595138
536 Ga0068861_102670487
537 Ga0068863_102196204
538 Ga0068858_100279030
539 Ga0068858_101848769
540 Ga0081455_10100487
541 Ga0081455_10102062
542 Ga0081455_10201943
543 Ga0081455_11019653
544 Ga0081538_10138172
545 Ga0081539_10055158
546 Ga0075368_10278741
547 Ga0075368_10341287
548 Ga0075363_100918015
549 Ga0075364_10315862
550 Ga0070716_100606558
551 Ga0070712_100039243
552 Ga0070712_101128395
553 Ga0075362_10079579
554 Ga0075367_10181139
555 Ga0075367_11096573
556 Ga0097621_102196664
557 Ga0075370_10310403
558 Ga0075428_100045500
559 Ga0075428_100257764
560 Ga0075428_100280265
561 Ga0075430_100156035
562 Ga0075430_100271524
563 Ga0075430_100668422
564 Ga0075430_101743910
565 Ga0075431_100029973
566 Ga0075431_100136680
567 Ga0075431_100422250
568 Ga0075431_100746150
569 Ga0075431_101575012
570 Ga0075433_10020441
571 Ga0075434_100021081
572 Ga0075434_100916746
573 Ga0075434_101993565
574 Ga0075429_100012733
575 Ga0075429_100453446
576 Ga0075436_100128494
577 Ga0097620_101886221
578 Ga0075435_100005764
579 Ga0111539_10069269
580 Ga0111539_10320965
581 Ga0111539_11444463
582 Ga0111539_12182950
583 Ga0111539_12790764
584 Ga0105245_10091585
585 Ga0105245_10113390
586 Ga0105245_10182929
587 Ga0105245_10656429
588 Ga0105245_11016491
589 Ga0105245_11922516
590 Ga0105245_13254239
591 Ga0114129_10024481
592 Ga0114129_10117817
593 Ga0114129_10526777
594 Ga0114129_12174276
595 Ga0105243_10972100
596 Ga0105243_12574462
597 Ga0105241_12670364
598 Ga0105242_10515694
599 Ga0105242_10721448
600 Ga0105242_10854158
601 Ga0105242_11778186
602 Ga0105242_12250674
603 Ga0105242_12951973
604 Ga0105249_11956269
605 Ga0105249_12927557
606 Ga0105249_13198743
607 Ga0105028_141293
608 Ga0105239_10175055
609 Ga0105246_11374777
610 Ga0105246_11892851
611 Ga0157316_1048988
612 Ga0157378_10407103
613 Ga0157378_12312468
614 Ga0157378_12868109
615 Ga0163162_11837746
616 Ga0163162_13094624
617 Ga0157375_11185427
618 Ga0157375_11391082
619 Ga0157375_12324639
620 Ga0157375_12620907
621 Ga0157375_13431326
622 Ga0163163_11281100
623 Ga0157380_10351731
624 Ga0157380_11704943
625 Ga0157380_12457247
626 Ga0182008_10957045
627 Ga0157377_10901286
628 Ga0157379_11201831
629 Ga0157379_11317955
630 Ga0157379_11381584
631 Ga0157379_11885202
632 Ga0157376_11192492
633 Ga0157376_11716651
634 Ga0206356_11009265
635 Ga0206352_11071152
636 Ga0213873_10130371
637 Ga0207642_10284083
638 Ga0207699_10307021
639 Ga0207645_10514594
640 Ga0207643_10475406
641 Ga0207684_10194781
642 Ga0207707_11631057
643 Ga0207693_10415231
644 Ga0207693_10762077
645 Ga0207693_11369190
646 Ga0207663_10054478
647 Ga0207663_11581719
648 Ga0207662_10466080
649 Ga0207662_11118270
650 Ga0207649_11203210
651 Ga0207652_10598892
652 Ga0207646_10947869
653 Ga0207659_10159896
654 Ga0207659_10345713
655 Ga0207687_10146716
656 Ga0207687_10182941
657 Ga0207700_10054995
658 Ga0207700_10204903
659 Ga0207664_10698845
660 Ga0207644_10018488
661 Ga0207686_10876756
662 Ga0207709_10391427
663 Ga0207709_11236153
664 Ga0207709_11459884
665 Ga0207670_10930565
666 Ga0207669_10331858
667 Ga0207704_10522929
668 Ga0207665_10085326
669 Ga0207691_10244974
670 Ga0207689_10730607
671 Ga0207689_11818075
672 Ga0207661_12081107
673 Ga0207679_12015414
674 Ga0207651_11437004
675 Ga0207651_11441406
676 Ga0207712_11968228
677 Ga0207640_10577956
678 Ga0207677_10092604
679 Ga0207703_10248327
680 Ga0207639_11344772
681 Ga0207678_10340752
682 Ga0207678_10367679
683 Ga0207708_11963978
684 Ga0207648_10767047
685 Ga0207675_100452952
686 Ga0207675_100907536
687 Ga0207683_10641406
688 Ga0209813_10235866
689 Ga0209813_10251123
690 Ga0207428_10026443
691 Ga0207428_10039105
692 Ga0268266_10153066
693 Ga0268266_10268482
694 Ga0268266_11869126
695 Ga0268266_12106050
696 Ga0265336_10196707
697 Ga0265338_10002397
698 Ga0265325_10000681
699 Ga0265339_10012906
700 Ga0265327_10014688
701 Ga0265327_10046777
702 Ga0265316_10654990
703 Ga0307513_10595660
704 Ga0307513_10631565
705 Ga0265313_10000515
706 Ga0265314_10086495
707 Ga0265342_10597381
708 Ga0307413_11272057
709 Ga0307406_11349361
710 Ga0307406_11449162
711 Ga0307409_101448025
712 Ga0307416_103671641
713 Ga0307411_12297627
714 Ga0373939_0535285
715 Ga0373960_0115581
716 Ga0373960_0454107
717 Ga0373946_0083279
718 Ga0373931_0222814
719 Ga0373931_0507520
720 Ga0373927_0825169
721 Ga0373933_0757916
722 Ga0373947_0045855
723 Ga0373937_0322035
724 Ga0373937_0649849
725 Ga0373925_0130627
726 Ga0373925_0460623
727 Ga0373925_1466137
728 Ga0395898_0932116
729 Ga0400483_031608
730 Ga0400483_276435
731 Ga0436362_0176349
732 Ga0436362_0287028
733 Ga0436362_0789299
734 Ga0451798_0706485
735 Ga0451807_1531633
736 Ga0451845_0731326
737 Ga0451853_2034670
738 Ga0451853_3858008
739 Ga0453684_2393437
740 Ga0466957_0143537
741 Ga0466967_0494339
742 Ga0495629_0707283
743 Ga0495653_0780574
744 Ga0495653_0805421
745 Ga0495580_1040248
746 Ga0495582_0071066
747 Ga0495639_0137155
748 Ga0495662_0161607
749 Ga0495584_0366072
750 Ga0495594_0659147
751 Ga0495596_0075428
752 Ga0495583_0299612
753 Ga0495608_0873380
754 Ga0495616_0312885
755 Ga0495618_0331081
756 Ga0495618_0543423
757 Ga0495628_0669209
758 Ga0495630_0116621
759 Ga0495630_0503558
760 Ga0495630_0842829
761 Ga0495631_0347866
762 Ga0495666_0296478
763 Ga0495665_0151159
764 Ga0495586_0256311
765 Ga0495586_0522956
766 Ga0495587_0331809
767 Ga0495598_0239872
768 Ga0495645_0302251
769 Ga0495667_0338093
770 Ga0495656_0179965
771 Ga0495656_0762726
772 Ga0495668_0614060
773 Ga0495634_0649397
774 Ga0495659_0069929
775 Ga0495588_0208980
776 Ga0495599_0197665
777 Ga0495647_0084501
778 Ga0495647_0270152
779 Ga0495658_0101804
780 Ga0495658_0719216
781 Ga0495613_0090627
782 Ga0495613_0934763
783 Ga0495670_0617720
784 Ga0495589_0508866
785 Ga0495581_0218646
786 Ga0495581_0776816
787 Ga0495604_0424996
788 Ga0495604_0808401
789 Ga0495636_0456302
790 Ga0495674_0438371
791 Ga0495674_0678947
792 Ga0495674_1002830
793 Ga0495672_0002557
794 Ga0495676_0046659
795 Ga0495676_0793251
796 Ga0495680_0482667
797 Ga0495602_0162960
798 Ga0495614_0265229
799 Ga0496100_0007183
800 Ga0496100_0622579
801 Ga0496100_1278632
802 Ga0496101_0019614
803 Ga0496101_0145495
804 Ga0496102_0016033
805 Ga0496102_0205937
806 Ga0496102_0363372
807 Ga0496103_0116313
808 Ga0496103_1028754
809 Ga0496104_0009966
810 Ga0496104_0074589
811 Ga0496104_0493269
812 Ga0496104_1228312
813 Ga0496105_0038229
814 Ga0496105_0038825
815 Ga0496105_0289035
816 Ga0496105_0809126
817 Ga0496106_0658767
818 Ga0496107_0172701
819 Ga0496108_0104448
820 Ga0496108_0119984
821 Ga0496109_0201332
822 Ga0496109_1637787
823 Ga0496110_0547251
824 Ga0496110_1261916
825 Ga0496110_1899440
826 Ga0496111_0463991
827 Ga0496112_1371220
828 Ga0496114_0298750
829 Ga0496114_1101850
830 Ga0496115_0003640
831 Ga0501031_0672523
832 Ga0501032_0340177
833 Ga0501032_0519836
834 Ga0501034_0000888
835 Ga0501034_0113053
836 Ga0501034_0665710
837 Ga0501036_0668351
838 Ga0501036_0679427
839 Ga0501036_0837994
840 Ga0501037_0021209
841 Ga0501037_0800646
842 Ga0501039_0430085
843 Ga0501039_1347653
844 Ga0501040_1419835
845 Ga0501041_0139375
846 Ga0501042_0695211
847 Ga0501043_0030277
848 Ga0501043_0249994
849 Ga0501046_0019701
850 Ga0501047_0227510
851 Ga0501047_1116969
852 Ga0501067_0012407
853 Ga0501067_0112926
854 Ga0501068_0000026
855 Ga0501068_0002847
856 Ga0501068_0216436
857 Ga0501068_0379683
858 Ga0501068_0711971
859 Ga0501068_0842118
860 Ga0501069_0001068
861 Ga0501070_0000507
862 Ga0501070_0026996
863 Ga0501070_0143900
864 Ga0501070_0333824
865 Ga0501071_0013984
866 Ga0501071_0017832
867 Ga0501071_0207750
868 Ga0501071_1560216
869 Ga0501072_0003707
870 Ga0501072_0014315
871 Ga0501072_0351709
872 Ga0501072_0671717
873 Ga0501072_0808338
874 Ga0501073_0002114
875 Ga0501073_0004564
876 Ga0501073_0139696
877 Ga0501073_0140741
878 Ga0501073_0426668
879 Ga0501073_0523805
880 Ga0501074_0007018
881 Ga0501074_0046734
882 Ga0501074_0153579
883 Ga0501074_0200376
884 Ga0501074_0803147
885 Ga0501075_0054015
886 Ga0501075_1117394
887 Ga0501076_0064956
888 Ga0501076_1658025
889 Ga0501077_0590897
890 Ga0501079_0046191
891 Ga0501079_1351537
892 Ga0501080_0011316
893 Ga0501080_0067227
894 Ga0501080_0178481
895 Ga0501080_0202947
896 Ga0501080_1122736
897 Ga0501080_1283382
898 Ga0501080_1524785
899 Ga0501081_0273848
900 Ga0501083_0000693
901 Ga0501083_0026068
902 Ga0501083_0312950
903 Ga0501083_0314127
904 Ga0501083_0403182
905 Ga0501035_1297779
906 Ga0501044_0079818
907 Ga0501045_0005778
908 nmdc:mga03n38_248186_c1
909 nmdc:mga03n38_25194_c1
910 nmdc:mga03n38_769275_c1
911 nmdc:mga0yw44_404654_c1
912 nmdc:mga0yw44_457385_c1
913 nmdc:mga06z11_127325_c1
914 nmdc:mga06z11_307519_c1
915 nmdc:mga04h51_244080_c1
916 nmdc:mga04h51_266322_c1
917 nmdc:mga07m45_387185_c1
918 nmdc:mga05p37_1550898_c1
919 nmdc:mga05p37_296284_c1
920 nmdc:mga05p37_418904_c1
921 nmdc:mga09592_191197_c1
922 nmdc:mga09592_676370_c1
923 nmdc:mga0qj67_1360703_c1
924 nmdc:mga0qj67_262050_c1
925 nmdc:mga0qj67_541388_c1
926 nmdc:mga0qj67_55976_c1
927 nmdc:mga06r32_1712550_c1
928 nmdc:mga06r32_17838_c1
929 nmdc:mga06r32_204781_c1
930 nmdc:mga06r32_502975_c1
931 nmdc:mga08y16_43623_c1
932 nmdc:mga08y16_50024_c1
933 nmdc:mga08y16_616726_c1
934 nmdc:mga0n895_1500201_c1
935 nmdc:mga0n895_249685_c1
936 nmdc:mga0n895_763709_c1
937 nmdc:mga0rr50_126855_c1
938 nmdc:mga0rr50_145799_c1
939 nmdc:mga08x19_486275_c1
940 nmdc:mga0a205_5963_c1
941 Ga0495601_0090746
942 Ga0495601_0153950
943 Ga0495601_0613845
944 Ga0495601_0657106
945 Ga0495595_0262475
946 Ga0495595_0367754
947 Ga0495619_0201071
948 Ga0495619_0840822
949 Ga0500554_135942
950 Ga0500568_0000018
951 Ga0500616_0013648
952 Ga0501084_0000396
953 Ga0501084_0297545
954 Ga0501084_0438359
955 Ga0501084_0474321
956 Ga0501084_1300605
957 Ga0501082_0022989
958 Ga0501082_0220765
959 Ga0501082_0301800
960 Ga0501082_0609162
961 Ga0530510_0021602
962 Ga0530510_1240352

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03966

Trm112p

Trm112p-like protein

4

43

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ju7-assembly1.cif.gz_A dna binding domain of e.coli cadc 0.7909 17 69
8b4b-assembly1.cif.gz_Y toxr bacterial transcriptional regulator bound to 19 bp ompu promoter dna 0.7789 20 69
8b4b-assembly1.cif.gz_W toxr bacterial transcriptional regulator bound to 19 bp ompu promoter dna 0.7784 26 69
8b4b-assembly1.cif.gz_X toxr bacterial transcriptional regulator bound to 19 bp ompu promoter dna 0.7638 26 69
2pk7-assembly1.cif.gz_A crystal structure of the q4kft4_psef5 protein from pseudomonas fluorescens. nesg target plr1 0.7021 7 60
ID Description Score Start End Superfamily
af_P23890_1_102_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8152 18 69 1.10.10.10
af_Q8N302_203_254_3.10.50.10 Alpha Beta;Roll;Chitinase A; domain 3; 0.805 20 42 3.10.50.10
af_Q2FUY9_123_221_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8025 17 65 1.10.10.10
2jr6A01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7839 12 63 2.20.25.10
af_Q8LG27_23_76_2.20.25.10 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7645 12 57 2.20.25.10
ID Description Score Start End GO Terms
AF-A0A6N7G197-F1-model_v4 Trm112 family protein 0.9721 19 78
AF-A0A1B6NRG7-F1-model_v4 Cytosolic protein 0.9642 27 64
AF-A0A6N7G197-F1-model_v4 Trm112 family protein 0.9564 19 78
AF-A0A2V7PVY5-F1-model_v4 Tetraacyldisaccharide 4'-kinase 0.9551 18 55 GO:0016301
AF-A0A2V7PVY5-F1-model_v4 Tetraacyldisaccharide 4'-kinase 0.9324 18 55 GO:0016301

Map