F452390

General Info

Members Datasets Scaffolds Average Seq Length
481 275 473 146

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10002929|Ga0105251_100029296
Length 165
Sequence MEQLAMIYPWLKAGHVIFVIFWMAGLFMLPRFFVYHQESEPGSPEEARWVDREAKLRKIILTPSLIMVWLFGLALAVSGQWWVAGWLHAKLLLVFLLSGYHGWMVGYSKKLAKGERRLSGKALRLLNEVPGIAAVLIVVLVVVKPFWPADSQGVAMFIPMLAALR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
4 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
5 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
6 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
7 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
8 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
78 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
79 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
172 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
192 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
218 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
255 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
256 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
257 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
258 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
259 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
260 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
261 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
262 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
263 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
266 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
269 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
272 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
273 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
274 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
275 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.27
Nodule 0
Rhizoplane 3.74
Rhizosphere 73.8
Stem 0
Stem Tuber 0
Unclassified 10.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2092787 2162886007 Bacteria 1121
2 SwRhRL2b_contig_2977751 2162886007 Bacteria 1634
3 SwRhRL2b_contig_780398 2162886007 Bacteria 36690
4 JGI24736J21556_1006117 3300001904 Bacteria 2031
5 JGI24741J21665_1006068 3300001915 Bacteria 2463
6 JGI24739J22299_10060341 3300001989 Bacteria 1200
7 JGI24737J22298_10002929 3300001990 Bacteria 6049
8 JGI24737J22298_10169909 3300001990 Bacteria 643
9 JGI24744J21845_10012848 3300002077 Bacteria 1692
10 JGI24034J26672_10063430 3300002239 Bacteria 652
11 JGI25153J46596_10001130 3300003215 Bacteria 16141
12 Ga0055525_1000118 3300003759 Bacteria 120652
13 Ga0055542_1000076 3300003762 Bacteria 139662
14 Ga0055529_1000004 3300003763 Bacteria 433331
15 Ga0055530_10012841 3300003791 Bacteria 2896
16 Ga0065714_10079710 3300005288 Bacteria 2493
17 Ga0065704_10070157 3300005289 Bacteria 211668
18 Ga0065704_10075725 3300005289 Bacteria 5446
19 Ga0065704_10096981 3300005289 Bacteria 2414
20 Ga0065704_10354006 3300005289 Bacteria 803
21 Ga0065707_10087470 3300005295 Bacteria 5011
22 Ga0065707_10127396 3300005295 Bacteria 1985
23 Ga0070658_10115022 3300005327 Bacteria 2231
24 Ga0070658_10344302 3300005327 Bacteria 1275
25 Ga0070658_10493254 3300005327 Bacteria 1057
26 Ga0070658_11140656 3300005327 Bacteria 678
27 Ga0070683_100353228 3300005329 Bacteria 1400
28 Ga0070683_100412874 3300005329 Bacteria 1287
29 Ga0070670_100173018 3300005331 Bacteria 1873
30 Ga0070666_10044153 3300005335 Bacteria 2985
31 Ga0070680_100308684 3300005336 Bacteria 1342
32 Ga0070680_100698408 3300005336 Bacteria 873
33 Ga0070682_100208484 3300005337 Bacteria 1383
34 Ga0068868_100390048 3300005338 Bacteria 1200
35 Ga0070660_100112385 3300005339 Bacteria 2168
36 Ga0070660_101260039 3300005339 Bacteria 627
37 Ga0070661_101166144 3300005344 Bacteria 643
38 Ga0070661_101351553 3300005344 Bacteria 598
39 Ga0070668_100003911 3300005347 Bacteria 11002
40 Ga0070669_100000291 3300005353 Bacteria 39339
41 Ga0070675_100173272 3300005354 Bacteria 1862
42 Ga0070675_101081563 3300005354 Bacteria 737
43 Ga0070671_100008960 3300005355 Bacteria 8029
44 Ga0070674_100139041 3300005356 Bacteria 1820
45 Ga0070674_101421836 3300005356 Bacteria 621
46 Ga0070673_100366565 3300005364 Bacteria 1282
47 Ga0070659_100256040 3300005366 Bacteria 1451
48 Ga0070667_100000160 3300005367 Bacteria 83754
49 Ga0070667_100032565 3300005367 Bacteria 4348
50 Ga0070667_100040302 3300005367 Bacteria 3916
51 Ga0070663_100060112 3300005455 Bacteria 2732
52 Ga0070663_100108502 3300005455 Bacteria 2082
53 Ga0070678_100010458 3300005456 Bacteria 5672
54 Ga0070678_100968776 3300005456 Bacteria 780
55 Ga0070662_100138316 3300005457 Bacteria 1885
56 Ga0070662_100275707 3300005457 Bacteria 1359
57 Ga0070681_11978357 3300005458 Bacteria 511
58 Ga0068867_101572688 3300005459 Bacteria 614
59 Ga0070679_100011790 3300005530 Bacteria 8336
60 Ga0070679_100344407 3300005530 Bacteria 1438
61 Ga0070684_100273878 3300005535 Bacteria 1545
62 Ga0068853_100394131 3300005539 Bacteria 1295
63 Ga0068853_101528070 3300005539 Bacteria 646
64 Ga0068853_101528072 3300005539 Bacteria 646
65 Ga0070672_100059310 3300005543 Bacteria 3011
66 Ga0070665_100000043 3300005548 Bacteria 279774
67 Ga0070665_100000101 3300005548 Bacteria 159353
68 Ga0070665_100487153 3300005548 Bacteria 1244
69 Ga0068855_100006162 3300005563 Bacteria 14623
70 Ga0068855_100081316 3300005563 Bacteria 3755
71 Ga0068855_100410923 3300005563 Bacteria 1482
72 Ga0070664_100063592 3300005564 Bacteria 3146
73 Ga0068854_100567632 3300005578 Bacteria 965
74 Ga0068856_100587493 3300005614 Bacteria 1135
75 Ga0068859_100374321 3300005617 Bacteria 1520
76 Ga0068861_100380239 3300005719 Bacteria 1247
77 Ga0068863_100002604 3300005841 Bacteria 17894
78 Ga0068863_100002810 3300005841 Bacteria 17249
79 Ga0068863_100009722 3300005841 Bacteria 9382
80 Ga0068863_100504545 3300005841 Bacteria 1191
81 Ga0068858_100000268 3300005842 Bacteria 55747
82 Ga0068858_100493346 3300005842 Bacteria 1183
83 Ga0068860_100000391 3300005843 Bacteria 57332
84 Ga0068860_100005319 3300005843 Bacteria 13065
85 Ga0068860_100026953 3300005843 Bacteria 5538
86 Ga0068860_100119982 3300005843 Bacteria 2518
87 Ga0068862_100000014 3300005844 Bacteria 251552
88 Ga0068862_100003464 3300005844 Bacteria 13574
89 Ga0068862_100016320 3300005844 Bacteria 6180
90 Ga0075364_10120042 3300006051 Bacteria 1759
91 Ga0075369_10024851 3300006186 Bacteria 2486
92 Ga0075366_10010488 3300006195 Bacteria 5202
93 Ga0075366_10042391 3300006195 Bacteria 2694
94 Ga0075370_10052406 3300006353 Bacteria 2315
95 Ga0075370_10088043 3300006353 Bacteria 1790
96 Ga0075370_10262824 3300006353 Bacteria 1024
97 Ga0075370_10276185 3300006353 Bacteria 998
98 Ga0068871_100071010 3300006358 Bacteria 2863
99 Ga0068871_100764105 3300006358 Bacteria 889
100 Ga0068871_100911523 3300006358 Bacteria 815
101 Ga0097620_100374327 3300006931 Bacteria 1520
102 Ga0105251_10002929 3300009011 Bacteria 12791
103 Ga0105240_10694268 3300009093 Bacteria 1111
104 Ga0111539_10629860 3300009094 Bacteria 1249
105 Ga0105247_10003692 3300009101 Bacteria 9932
106 Ga0105247_10120076 3300009101 Bacteria 1702
107 Ga0105243_10000490 3300009148 Bacteria 40402
108 Ga0105243_10153893 3300009148 Bacteria 1976
109 Ga0105241_10006458 3300009174 Bacteria 8643
110 Ga0105242_10270646 3300009176 Bacteria 1539
111 Ga0105248_10008523 3300009177 Bacteria 11256
112 Ga0105248_10058985 3300009177 Bacteria 4310
113 Ga0105238_11166236 3300009551 Bacteria 794
114 Ga0105238_11623525 3300009551 Bacteria 677
115 Ga0105249_10000002 3300009553 Bacteria 376207
116 Ga0105249_10796404 3300009553 Bacteria 1009
117 Ga0105239_10916673 3300010375 Bacteria 1006
118 Ga0105239_11364549 3300010375 Bacteria 818
119 Ga0157317_1000725 3300012475 Bacteria 1557
120 Ga0157322_1001092 3300012490 Bacteria 1256
121 Ga0157324_1000358 3300012506 Bacteria 2128
122 Ga0157373_10093369 3300013100 Bacteria 2119
123 Ga0157373_10616178 3300013100 Bacteria 791
124 Ga0157371_10000062 3300013102 Bacteria 169669
125 Ga0157371_10004989 3300013102 Bacteria 11391
126 Ga0157374_10140228 3300013296 Bacteria 2346
127 Ga0157374_10291430 3300013296 Bacteria 1613
128 Ga0157378_10053691 3300013297 Bacteria 3588
129 Ga0157378_10397892 3300013297 Bacteria 1356
130 Ga0163162_10010851 3300013306 Bacteria 8866
131 Ga0163162_10526298 3300013306 Bacteria 1311
132 Ga0157372_10777420 3300013307 Bacteria 1113
133 Ga0157372_11137252 3300013307 Bacteria 903
134 Ga0157375_10207573 3300013308 Bacteria 2115
135 Ga0157375_10347151 3300013308 Bacteria 1650
136 Ga0157375_10750854 3300013308 Bacteria 1127
137 Ga0182008_10145521 3300014497 Bacteria 1187
138 Ga0163161_10000412 3300017792 Bacteria 35877
139 Ga0163161_10375372 3300017792 Bacteria 1135
140 Ga0163161_10528656 3300017792 Bacteria 964
141 Ga0209674_106760 3300025226 Bacteria 1518
142 Ga0209563_100070 3300025230 Bacteria 249779
143 Ga0209437_101640 3300025233 Bacteria 5077
144 Ga0209646_1011574 3300025246 Bacteria 1364
145 Ga0209026_1028903 3300025250 Bacteria 827
146 Ga0209677_113751 3300025253 Bacteria 1136
147 Ga0209148_1000008 3300025254 Bacteria 1504371
148 Ga0209233_1000044 3300025261 Bacteria 489783
149 Ga0209233_1043429 3300025261 Bacteria 958
150 Ga0209455_1000002 3300025272 Bacteria 1505459
151 Ga0209758_1000007 3300025297 Bacteria 1270410
152 Ga0209050_1000474 3300025298 Bacteria 71192
153 Ga0207697_10003663 3300025315 Bacteria 7527
154 Ga0207697_10284046 3300025315 Bacteria 733
155 Ga0207656_10000493 3300025321 Bacteria 13053
156 Ga0207656_10309286 3300025321 Bacteria 783
157 Ga0207713_1002253 3300025735 Bacteria 14260
158 Ga0207713_1213056 3300025735 Bacteria 586
159 Ga0207710_10001762 3300025900 Bacteria 10446
160 Ga0207710_10138215 3300025900 Bacteria 1175
161 Ga0207680_10026602 3300025903 Bacteria 3209
162 Ga0207680_10046766 3300025903 Bacteria 2560
163 Ga0207647_10051131 3300025904 Bacteria 2556
164 Ga0207645_10160453 3300025907 Bacteria 1471
165 Ga0207705_10005418 3300025909 Bacteria 9545
166 Ga0207705_10512586 3300025909 Bacteria 932
167 Ga0207654_10000226 3300025911 Bacteria 34521
168 Ga0207695_10016920 3300025913 Bacteria 8508
169 Ga0207695_10752028 3300025913 Bacteria 855
170 Ga0207671_10032982 3300025914 Bacteria 3855
171 Ga0207657_10009722 3300025919 Bacteria 9644
172 Ga0207657_10014245 3300025919 Bacteria 7773
173 Ga0207649_10331065 3300025920 Bacteria 1122
174 Ga0207652_10003649 3300025921 Bacteria 12670
175 Ga0207652_10200669 3300025921 Bacteria 1795
176 Ga0207652_10513611 3300025921 Bacteria 1078
177 Ga0207652_10694071 3300025921 Bacteria 908
178 Ga0207681_10000224 3300025923 Bacteria 44695
179 Ga0207694_10027016 3300025924 Bacteria 4369
180 Ga0207650_10031979 3300025925 Bacteria 3804
181 Ga0207659_10188098 3300025926 Bacteria 1641
182 Ga0207644_10001440 3300025931 Bacteria 15329
183 Ga0207644_10239258 3300025931 Bacteria 1445
184 Ga0207644_10523829 3300025931 Bacteria 979
185 Ga0207690_10003226 3300025932 Bacteria 9791
186 Ga0207706_10055156 3300025933 Bacteria 3505
187 Ga0207709_10000005 3300025935 Bacteria 806813
188 Ga0207709_10146344 3300025935 Bacteria 1631
189 Ga0207669_10005383 3300025937 Bacteria 5738
190 Ga0207704_10328294 3300025938 Bacteria 1183
191 Ga0207691_10044642 3300025940 Bacteria 4078
192 Ga0207711_10003775 3300025941 Bacteria 13046
193 Ga0207711_10004284 3300025941 Bacteria 12191
194 Ga0207689_10197142 3300025942 Bacteria 1662
195 Ga0207661_10066915 3300025944 Bacteria 2920
196 Ga0207661_10234616 3300025944 Bacteria 1626
197 Ga0207661_10442599 3300025944 Bacteria 1183
198 Ga0207679_10025050 3300025945 Bacteria 4098
199 Ga0207679_11527712 3300025945 Bacteria 612
200 Ga0207667_10000001 3300025949 Bacteria 1178522
201 Ga0207667_10003313 3300025949 Bacteria 19874
202 Ga0207667_10009832 3300025949 Bacteria 11240
203 Ga0207667_10013321 3300025949 Bacteria 9419
204 Ga0207667_10042273 3300025949 Bacteria 4846
205 Ga0207667_10583047 3300025949 Bacteria 1129
206 Ga0207651_10406266 3300025960 Bacteria 1159
207 Ga0207712_10000002 3300025961 Bacteria 706628
208 Ga0207668_10072863 3300025972 Bacteria 2459
209 Ga0207668_10128226 3300025972 Bacteria 1933
210 Ga0207640_10002461 3300025981 Bacteria 9912
211 Ga0207658_10018107 3300025986 Bacteria 4859
212 Ga0207658_10019519 3300025986 Bacteria 4688
213 Ga0207703_10000139 3300026035 Bacteria 86495
214 Ga0207703_10435678 3300026035 Bacteria 1222
215 Ga0207639_10007127 3300026041 Bacteria 7620
216 Ga0207639_10899083 3300026041 Bacteria 827
217 Ga0207678_10007090 3300026067 Bacteria 9943
218 Ga0207678_10326448 3300026067 Bacteria 1321
219 Ga0207702_10000862 3300026078 Bacteria 31638
220 Ga0207702_10822697 3300026078 Bacteria 919
221 Ga0207702_11513470 3300026078 Bacteria 664
222 Ga0207641_10002819 3300026088 Bacteria 15805
223 Ga0207641_10005119 3300026088 Bacteria 11229
224 Ga0207641_10013915 3300026088 Bacteria 6598
225 Ga0207648_10273058 3300026089 Bacteria 1511
226 Ga0207648_10383670 3300026089 Bacteria 1271
227 Ga0207676_10000072 3300026095 Bacteria 101978
228 Ga0207674_10013140 3300026116 Bacteria 9215
229 Ga0207683_10002482 3300026121 Bacteria 16096
230 Ga0207698_10001942 3300026142 Bacteria 12137
231 Ga0207698_10043646 3300026142 Bacteria 3361
232 Ga0207698_10190895 3300026142 Bacteria 1824
233 Ga0207698_10410299 3300026142 Bacteria 1297
234 Ga0207698_11362089 3300026142 Bacteria 724
235 Ga0268266_10000002 3300028379 Bacteria 3059047
236 Ga0268266_10001320 3300028379 Bacteria 30084
237 Ga0268266_10036274 3300028379 Bacteria 4196
238 Ga0268265_10000607 3300028380 Bacteria 35893
239 Ga0268265_10018601 3300028380 Bacteria 4818
240 Ga0268265_10049324 3300028380 Bacteria 3165
241 Ga0268264_10000439 3300028381 Bacteria 57339
242 Ga0268264_10021472 3300028381 Bacteria 5272
243 Ga0268264_10098556 3300028381 Bacteria 2535
244 Ga0307517_10012984 3300028786 Bacteria 11362
245 Ga0307517_10052987 3300028786 Bacteria 4051
246 Ga0307513_10023461 3300031456 Bacteria 7206
247 Ga0307508_10000011 3300031616 Bacteria 248001
248 Ga0307508_10010338 3300031616 Bacteria 8539
249 Ga0307405_10223686 3300031731 Bacteria 1383
250 Ga0307405_10446058 3300031731 Bacteria 1025
251 Ga0307405_11460829 3300031731 Bacteria 599
252 Ga0316577_10370708 3300031733 Bacteria 813
253 Ga0307413_10386026 3300031824 Bacteria 1093
254 Ga0307413_10451062 3300031824 Bacteria 1021
255 Ga0307410_10013400 3300031852 Bacteria 4782
256 Ga0307410_10384942 3300031852 Bacteria 1129
257 Ga0307410_10390960 3300031852 Bacteria 1121
258 Ga0307410_10891126 3300031852 Bacteria 762
259 Ga0307407_10180521 3300031903 Bacteria 1399
260 Ga0307407_10423181 3300031903 Bacteria 960
261 Ga0307412_10753051 3300031911 Bacteria 841
262 Ga0307409_100317909 3300031995 Bacteria 1456
263 Ga0307409_101354516 3300031995 Bacteria 737
264 Ga0307416_100888552 3300032002 Bacteria 990
265 Ga0307414_10173296 3300032004 Bacteria 1727
266 Ga0307414_10264601 3300032004 Bacteria 1437
267 Ga0307414_10363389 3300032004 Bacteria 1246
268 Ga0307411_11306473 3300032005 Bacteria 661
269 Ga0307415_100045047 3300032126 Bacteria 2955
270 Ga0307415_100702921 3300032126 Bacteria 912
271 Ga0307415_102096070 3300032126 Bacteria 552
272 Ga0373937_1210912 3300036401 Bacteria 704
273 Ga0316582_0174952 3300036647 Bacteria 1459
274 Ga0316584_0474518 3300036712 Bacteria 882
275 Ga0237819_00201 3300038705 Bacteria 21739
276 Ga0436363_0336953 3300039450 Bacteria 1550
277 Ga0436363_1438919 3300039450 Bacteria 1177
278 Ga0451791_0028024 3300041451 Bacteria 788
279 Ga0451793_1433991 3300041452 Bacteria 961
280 Ga0451797_1466777 3300041453 Bacteria 612
281 Ga0451807_2168953 3300041486 Bacteria 809
282 Ga0451845_0243401 3300041501 Bacteria 858
283 Ga0451843_0793070 3300041509 Bacteria 1566
284 Ga0451853_0111108 3300041512 Bacteria 816
285 Ga0451853_3724323 3300041512 Bacteria 1452
286 Ga0450912_001246 3300042116 Bacteria 1511
287 Ga0495627_000198 3300046453 Bacteria 65997
288 Ga0495591_151908 3300046458 Bacteria 556
289 Ga0495629_0020819 3300046459 Bacteria 4682
290 Ga0495638_0000402 3300046460 Bacteria 52910
291 Ga0495638_0048347 3300046460 Bacteria 2663
292 Ga0495638_0241497 3300046460 Bacteria 1000
293 Ga0495650_0000995 3300046471 Bacteria 32148
294 Ga0495650_0003812 3300046471 Bacteria 10726
295 Ga0495650_0012193 3300046471 Bacteria 4641
296 Ga0495605_0278005 3300046474 Bacteria 712
297 Ga0495584_0226929 3300046491 Bacteria 949
298 Ga0495584_0368856 3300046491 Bacteria 729
299 Ga0495585_0019768 3300046492 Bacteria 3879
300 Ga0495585_0229613 3300046492 Bacteria 933
301 Ga0495585_0346172 3300046492 Bacteria 723
302 Ga0495596_0000119 3300046500 Bacteria 54166
303 Ga0495596_0001077 3300046500 Bacteria 16192
304 Ga0495596_0089098 3300046500 Bacteria 1197
305 Ga0495607_0007039 3300046501 Bacteria 7821
306 Ga0495583_0001362 3300046506 Bacteria 25203
307 Ga0495583_0047393 3300046506 Bacteria 1977
308 Ga0495583_0051520 3300046506 Bacteria 1876
309 Ga0495583_0301015 3300046506 Bacteria 637
310 Ga0495606_0024329 3300046507 Bacteria 4367
311 Ga0495606_0073295 3300046507 Bacteria 2149
312 Ga0495606_0245693 3300046507 Bacteria 995
313 Ga0495610_0000050 3300046512 Bacteria 143781
314 Ga0495610_0000352 3300046512 Bacteria 48332
315 Ga0495616_0149799 3300046513 Bacteria 1056
316 Ga0495616_0184745 3300046513 Bacteria 924
317 Ga0495618_0361568 3300046514 Bacteria 893
318 Ga0495620_0062035 3300046515 Bacteria 1553
319 Ga0495620_0120039 3300046515 Bacteria 1036
320 Ga0495631_0063795 3300046518 Bacteria 1595
321 Ga0495632_0003354 3300046519 Bacteria 11413
322 Ga0495632_0179518 3300046519 Bacteria 970
323 Ga0495637_0012078 3300046520 Bacteria 4138
324 Ga0495643_0000036 3300046522 Bacteria 238374
325 Ga0495643_0001994 3300046522 Bacteria 17059
326 Ga0495643_0022436 3300046522 Bacteria 3602
327 Ga0495643_0033021 3300046522 Bacteria 2867
328 Ga0495643_0072255 3300046522 Bacteria 1809
329 Ga0495643_0083313 3300046522 Bacteria 1660
330 Ga0495643_0115543 3300046522 Bacteria 1360
331 Ga0495648_0000323 3300046524 Bacteria 53106
332 Ga0495648_0025497 3300046524 Bacteria 4001
333 Ga0495642_0011218 3300046528 Bacteria 3437
334 Ga0495654_0041823 3300046530 Bacteria 2278
335 Ga0495587_0040230 3300046536 Bacteria 2795
336 Ga0495598_0199991 3300046537 Bacteria 721
337 Ga0495609_0104292 3300046538 Bacteria 1227
338 Ga0495621_0063681 3300046539 Bacteria 1344
339 Ga0495597_0321693 3300046542 Bacteria 597
340 Ga0495622_0012236 3300046557 Bacteria 3968
341 Ga0495633_0000494 3300046558 Bacteria 39797
342 Ga0495633_0219317 3300046558 Bacteria 871
343 Ga0495668_0000059 3300046616 Bacteria 194951
344 Ga0495668_0043761 3300046616 Bacteria 2489
345 Ga0495668_0127023 3300046616 Bacteria 1396
346 Ga0495668_0223312 3300046616 Bacteria 1031
347 Ga0495611_0035018 3300046648 Bacteria 2222
348 Ga0495611_0051772 3300046648 Bacteria 1851
349 Ga0495625_0000094 3300046660 Bacteria 144517
350 Ga0495625_0000559 3300046660 Bacteria 54547
351 Ga0495625_0009358 3300046660 Bacteria 8205
352 Ga0495625_0014033 3300046660 Bacteria 6413
353 Ga0495625_0020359 3300046660 Bacteria 5124
354 Ga0495625_0093589 3300046660 Bacteria 2074
355 Ga0495625_0132373 3300046660 Bacteria 1688
356 Ga0495625_0378770 3300046660 Bacteria 888
357 Ga0495625_0418036 3300046660 Bacteria 834
358 Ga0495661_0478385 3300046665 Bacteria 596
359 Ga0495669_0000628 3300046684 Bacteria 15338
360 Ga0495649_0033503 3300046694 Bacteria 2827
361 Ga0495649_0518434 3300046694 Bacteria 592
362 Ga0495600_0006647 3300046809 Bacteria 7044
363 Ga0495660_0069442 3300046810 Bacteria 1873
364 Ga0495660_0081624 3300046810 Bacteria 1695
365 Ga0495683_0047147 3300047323 Bacteria 2162
366 Ga0495683_0069502 3300047323 Bacteria 1730
367 Ga0495683_0209024 3300047323 Bacteria 876
368 Ga0495687_000152 3300047443 Bacteria 105602
369 Ga0495687_000517 3300047443 Bacteria 46300
370 Ga0495677_0009651 3300047445 Bacteria 3559
371 Ga0495673_0161517 3300047469 Bacteria 860
372 Ga0495681_0000095 3300047470 Bacteria 76975
373 Ga0495681_0006423 3300047470 Bacteria 7729
374 Ga0495686_0000209 3300047472 Bacteria 108972
375 Ga0495602_0723244 3300048088 Bacteria 674
376 Ga0495615_0000158 3300048090 Bacteria 17114
377 Ga0495615_0241067 3300048090 Bacteria 570
378 Ga0495626_0001951 3300048091 Bacteria 15322
379 Ga0496101_0491946 3300048904 Bacteria 969
380 Ga0496102_0000184 3300048905 Bacteria 84568
381 Ga0496102_0342370 3300048905 Bacteria 1408
382 Ga0496103_0000099 3300048906 Bacteria 94046
383 Ga0496103_0017222 3300048906 Bacteria 4322
384 Ga0496104_0002902 3300048907 Bacteria 14768
385 Ga0496105_0000589 3300048908 Bacteria 24200
386 Ga0496107_0291255 3300048910 Bacteria 1215
387 Ga0496110_0080817 3300048913 Bacteria 2897
388 Ga0496111_0186285 3300048914 Bacteria 1543
389 Ga0496112_1127883 3300048915 Bacteria 702
390 Ga0496114_0016017 3300048917 Bacteria 6032
391 Ga0496115_0000066 3300048918 Bacteria 95550
392 Ga0496115_0181455 3300048918 Bacteria 1740
393 Ga0496116_0000149 3300048919 Bacteria 141841
394 Ga0496116_0043247 3300048919 Bacteria 3071
395 Ga0496117_0001024 3300048920 Bacteria 42696
396 Ga0496117_0030030 3300048920 Bacteria 4178
397 Ga0496117_0030608 3300048920 Bacteria 4126
398 Ga0496117_0233595 3300048920 Bacteria 1014
399 Ga0496118_0000154 3300048921 Bacteria 122224
400 Ga0496118_0048068 3300048921 Bacteria 3301
401 Ga0496118_0104709 3300048921 Bacteria 1898
402 Ga0496118_0156379 3300048921 Bacteria 1417
403 Ga0496120_0047121 3300048923 Bacteria 2487
404 Ga0496121_0001202 3300048924 Bacteria 45329
405 Ga0496121_0001791 3300048924 Bacteria 34731
406 Ga0496121_0010925 3300048924 Bacteria 10142
407 Ga0496121_0041460 3300048924 Bacteria 4021
408 Ga0496121_0067475 3300048924 Bacteria 2899
409 Ga0496122_0022271 3300048925 Bacteria 5638
410 Ga0496122_0024680 3300048925 Bacteria 5254
411 Ga0496122_0030169 3300048925 Bacteria 4552
412 Ga0496122_0400696 3300048925 Bacteria 697
413 Ga0496123_0000830 3300048926 Bacteria 49505
414 Ga0496123_0004529 3300048926 Bacteria 14518
415 Ga0496123_0029886 3300048926 Bacteria 4000
416 Ga0496123_0270907 3300048926 Bacteria 826
417 Ga0496124_0000291 3300048927 Bacteria 94493
418 Ga0496125_0001248 3300048928 Bacteria 37996
419 Ga0496125_0005390 3300048928 Bacteria 14262
420 Ga0496125_0135000 3300048928 Bacteria 1728
421 Ga0496126_0000261 3300048929 Bacteria 112027
422 Ga0496126_0001079 3300048929 Bacteria 45863
423 Ga0496126_0031715 3300048929 Bacteria 4987
424 Ga0496126_0440969 3300048929 Bacteria 1050
425 Ga0501031_0177007 3300049568 Bacteria 1394
426 Ga0501031_0788236 3300049568 Bacteria 609
427 Ga0501034_0400153 3300049571 Bacteria 1296
428 Ga0501034_0525617 3300049571 Bacteria 1095
429 Ga0501047_0429983 3300049581 Bacteria 1151
430 Ga0501068_0627616 3300049584 Bacteria 701
431 Ga0501224_023206 3300049664 Bacteria 926
432 Ga0501249_029935 3300049679 Bacteria 1211
433 Ga0501035_0373195 3300049822 Bacteria 1191
434 Ga0501035_0400646 3300049822 Bacteria 1142
435 Ga0501044_0180055 3300049823 Bacteria 2081
436 Ga0501044_0345744 3300049823 Bacteria 1408
437 Ga0501044_0363471 3300049823 Bacteria 1365
438 nmdc:mga00v17_264886_c1 3300050491 Bacteria 1115
439 nmdc:mga0k408_16895_c1 3300050493 Bacteria 4057
440 nmdc:mga0k408_48360_c1 3300050493 Bacteria 2460
441 nmdc:mga07m45_102559_c1 3300050496 Bacteria 1643
442 nmdc:mga07m45_188490_c1 3300050496 Bacteria 1199
443 nmdc:mga0sz30_122486_c1 3300050516 Bacteria 1143
444 Ga0500610_0000101 3300053079 Bacteria 25651
445 Ga0500643_007856 3300053087 Bacteria 4250
446 Ga0500643_022722 3300053087 Bacteria 2014
447 Ga0500643_089899 3300053087 Bacteria 838
448 Ga0500643_104014 3300053087 Bacteria 769
449 Ga0500641_0055237 3300053096 Bacteria 1644
450 Ga0500556_0000408 3300053104 Bacteria 31362
451 Ga0500557_242410 3300053105 Bacteria 566
452 Ga0500562_007402 3300053108 Bacteria 2769
453 Ga0500562_027196 3300053108 Bacteria 1500
454 Ga0500595_005603 3300053119 Bacteria 5463
455 Ga0500595_020151 3300053119 Bacteria 2406
456 Ga0500607_265958 3300053121 Bacteria 667
457 Ga0500642_0000001 3300053130 Bacteria 1468402
458 Ga0500642_0000830 3300053130 Bacteria 9013
459 Ga0500658_0000535 3300053134 Bacteria 16034
460 Ga0500559_0004938 3300053136 Bacteria 6202
461 Ga0500559_0018207 3300053136 Bacteria 2968
462 Ga0500559_0187241 3300053136 Bacteria 975
463 Ga0500564_074493 3300053138 Bacteria 1528
464 Ga0500568_0094160 3300053139 Bacteria 1128
465 Ga0500573_0002159 3300053140 Bacteria 9711
466 Ga0500604_0076539 3300053151 Bacteria 1075
467 Ga0500604_0088729 3300053151 Bacteria 1008
468 Ga0500616_0001672 3300053153 Bacteria 20446
469 Ga0500616_0085091 3300053153 Bacteria 1580
470 Ga0500636_0009480 3300053177 Bacteria 5660
471 Ga0500596_008713 3300053735 Bacteria 1610
472 Ga0500601_051674 3300053737 Bacteria 512
473 Ga0500661_015542 3300055283 Bacteria 1365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041453 Ga0451797_1466777 Ga0451797_1466777_230_601 123
2 3300046507 Ga0495606_0245693 Ga0495606_0245693_11_382 123
3 3300006353 Ga0075370_10262824 Ga0075370_102628242 134
4 3300031852 Ga0307410_10384942 Ga0307410_103849421 134
5 3300032002 Ga0307416_100888552 Ga0307416_1008885522 134
6 3300032004 Ga0307414_10173296 Ga0307414_101732962 134
7 3300032004 Ga0307414_10363389 Ga0307414_103633892 134
8 3300032126 Ga0307415_100045047 Ga0307415_1000450472 134
9 3300003791 Ga0055530_10012841 Ga0055530_100128413 135
10 3300025298 Ga0209050_1000474 Ga0209050_100047442 135
11 3300031731 Ga0307405_10223686 Ga0307405_102236862 136
12 3300031852 Ga0307410_10013400 Ga0307410_100134002 136
13 3300031903 Ga0307407_10423181 Ga0307407_104231812 136
14 3300031995 Ga0307409_100317909 Ga0307409_1003179092 136
15 3300005339 Ga0070660_101260039 Ga0070660_1012600391 137
16 iso_pu_bacteria 2818991438 2819551075 137
17 iso_pu_bacteria 2896253425 2896253491 137
18 iso_pu_bacteria 3000865235 3000867416 137
19 3300036647 Ga0316582_0174952 Ga0316582_0174952_790_1242 139
20 3300025944 Ga0207661_10442599 Ga0207661_104425992 140
21 3300046453 Ga0495627_000198 Ga0495627_000198_15697_16137 140
22 3300046471 Ga0495650_0003812 Ga0495650_0003812_8958_9398 140
23 3300046506 Ga0495583_0301015 Ga0495583_0301015_92_532 140
24 3300046512 Ga0495610_0000050 Ga0495610_0000050_111418_111858 140
25 3300046513 Ga0495616_0149799 Ga0495616_0149799_572_1012 140
26 3300046515 Ga0495620_0062035 Ga0495620_0062035_1081_1521 140
27 3300046515 Ga0495620_0120039 Ga0495620_0120039_33_473 140
28 3300046519 Ga0495632_0003354 Ga0495632_0003354_2183_2623 140
29 3300046530 Ga0495654_0041823 Ga0495654_0041823_1540_1980 140
30 3300047323 Ga0495683_0209024 Ga0495683_0209024_304_744 140
31 3300047470 Ga0495681_0000095 Ga0495681_0000095_15719_16159 140
32 3300048090 Ga0495615_0000158 Ga0495615_0000158_14616_15056 140
33 3300048925 Ga0496122_0030169 Ga0496122_0030169_3332_3772 140
34 3300048926 Ga0496123_0000830 Ga0496123_0000830_33559_33999 140
35 3300048929 Ga0496126_0440969 Ga0496126_0440969_474_914 140
36 3300053121 Ga0500607_265958 Ga0500607_265958_167_607 140
37 3300053138 Ga0500564_074493 Ga0500564_074493_413_850 140
38 3300005289 Ga0065704_10075725 Ga0065704_100757253 141
39 3300005327 Ga0070658_10344302 Ga0070658_103443022 141
40 3300005327 Ga0070658_10493254 Ga0070658_104932541 141
41 3300005329 Ga0070683_100412874 Ga0070683_1004128742 141
42 3300005331 Ga0070670_100173018 Ga0070670_1001730182 141
43 3300005335 Ga0070666_10044153 Ga0070666_100441533 141
44 3300005336 Ga0070680_100308684 Ga0070680_1003086842 141
45 3300005336 Ga0070680_100698408 Ga0070680_1006984082 141
46 3300005339 Ga0070660_100112385 Ga0070660_1001123853 141
47 3300005347 Ga0070668_100003911 Ga0070668_1000039116 141
48 3300005353 Ga0070669_100000291 Ga0070669_1000002916 141
49 3300005354 Ga0070675_101081563 Ga0070675_1010815631 141
50 3300005355 Ga0070671_100008960 Ga0070671_1000089605 141
51 3300005367 Ga0070667_100032565 Ga0070667_1000325652 141
52 3300005455 Ga0070663_100060112 Ga0070663_1000601122 141
53 3300005457 Ga0070662_100138316 Ga0070662_1001383162 141
54 3300005458 Ga0070681_11978357 Ga0070681_119783571 141
55 3300005459 Ga0068867_101572688 Ga0068867_1015726881 141
56 3300005530 Ga0070679_100011790 Ga0070679_1000117907 141
57 3300005530 Ga0070679_100344407 Ga0070679_1003444072 141
58 3300005548 Ga0070665_100000101 Ga0070665_10000010198 141
59 3300005563 Ga0068855_100006162 Ga0068855_1000061623 141
60 3300005563 Ga0068855_100410923 Ga0068855_1004109232 141
61 3300005614 Ga0068856_100587493 Ga0068856_1005874932 141
62 3300005841 Ga0068863_100002604 Ga0068863_10000260423 141
63 3300005842 Ga0068858_100493346 Ga0068858_1004933462 141
64 3300005843 Ga0068860_100005319 Ga0068860_1000053194 141
65 3300005844 Ga0068862_100016320 Ga0068862_1000163206 141
66 3300006195 Ga0075366_10010488 Ga0075366_100104884 141
67 3300006358 Ga0068871_100764105 Ga0068871_1007641052 141
68 3300017792 Ga0163161_10000412 Ga0163161_100004128 141
69 3300017792 Ga0163161_10375372 Ga0163161_103753722 141
70 3300025315 Ga0207697_10284046 Ga0207697_102840462 141
71 3300025735 Ga0207713_1002253 Ga0207713_100225313 141
72 3300025900 Ga0207710_10138215 Ga0207710_101382152 141
73 3300025903 Ga0207680_10026602 Ga0207680_100266023 141
74 3300025913 Ga0207695_10752028 Ga0207695_107520282 141
75 3300025919 Ga0207657_10014245 Ga0207657_100142452 141
76 3300025920 Ga0207649_10331065 Ga0207649_103310651 141
77 3300025921 Ga0207652_10003649 Ga0207652_100036492 141
78 3300025921 Ga0207652_10200669 Ga0207652_102006692 141
79 3300025921 Ga0207652_10513611 Ga0207652_105136112 141
80 3300025921 Ga0207652_10694071 Ga0207652_106940712 141
81 3300025923 Ga0207681_10000224 Ga0207681_1000022441 141
82 3300025931 Ga0207644_10001440 Ga0207644_1000144010 141
83 3300025933 Ga0207706_10055156 Ga0207706_100551563 141
84 3300025941 Ga0207711_10004284 Ga0207711_100042842 141
85 3300025944 Ga0207661_10066915 Ga0207661_100669152 141
86 3300025949 Ga0207667_10003313 Ga0207667_1000331312 141
87 3300025949 Ga0207667_10013321 Ga0207667_100133218 141
88 3300025972 Ga0207668_10072863 Ga0207668_100728631 141
89 3300026035 Ga0207703_10435678 Ga0207703_104356781 141
90 3300026078 Ga0207702_10822697 Ga0207702_108226972 141
91 3300026088 Ga0207641_10013915 Ga0207641_100139154 141
92 3300026089 Ga0207648_10383670 Ga0207648_103836702 141
93 3300028379 Ga0268266_10001320 Ga0268266_100013205 141
94 3300028380 Ga0268265_10049324 Ga0268265_100493243 141
95 3300031731 Ga0307405_11460829 Ga0307405_114608291 141
96 3300031733 Ga0316577_10370708 Ga0316577_103707082 141
97 3300031852 Ga0307410_10891126 Ga0307410_108911261 141
98 3300032005 Ga0307411_11306473 Ga0307411_113064731 141
99 3300048919 Ga0496116_0000149 Ga0496116_0000149_58207_58650 141
100 3300048920 Ga0496117_0233595 Ga0496117_0233595_71_514 141
101 3300048921 Ga0496118_0048068 Ga0496118_0048068_2337_2780 141
102 3300048924 Ga0496121_0001791 Ga0496121_0001791_14661_15104 141
103 3300048925 Ga0496122_0022271 Ga0496122_0022271_380_823 141
104 3300048926 Ga0496123_0004529 Ga0496123_0004529_13148_13591 141
105 3300048928 Ga0496125_0005390 Ga0496125_0005390_5461_5904 141
106 3300048929 Ga0496126_0000261 Ga0496126_0000261_82893_83336 141
107 3300049822 Ga0501035_0400646 Ga0501035_0400646_704_1129 141
108 3300050493 nmdc:mga0k408_16895_c1 nmdc:mga0k408_16895_c1_2637_3062 141
109 iso_pu_bacteria 8054302542 8054304008 142
110 iso_pu_bacteria 2510917021 2511129833 143
111 iso_pu_bacteria 2848297114 2848297989 143
112 iso_pu_bacteria 2895880812 2895881042 143
113 iso_pu_bacteria 2919138771 2919138896 143
114 3300005539 Ga0068853_100394131 Ga0068853_1003941313 144
115 3300025321 Ga0207656_10309286 Ga0207656_103092862 144
116 3300001904 JGI24736J21556_1006117 JGI24736J21556_10061172 145
117 3300001915 JGI24741J21665_1006068 JGI24741J21665_10060682 145
118 3300001989 JGI24739J22299_10060341 JGI24739J22299_100603412 145
119 3300001990 JGI24737J22298_10002929 JGI24737J22298_100029291 145
120 3300001990 JGI24737J22298_10169909 JGI24737J22298_101699091 145
121 3300002077 JGI24744J21845_10012848 JGI24744J21845_100128482 145
122 3300003215 JGI25153J46596_10001130 JGI25153J46596_1000113020 145
123 3300003759 Ga0055525_1000118 Ga0055525_100011863 145
124 3300003762 Ga0055542_1000076 Ga0055542_100007632 145
125 3300003763 Ga0055529_1000004 Ga0055529_1000004112 145
126 3300005289 Ga0065704_10354006 Ga0065704_103540062 145
127 3300005327 Ga0070658_10115022 Ga0070658_101150221 145
128 3300005329 Ga0070683_100353228 Ga0070683_1003532282 145
129 3300005338 Ga0068868_100390048 Ga0068868_1003900482 145
130 3300005344 Ga0070661_101166144 Ga0070661_1011661441 145
131 3300005344 Ga0070661_101351553 Ga0070661_1013515531 145
132 3300005354 Ga0070675_100173272 Ga0070675_1001732722 145
133 3300005356 Ga0070674_100139041 Ga0070674_1001390412 145
134 3300005356 Ga0070674_101421836 Ga0070674_1014218361 145
135 3300005364 Ga0070673_100366565 Ga0070673_1003665652 145
136 3300005366 Ga0070659_100256040 Ga0070659_1002560402 145
137 3300005367 Ga0070667_100040302 Ga0070667_1000403024 145
138 3300005455 Ga0070663_100108502 Ga0070663_1001085023 145
139 3300005456 Ga0070678_100010458 Ga0070678_1000104582 145
140 3300005456 Ga0070678_100968776 Ga0070678_1009687761 145
141 3300005457 Ga0070662_100275707 Ga0070662_1002757072 145
142 3300005535 Ga0070684_100273878 Ga0070684_1002738782 145
143 3300005539 Ga0068853_101528070 Ga0068853_1015280701 145
144 3300005539 Ga0068853_101528072 Ga0068853_1015280721 145
145 3300005543 Ga0070672_100059310 Ga0070672_1000593103 145
146 3300005548 Ga0070665_100000043 Ga0070665_100000043277 145
147 3300005564 Ga0070664_100063592 Ga0070664_1000635923 145
148 3300005841 Ga0068863_100504545 Ga0068863_1005045452 145
149 3300006186 Ga0075369_10024851 Ga0075369_100248512 145
150 3300006195 Ga0075366_10042391 Ga0075366_100423912 145
151 3300006353 Ga0075370_10276185 Ga0075370_102761852 145
152 3300006358 Ga0068871_100071010 Ga0068871_1000710103 145
153 3300009148 Ga0105243_10000490 Ga0105243_1000049019 145
154 3300009174 Ga0105241_10006458 Ga0105241_1000645813 145
155 3300012475 Ga0157317_1000725 Ga0157317_10007252 145
156 3300012506 Ga0157324_1000358 Ga0157324_10003582 145
157 3300013102 Ga0157371_10000062 Ga0157371_1000006281 145
158 3300013296 Ga0157374_10140228 Ga0157374_101402282 145
159 3300013297 Ga0157378_10053691 Ga0157378_100536912 145
160 3300025226 Ga0209674_106760 Ga0209674_1067602 145
161 3300025230 Ga0209563_100070 Ga0209563_10007060 145
162 3300025246 Ga0209646_1011574 Ga0209646_10115742 145
163 3300025250 Ga0209026_1028903 Ga0209026_10289032 145
164 3300025253 Ga0209677_113751 Ga0209677_1137512 145
165 3300025254 Ga0209148_1000008 Ga0209148_1000008604 145
166 3300025261 Ga0209233_1043429 Ga0209233_10434292 145
167 3300025272 Ga0209455_1000002 Ga0209455_1000002820 145
168 3300025297 Ga0209758_1000007 Ga0209758_1000007721 145
169 3300025321 Ga0207656_10000493 Ga0207656_100004932 145
170 3300025904 Ga0207647_10051131 Ga0207647_100511312 145
171 3300025907 Ga0207645_10160453 Ga0207645_101604532 145
172 3300025909 Ga0207705_10005418 Ga0207705_100054182 145
173 3300025911 Ga0207654_10000226 Ga0207654_1000022613 145
174 3300025913 Ga0207695_10016920 Ga0207695_100169202 145
175 3300025914 Ga0207671_10032982 Ga0207671_100329823 145
176 3300025919 Ga0207657_10009722 Ga0207657_100097222 145
177 3300025924 Ga0207694_10027016 Ga0207694_100270164 145
178 3300025925 Ga0207650_10031979 Ga0207650_100319792 145
179 3300025926 Ga0207659_10188098 Ga0207659_101880982 145
180 3300025931 Ga0207644_10239258 Ga0207644_102392582 145
181 3300025932 Ga0207690_10003226 Ga0207690_100032262 145
182 3300025935 Ga0207709_10000005 Ga0207709_10000005579 145
183 3300025937 Ga0207669_10005383 Ga0207669_100053837 145
184 3300025938 Ga0207704_10328294 Ga0207704_103282942 145
185 3300025940 Ga0207691_10044642 Ga0207691_100446425 145
186 3300025944 Ga0207661_10234616 Ga0207661_102346162 145
187 3300025945 Ga0207679_10025050 Ga0207679_100250502 145
188 3300025949 Ga0207667_10000001 Ga0207667_100000011098 145
189 3300025949 Ga0207667_10009832 Ga0207667_1000983211 145
190 3300025960 Ga0207651_10406266 Ga0207651_104062662 145
191 3300025972 Ga0207668_10128226 Ga0207668_101282262 145
192 3300025981 Ga0207640_10002461 Ga0207640_100024612 145
193 3300025986 Ga0207658_10018107 Ga0207658_100181073 145
194 3300026041 Ga0207639_10007127 Ga0207639_100071277 145
195 3300026067 Ga0207678_10007090 Ga0207678_1000709013 145
196 3300026078 Ga0207702_10000862 Ga0207702_1000086215 145
197 3300026089 Ga0207648_10273058 Ga0207648_102730582 145
198 3300026116 Ga0207674_10013140 Ga0207674_100131402 145
199 3300026121 Ga0207683_10002482 Ga0207683_100024827 145
200 3300026142 Ga0207698_10001942 Ga0207698_1000194215 145
201 3300028379 Ga0268266_10000002 Ga0268266_10000002315 145
202 3300028379 Ga0268266_10036274 Ga0268266_100362745 145
203 3300028786 Ga0307517_10012984 Ga0307517_1001298411 145
204 3300028786 Ga0307517_10052987 Ga0307517_100529872 145
205 3300031911 Ga0307412_10753051 Ga0307412_107530511 145
206 3300041452 Ga0451793_1433991 Ga0451793_1433991_89_526 145
207 3300046471 Ga0495650_0012193 Ga0495650_0012193_417_854 145
208 3300046491 Ga0495584_0226929 Ga0495584_0226929_280_717 145
209 3300046491 Ga0495584_0368856 Ga0495584_0368856_232_669 145
210 3300046492 Ga0495585_0019768 Ga0495585_0019768_2967_3404 145
211 3300046518 Ga0495631_0063795 Ga0495631_0063795_524_961 145
212 3300046519 Ga0495632_0179518 Ga0495632_0179518_349_786 145
213 3300046520 Ga0495637_0012078 Ga0495637_0012078_35_472 145
214 3300046524 Ga0495648_0025497 Ga0495648_0025497_3312_3749 145
215 3300046528 Ga0495642_0011218 Ga0495642_0011218_688_1125 145
216 3300046660 Ga0495625_0000559 Ga0495625_0000559_44291_44728 145
217 3300046660 Ga0495625_0418036 Ga0495625_0418036_300_737 145
218 3300047443 Ga0495687_000152 Ga0495687_000152_91408_91845 145
219 3300047445 Ga0495677_0009651 Ga0495677_0009651_826_1263 145
220 3300053079 Ga0500610_0000101 Ga0500610_0000101_977_1414 145
221 3300053087 Ga0500643_104014 Ga0500643_104014_179_616 145
222 3300053130 Ga0500642_0000830 Ga0500642_0000830_321_758 145
223 2162886007 SwRhRL2b_contig_2977751 SwRhRL2b_0978.00001120 146
224 3300005288 Ga0065714_10079710 Ga0065714_100797102 146
225 3300005367 Ga0070667_100000160 Ga0070667_10000016050 146
226 3300005578 Ga0068854_100567632 Ga0068854_1005676322 146
227 3300005719 Ga0068861_100380239 Ga0068861_1003802392 146
228 3300005841 Ga0068863_100009722 Ga0068863_10000972213 146
229 3300005842 Ga0068858_100000268 Ga0068858_10000026812 146
230 3300005843 Ga0068860_100026953 Ga0068860_1000269533 146
231 3300005844 Ga0068862_100003464 Ga0068862_10000346412 146
232 3300006051 Ga0075364_10120042 Ga0075364_101200422 146
233 3300006353 Ga0075370_10088043 Ga0075370_100880432 146
234 3300009011 Ga0105251_10002929 Ga0105251_100029296 146
235 3300009101 Ga0105247_10120076 Ga0105247_101200762 146
236 3300009148 Ga0105243_10153893 Ga0105243_101538932 146
237 3300009176 Ga0105242_10270646 Ga0105242_102706462 146
238 3300009177 Ga0105248_10008523 Ga0105248_1000852310 146
239 3300009177 Ga0105248_10058985 Ga0105248_100589852 146
240 3300009551 Ga0105238_11166236 Ga0105238_111662361 146
241 3300009553 Ga0105249_10796404 Ga0105249_107964041 146
242 3300010375 Ga0105239_11364549 Ga0105239_113645492 146
243 3300012490 Ga0157322_1001092 Ga0157322_10010922 146
244 3300013100 Ga0157373_10093369 Ga0157373_100933693 146
245 3300013102 Ga0157371_10004989 Ga0157371_100049892 146
246 3300013297 Ga0157378_10397892 Ga0157378_103978922 146
247 3300013306 Ga0163162_10010851 Ga0163162_100108512 146
248 3300013306 Ga0163162_10526298 Ga0163162_105262982 146
249 3300013307 Ga0157372_10777420 Ga0157372_107774202 146
250 3300013308 Ga0157375_10750854 Ga0157375_107508542 146
251 3300014497 Ga0182008_10145521 Ga0182008_101455212 146
252 3300017792 Ga0163161_10528656 Ga0163161_105286561 146
253 3300025233 Ga0209437_101640 Ga0209437_1016407 146
254 3300025261 Ga0209233_1000044 Ga0209233_1000044391 146
255 3300025315 Ga0207697_10003663 Ga0207697_100036639 146
256 3300025735 Ga0207713_1213056 Ga0207713_12130561 146
257 3300025909 Ga0207705_10512586 Ga0207705_105125862 146
258 3300025931 Ga0207644_10523829 Ga0207644_105238292 146
259 3300025935 Ga0207709_10146344 Ga0207709_101463442 146
260 3300025941 Ga0207711_10003775 Ga0207711_1000377514 146
261 3300025942 Ga0207689_10197142 Ga0207689_101971422 146
262 3300025949 Ga0207667_10583047 Ga0207667_105830472 146
263 3300025986 Ga0207658_10019519 Ga0207658_100195194 146
264 3300026035 Ga0207703_10000139 Ga0207703_1000013940 146
265 3300026041 Ga0207639_10899083 Ga0207639_108990832 146
266 3300026088 Ga0207641_10002819 Ga0207641_100028199 146
267 3300026095 Ga0207676_10000072 Ga0207676_1000007286 146
268 3300026142 Ga0207698_10410299 Ga0207698_104102992 146
269 3300028380 Ga0268265_10018601 Ga0268265_100186015 146
270 3300028381 Ga0268264_10021472 Ga0268264_100214723 146
271 3300031616 Ga0307508_10000011 Ga0307508_100000112 146
272 3300031824 Ga0307413_10386026 Ga0307413_103860261 146
273 3300032004 Ga0307414_10264601 Ga0307414_102646012 146
274 3300039450 Ga0436363_0336953 Ga0436363_0336953_1062_1502 146
275 3300041451 Ga0451791_0028024 Ga0451791_0028024_238_690 146
276 3300041509 Ga0451843_0793070 Ga0451843_0793070_694_1134 146
277 3300046459 Ga0495629_0020819 Ga0495629_0020819_2947_3387 146
278 3300046460 Ga0495638_0000402 Ga0495638_0000402_51793_52245 146
279 3300046460 Ga0495638_0241497 Ga0495638_0241497_339_779 146
280 3300046471 Ga0495650_0000995 Ga0495650_0000995_17138_17578 146
281 3300046492 Ga0495585_0229613 Ga0495585_0229613_124_564 146
282 3300046500 Ga0495596_0089098 Ga0495596_0089098_25_465 146
283 3300046506 Ga0495583_0001362 Ga0495583_0001362_24025_24465 146
284 3300046506 Ga0495583_0047393 Ga0495583_0047393_393_833 146
285 3300046506 Ga0495583_0051520 Ga0495583_0051520_45_485 146
286 3300046513 Ga0495616_0184745 Ga0495616_0184745_134_586 146
287 3300046514 Ga0495618_0361568 Ga0495618_0361568_24_464 146
288 3300046522 Ga0495643_0001994 Ga0495643_0001994_9689_10129 146
289 3300046522 Ga0495643_0072255 Ga0495643_0072255_419_859 146
290 3300046522 Ga0495643_0083313 Ga0495643_0083313_1173_1613 146
291 3300046522 Ga0495643_0115543 Ga0495643_0115543_810_1250 146
292 3300046524 Ga0495648_0000323 Ga0495648_0000323_28535_28975 146
293 3300046536 Ga0495587_0040230 Ga0495587_0040230_502_942 146
294 3300046538 Ga0495609_0104292 Ga0495609_0104292_30_470 146
295 3300046542 Ga0495597_0321693 Ga0495597_0321693_71_523 146
296 3300046557 Ga0495622_0012236 Ga0495622_0012236_668_1108 146
297 3300046558 Ga0495633_0000494 Ga0495633_0000494_614_1054 146
298 3300046616 Ga0495668_0000059 Ga0495668_0000059_147463_147903 146
299 3300046648 Ga0495611_0035018 Ga0495611_0035018_1242_1682 146
300 3300046648 Ga0495611_0051772 Ga0495611_0051772_1144_1584 146
301 3300046660 Ga0495625_0000094 Ga0495625_0000094_96128_96580 146
302 3300046660 Ga0495625_0009358 Ga0495625_0009358_803_1243 146
303 3300046660 Ga0495625_0093589 Ga0495625_0093589_1111_1551 146
304 3300046660 Ga0495625_0132373 Ga0495625_0132373_746_1198 146
305 3300046660 Ga0495625_0378770 Ga0495625_0378770_382_822 146
306 3300046684 Ga0495669_0000628 Ga0495669_0000628_521_961 146
307 3300046694 Ga0495649_0033503 Ga0495649_0033503_599_1039 146
308 3300046694 Ga0495649_0518434 Ga0495649_0518434_115_558 146
309 3300046809 Ga0495600_0006647 Ga0495600_0006647_1450_1890 146
310 3300046810 Ga0495660_0069442 Ga0495660_0069442_800_1240 146
311 3300046810 Ga0495660_0081624 Ga0495660_0081624_760_1200 146
312 3300047323 Ga0495683_0047147 Ga0495683_0047147_500_940 146
313 3300047323 Ga0495683_0069502 Ga0495683_0069502_1174_1614 146
314 3300047443 Ga0495687_000517 Ga0495687_000517_720_1160 146
315 3300047469 Ga0495673_0161517 Ga0495673_0161517_176_616 146
316 3300047470 Ga0495681_0006423 Ga0495681_0006423_676_1116 146
317 3300047472 Ga0495686_0000209 Ga0495686_0000209_48322_48762 146
318 3300048088 Ga0495602_0723244 Ga0495602_0723244_177_617 146
319 3300048090 Ga0495615_0241067 Ga0495615_0241067_99_539 146
320 3300048904 Ga0496101_0491946 Ga0496101_0491946_444_884 146
321 3300048905 Ga0496102_0000184 Ga0496102_0000184_82571_83011 146
322 3300048905 Ga0496102_0342370 Ga0496102_0342370_511_951 146
323 3300048906 Ga0496103_0000099 Ga0496103_0000099_890_1330 146
324 3300048906 Ga0496103_0017222 Ga0496103_0017222_823_1263 146
325 3300048907 Ga0496104_0002902 Ga0496104_0002902_515_955 146
326 3300048908 Ga0496105_0000589 Ga0496105_0000589_22970_23410 146
327 3300048910 Ga0496107_0291255 Ga0496107_0291255_389_829 146
328 3300048913 Ga0496110_0080817 Ga0496110_0080817_488_928 146
329 3300048914 Ga0496111_0186285 Ga0496111_0186285_563_1003 146
330 3300048915 Ga0496112_1127883 Ga0496112_1127883_200_640 146
331 3300048917 Ga0496114_0016017 Ga0496114_0016017_5026_5466 146
332 3300048918 Ga0496115_0000066 Ga0496115_0000066_92672_93112 146
333 3300048918 Ga0496115_0181455 Ga0496115_0181455_445_897 146
334 3300048919 Ga0496116_0043247 Ga0496116_0043247_2154_2594 146
335 3300048920 Ga0496117_0001024 Ga0496117_0001024_1220_1660 146
336 3300048920 Ga0496117_0030030 Ga0496117_0030030_307_747 146
337 3300048921 Ga0496118_0000154 Ga0496118_0000154_77779_78219 146
338 3300048921 Ga0496118_0156379 Ga0496118_0156379_674_1114 146
339 3300048923 Ga0496120_0047121 Ga0496120_0047121_1650_2090 146
340 3300048924 Ga0496121_0010925 Ga0496121_0010925_1516_1956 146
341 3300048924 Ga0496121_0041460 Ga0496121_0041460_2404_2844 146
342 3300048924 Ga0496121_0067475 Ga0496121_0067475_1790_2257 146
343 3300048925 Ga0496122_0024680 Ga0496122_0024680_4447_4887 146
344 3300048925 Ga0496122_0400696 Ga0496122_0400696_34_474 146
345 3300048926 Ga0496123_0029886 Ga0496123_0029886_33_473 146
346 3300048926 Ga0496123_0270907 Ga0496123_0270907_182_622 146
347 3300048927 Ga0496124_0000291 Ga0496124_0000291_92470_92910 146
348 3300048928 Ga0496125_0001248 Ga0496125_0001248_36322_36762 146
349 3300048928 Ga0496125_0135000 Ga0496125_0135000_923_1363 146
350 3300048929 Ga0496126_0001079 Ga0496126_0001079_43976_44416 146
351 3300048929 Ga0496126_0031715 Ga0496126_0031715_3485_3925 146
352 3300050491 nmdc:mga00v17_264886_c1 nmdc:mga00v17_264886_c1_370_810 146
353 3300050493 nmdc:mga0k408_48360_c1 nmdc:mga0k408_48360_c1_1550_1990 146
354 3300050496 nmdc:mga07m45_102559_c1 nmdc:mga07m45_102559_c1_565_1005 146
355 3300050516 nmdc:mga0sz30_122486_c1 nmdc:mga0sz30_122486_c1_160_600 146
356 3300053096 Ga0500641_0055237 Ga0500641_0055237_741_1193 146
357 3300053119 Ga0500595_005603 Ga0500595_005603_3564_4004 146
358 3300053119 Ga0500595_020151 Ga0500595_020151_557_1009 146
359 3300053134 Ga0500658_0000535 Ga0500658_0000535_825_1277 146
360 3300053136 Ga0500559_0004938 Ga0500559_0004938_420_872 146
361 3300053136 Ga0500559_0018207 Ga0500559_0018207_601_1053 146
362 3300053136 Ga0500559_0187241 Ga0500559_0187241_178_630 146
363 3300053139 Ga0500568_0094160 Ga0500568_0094160_600_1052 146
364 3300053151 Ga0500604_0076539 Ga0500604_0076539_115_567 146
365 3300053153 Ga0500616_0085091 Ga0500616_0085091_313_765 146
366 3300053177 Ga0500636_0009480 Ga0500636_0009480_4728_5168 146
367 3300053735 Ga0500596_008713 Ga0500596_008713_503_943 146
368 3300053737 Ga0500601_051674 Ga0500601_051674_41_493 146
369 3300055283 Ga0500661_015542 Ga0500661_015542_574_1014 146
370 2162886007 SwRhRL2b_contig_2092787 SwRhRL2b_0537.00005820 147
371 2162886007 SwRhRL2b_contig_780398 SwRhRL2b_0866.00007250 147
372 3300002239 JGI24034J26672_10063430 JGI24034J26672_100634302 147
373 3300005289 Ga0065704_10070157 Ga0065704_1007015787 147
374 3300005289 Ga0065704_10096981 Ga0065704_100969813 147
375 3300005295 Ga0065707_10087470 Ga0065707_100874703 147
376 3300005295 Ga0065707_10127396 Ga0065707_101273962 147
377 3300005327 Ga0070658_11140656 Ga0070658_111406561 147
378 3300005337 Ga0070682_100208484 Ga0070682_1002084842 147
379 3300005548 Ga0070665_100487153 Ga0070665_1004871532 147
380 3300005563 Ga0068855_100081316 Ga0068855_1000813162 147
381 3300005617 Ga0068859_100374321 Ga0068859_1003743211 147
382 3300005841 Ga0068863_100002810 Ga0068863_10000281023 147
383 3300005843 Ga0068860_100000391 Ga0068860_10000039133 147
384 3300005843 Ga0068860_100119982 Ga0068860_1001199822 147
385 3300005844 Ga0068862_100000014 Ga0068862_100000014130 147
386 3300006353 Ga0075370_10052406 Ga0075370_100524062 147
387 3300006358 Ga0068871_100911523 Ga0068871_1009115232 147
388 3300006931 Ga0097620_100374327 Ga0097620_1003743271 147
389 3300009093 Ga0105240_10694268 Ga0105240_106942682 147
390 3300009094 Ga0111539_10629860 Ga0111539_106298601 147
391 3300009101 Ga0105247_10003692 Ga0105247_100036929 147
392 3300009551 Ga0105238_11623525 Ga0105238_116235251 147
393 3300009553 Ga0105249_10000002 Ga0105249_10000002268 147
394 3300010375 Ga0105239_10916673 Ga0105239_109166732 147
395 3300013100 Ga0157373_10616178 Ga0157373_106161781 147
396 3300013296 Ga0157374_10291430 Ga0157374_102914302 147
397 3300013307 Ga0157372_11137252 Ga0157372_111372521 147
398 3300013308 Ga0157375_10207573 Ga0157375_102075732 147
399 3300013308 Ga0157375_10347151 Ga0157375_103471512 147
400 3300025900 Ga0207710_10001762 Ga0207710_100017624 147
401 3300025903 Ga0207680_10046766 Ga0207680_100467664 147
402 3300025945 Ga0207679_11527712 Ga0207679_115277121 147
403 3300025949 Ga0207667_10042273 Ga0207667_100422734 147
404 3300025961 Ga0207712_10000002 Ga0207712_10000002639 147
405 3300026067 Ga0207678_10326448 Ga0207678_103264482 147
406 3300026078 Ga0207702_11513470 Ga0207702_115134701 147
407 3300026088 Ga0207641_10005119 Ga0207641_1000511910 147
408 3300026142 Ga0207698_10043646 Ga0207698_100436463 147
409 3300026142 Ga0207698_10190895 Ga0207698_101908952 147
410 3300026142 Ga0207698_11362089 Ga0207698_113620891 147
411 3300028380 Ga0268265_10000607 Ga0268265_100006072 147
412 3300028381 Ga0268264_10000439 Ga0268264_1000043956 147
413 3300028381 Ga0268264_10098556 Ga0268264_100985563 147
414 3300031456 Ga0307513_10023461 Ga0307513_100234618 147
415 3300031616 Ga0307508_10010338 Ga0307508_100103385 147
416 3300031731 Ga0307405_10446058 Ga0307405_104460582 147
417 3300031824 Ga0307413_10451062 Ga0307413_104510622 147
418 3300031852 Ga0307410_10390960 Ga0307410_103909602 147
419 3300031903 Ga0307407_10180521 Ga0307407_101805211 147
420 3300031995 Ga0307409_101354516 Ga0307409_1013545162 147
421 3300032126 Ga0307415_100702921 Ga0307415_1007029212 147
422 3300032126 Ga0307415_102096070 Ga0307415_1020960701 147
423 3300036401 Ga0373937_1210912 Ga0373937_1210912_176_619 147
424 3300036712 Ga0316584_0474518 Ga0316584_0474518_19_462 147
425 3300038705 Ga0237819_00201 Ga0237819_00201_720_1172 147
426 3300039450 Ga0436363_1438919 Ga0436363_1438919_128_583 147
427 3300041486 Ga0451807_2168953 Ga0451807_2168953_215_658 147
428 3300041501 Ga0451845_0243401 Ga0451845_0243401_110_553 147
429 3300041512 Ga0451853_0111108 Ga0451853_0111108_313_756 147
430 3300041512 Ga0451853_3724323 Ga0451853_3724323_620_1063 147
431 3300042116 Ga0450912_001246 Ga0450912_001246_21_464 147
432 3300046458 Ga0495591_151908 Ga0495591_151908_13_456 147
433 3300046460 Ga0495638_0048347 Ga0495638_0048347_1722_2183 147
434 3300046474 Ga0495605_0278005 Ga0495605_0278005_158_601 147
435 3300046492 Ga0495585_0346172 Ga0495585_0346172_103_546 147
436 3300046500 Ga0495596_0000119 Ga0495596_0000119_50851_51294 147
437 3300046500 Ga0495596_0001077 Ga0495596_0001077_1051_1494 147
438 3300046501 Ga0495607_0007039 Ga0495607_0007039_5983_6426 147
439 3300046507 Ga0495606_0024329 Ga0495606_0024329_2209_2652 147
440 3300046507 Ga0495606_0073295 Ga0495606_0073295_388_831 147
441 3300046512 Ga0495610_0000352 Ga0495610_0000352_45242_45685 147
442 3300046522 Ga0495643_0000036 Ga0495643_0000036_133287_133730 147
443 3300046522 Ga0495643_0022436 Ga0495643_0022436_597_1040 147
444 3300046522 Ga0495643_0033021 Ga0495643_0033021_1146_1589 147
445 3300046537 Ga0495598_0199991 Ga0495598_0199991_177_620 147
446 3300046539 Ga0495621_0063681 Ga0495621_0063681_647_1090 147
447 3300046558 Ga0495633_0219317 Ga0495633_0219317_152_595 147
448 3300046616 Ga0495668_0043761 Ga0495668_0043761_1267_1728 147
449 3300046616 Ga0495668_0127023 Ga0495668_0127023_43_486 147
450 3300046616 Ga0495668_0223312 Ga0495668_0223312_57_518 147
451 3300046660 Ga0495625_0014033 Ga0495625_0014033_3201_3644 147
452 3300046660 Ga0495625_0020359 Ga0495625_0020359_3098_3559 147
453 3300046665 Ga0495661_0478385 Ga0495661_0478385_124_567 147
454 3300048091 Ga0495626_0001951 Ga0495626_0001951_5778_6221 147
455 3300048920 Ga0496117_0030608 Ga0496117_0030608_2826_3293 147
456 3300048921 Ga0496118_0104709 Ga0496118_0104709_648_1115 147
457 3300048924 Ga0496121_0001202 Ga0496121_0001202_711_1166 147
458 3300049568 Ga0501031_0177007 Ga0501031_0177007_561_1004 147
459 3300049568 Ga0501031_0788236 Ga0501031_0788236_14_466 147
460 3300049571 Ga0501034_0400153 Ga0501034_0400153_753_1196 147
461 3300049571 Ga0501034_0525617 Ga0501034_0525617_509_952 147
462 3300049581 Ga0501047_0429983 Ga0501047_0429983_558_1001 147
463 3300049584 Ga0501068_0627616 Ga0501068_0627616_106_549 147
464 3300049664 Ga0501224_023206 Ga0501224_023206_399_842 147
465 3300049679 Ga0501249_029935 Ga0501249_029935_339_782 147
466 3300049822 Ga0501035_0373195 Ga0501035_0373195_408_851 147
467 3300049823 Ga0501044_0180055 Ga0501044_0180055_793_1236 147
468 3300049823 Ga0501044_0345744 Ga0501044_0345744_550_993 147
469 3300049823 Ga0501044_0363471 Ga0501044_0363471_559_1002 147
470 3300050496 nmdc:mga07m45_188490_c1 nmdc:mga07m45_188490_c1_18_461 147
471 3300053087 Ga0500643_007856 Ga0500643_007856_65_517 147
472 3300053087 Ga0500643_022722 Ga0500643_022722_1170_1631 147
473 3300053087 Ga0500643_089899 Ga0500643_089899_95_538 147
474 3300053104 Ga0500556_0000408 Ga0500556_0000408_28770_29231 147
475 3300053105 Ga0500557_242410 Ga0500557_242410_45_506 147
476 3300053108 Ga0500562_007402 Ga0500562_007402_388_849 147
477 3300053108 Ga0500562_027196 Ga0500562_027196_1024_1467 147
478 3300053130 Ga0500642_0000001 Ga0500642_0000001_453589_454050 147
479 3300053140 Ga0500573_0002159 Ga0500573_0002159_8491_8946 147
480 3300053151 Ga0500604_0088729 Ga0500604_0088729_398_841 147
481 3300053153 Ga0500616_0001672 Ga0500616_0001672_784_1227 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03653

UPF0093

Uncharacterised protein family (UPF0093)

4

146

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b87-assembly3.cif.gz_C crystal structure of transmembrane protein tmhc2_e 0.6334 3 111
7d5i-assembly1.cif.gz_A structure of mycobacterium smegmatis bd complex in the apo-form. 0.6326 9 139
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.5792 12 141
6b87-assembly3.cif.gz_C crystal structure of transmembrane protein tmhc2_e 0.5729 3 111
7d5i-assembly1.cif.gz_A structure of mycobacterium smegmatis bd complex in the apo-form. 0.5722 9 139
ID Description Score Start End Superfamily
af_Q8IBV4_136_271_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7642 7 84 3.30.40.10
af_Q59QL0_312_444_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6824 7 84 3.30.40.10
af_Q3EC11_359_492_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6702 5 84 1.10.287.70
af_A0A1D6P3W0_402_535_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6567 5 84 1.10.287.70
af_Q7JZW7_1_97_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.6346 1 108 1.20.5.110
ID Description Score Start End GO Terms
AF-A0A0M3TB39-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 1.001 8 147 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-Q2GC55-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9983 8 147 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A1I5KWE7-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.9968 8 147 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A2L0A566-F1-model_v4 Protoporphyrinogen IX oxidase (PPO) (EC 1.3.99.-) 0.996 9 147 GO:0005886
GO:0006782
GO:0046872
GO:0070818
AF-A0A7C5IUV1-F1-model_v4 Protoporphyrinogen IX oxidase 0.9958 11 74 GO:0005886
GO:0006782
GO:0016491
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.63 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map