F452350

General Info

Members Datasets Scaffolds Average Seq Length
481 286 962 118

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10099007|Ga0065715_100990073
Length 138
Sequence VCHTVFVRQYMAHGSPFDPALFDNLRLELRRGCLTVAVLAALRSEQYGYTLRKVLAEHGLVVDEGTLYPLLRRLETQGLLVSEWREEGKRNKRFYRLSVEGQRMLTLLLVEWRSLDTALDDILAEAQHGTTGPIPASR

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
88 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
153 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
175 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
176 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
195 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
196 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
197 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0
Rhizoplane 4.37
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 23.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10099007 3300005293 Bacteria 3470
2 MBSR1b_contig_6681625 2162886012 Bacteria 1083
3 JGI25406J46586_10021694 3300003203 Bacteria 2572
4 Ga0065714_10460544 3300005288 Unclassified 547
5 Ga0065712_10020233 3300005290 Bacteria 2245
6 Ga0065715_10494408 3300005293 Unclassified 713
7 Ga0070658_10496561 3300005327 Unclassified 1054
8 Ga0070683_100001021 3300005329 Bacteria 21002
9 Ga0070683_100104655 3300005329 Bacteria 2667
10 Ga0070683_100585023 3300005329 Bacteria 1068
11 Ga0070670_100023852 3300005331 Bacteria 5264
12 Ga0070677_10111713 3300005333 Bacteria 1221
13 Ga0068869_100022363 3300005334 Unclassified 4356
14 Ga0068868_100158124 3300005338 Bacteria 1870
15 Ga0068868_100179261 3300005338 Bacteria 1757
16 Ga0070661_100512619 3300005344 Bacteria 961
17 Ga0070661_100643254 3300005344 Bacteria 860
18 Ga0070692_10424199 3300005345 Unclassified 845
19 Ga0070669_101081510 3300005353 Bacteria 690
20 Ga0070675_100132871 3300005354 Bacteria 2122
21 Ga0070675_100326099 3300005354 Bacteria 1357
22 Ga0070671_100324765 3300005355 Bacteria 1312
23 Ga0070674_100267671 3300005356 Bacteria 1349
24 Ga0070674_100778865 3300005356 Bacteria 824
25 Ga0070688_100637587 3300005365 Bacteria 819
26 Ga0070667_100452736 3300005367 Bacteria 1173
27 Ga0070709_10505013 3300005434 Bacteria 919
28 Ga0070709_11279146 3300005434 Unclassified 591
29 Ga0070714_101295597 3300005435 Bacteria 711
30 Ga0070713_100378431 3300005436 Unclassified 1318
31 Ga0070710_10213256 3300005437 Bacteria 1225
32 Ga0070711_100444811 3300005439 Unclassified 1060
33 Ga0070711_100702737 3300005439 Bacteria 851
34 Ga0070705_100136590 3300005440 Bacteria 1607
35 Ga0070700_100120067 3300005441 Bacteria 1760
36 Ga0070700_100657348 3300005441 Bacteria 828
37 Ga0070700_101417844 3300005441 Unclassified 588
38 Ga0070694_100230392 3300005444 Bacteria 1393
39 Ga0070708_102085923 3300005445 Unclassified 524
40 Ga0070663_100476874 3300005455 Bacteria 1032
41 Ga0070678_100908305 3300005456 Unclassified 805
42 Ga0070678_101791941 3300005456 Bacteria 579
43 Ga0070678_102199177 3300005456 Bacteria 523
44 Ga0070662_100380395 3300005457 Bacteria 1162
45 Ga0070681_10135383 3300005458 Bacteria 2394
46 Ga0070681_10197229 3300005458 Bacteria 1932
47 Ga0070681_11652214 3300005458 Unclassified 566
48 Ga0068867_100475776 3300005459 Bacteria 1069
49 Ga0068867_101226726 3300005459 Bacteria 690
50 Ga0070698_100356759 3300005471 Unclassified 1394
51 Ga0070698_100611769 3300005471 Unclassified 1030
52 Ga0070699_100004508 3300005518 Bacteria 12322
53 Ga0070679_100053449 3300005530 Bacteria 4021
54 Ga0070679_100127741 3300005530 Unclassified 2524
55 Ga0070679_100362868 3300005530 Bacteria 1396
56 Ga0070684_100506022 3300005535 Bacteria 1119
57 Ga0070684_101000346 3300005535 Bacteria 785
58 Ga0070684_101014889 3300005535 Bacteria 779
59 Ga0068853_100428273 3300005539 Bacteria 1242
60 Ga0068853_100760272 3300005539 Unclassified 926
61 Ga0070672_100017440 3300005543 Bacteria 5168
62 Ga0070672_100456681 3300005543 Bacteria 1101
63 Ga0070672_100806997 3300005543 Bacteria 826
64 Ga0070686_100464662 3300005544 Bacteria 975
65 Ga0070695_100455619 3300005545 Bacteria 981
66 Ga0070665_100282602 3300005548 Bacteria 1661
67 Ga0070704_100501467 3300005549 Bacteria 1053
68 Ga0070704_100537476 3300005549 Bacteria 1020
69 Ga0070704_100565444 3300005549 Unclassified 995
70 Ga0070704_101196612 3300005549 Bacteria 693
71 Ga0068855_100762627 3300005563 Bacteria 1031
72 Ga0068855_100766338 3300005563 Bacteria 1028
73 Ga0068855_100801288 3300005563 Unclassified 1001
74 Ga0070664_100083674 3300005564 Bacteria 2753
75 Ga0070664_100305511 3300005564 Bacteria 1438
76 Ga0068857_100247897 3300005577 Bacteria 1632
77 Ga0068854_100144630 3300005578 Bacteria 1828
78 Ga0068854_100587864 3300005578 Unclassified 949
79 Ga0068856_100002025 3300005614 Bacteria 21096
80 Ga0068856_100006849 3300005614 Bacteria 11145
81 Ga0068856_100209604 3300005614 Bacteria 1964
82 Ga0068856_100666179 3300005614 Bacteria 1061
83 Ga0068856_100954066 3300005614 Unclassified 876
84 Ga0068852_102199574 3300005616 Bacteria 573
85 Ga0068859_100143606 3300005617 Bacteria 2460
86 Ga0068859_101974777 3300005617 Bacteria 644
87 Ga0068864_100000446 3300005618 Bacteria 35741
88 Ga0068864_100380185 3300005618 Bacteria 1338
89 Ga0068866_10290138 3300005718 Unclassified 1017
90 Ga0068861_100256287 3300005719 Bacteria 1495
91 Ga0068861_100564438 3300005719 Bacteria 1039
92 Ga0068858_100509011 3300005842 Bacteria 1164
93 Ga0068860_100062541 3300005843 Bacteria 3537
94 Ga0068860_100199186 3300005843 Bacteria 1940
95 Ga0068862_100361406 3300005844 Bacteria 1349
96 Ga0068862_100501313 3300005844 Unclassified 1152
97 Ga0068862_100969854 3300005844 Bacteria 839
98 Ga0081539_10000373 3300005985 Bacteria 98166
99 Ga0070717_10030171 3300006028 Bacteria 4356
100 Ga0070716_100606930 3300006173 Unclassified 824
101 Ga0070712_100591687 3300006175 Unclassified 938
102 Ga0075366_11048125 3300006195 Bacteria 509
103 Ga0097621_100070131 3300006237 Bacteria 2894
104 Ga0097621_100454315 3300006237 Unclassified 1154
105 Ga0068871_100009327 3300006358 Bacteria 7104
106 Ga0068871_100155816 3300006358 Bacteria 1950
107 Ga0068871_100557720 3300006358 Bacteria 1038
108 Ga0068871_100577635 3300006358 Bacteria 1020
109 Ga0068871_100780988 3300006358 Unclassified 879
110 Ga0068871_100930730 3300006358 Bacteria 807
111 Ga0075428_100977389 3300006844 Bacteria 897
112 Ga0075430_100133230 3300006846 Bacteria 2071
113 Ga0075430_100562488 3300006846 Bacteria 940
114 Ga0075431_100053642 3300006847 Unclassified 4156
115 Ga0075431_102245849 3300006847 Unclassified 500
116 Ga0075434_100705605 3300006871 Bacteria 1026
117 Ga0068865_100269980 3300006881 Bacteria 1350
118 Ga0068865_101824172 3300006881 Bacteria 550
119 Ga0075436_100343441 3300006914 Bacteria 1075
120 Ga0097620_100143612 3300006931 Bacteria 2460
121 Ga0097620_101283188 3300006931 Bacteria 807
122 Ga0097620_101974869 3300006931 Bacteria 644
123 Ga0099794_10139718 3300007265 Unclassified 1226
124 Ga0099795_10053565 3300007788 Unclassified 1477
125 Ga0099795_10615457 3300007788 Bacteria 518
126 Ga0105240_10027505 3300009093 Bacteria 7444
127 Ga0105240_10165320 3300009093 Bacteria 2625
128 Ga0111539_10007761 3300009094 Bacteria 13702
129 Ga0111539_10137842 3300009094 Bacteria 2857
130 Ga0111539_11001032 3300009094 Bacteria 972
131 Ga0111539_13167572 3300009094 Bacteria 531
132 Ga0105247_10334738 3300009101 Bacteria 1060
133 Ga0114129_10007747 3300009147 Bacteria 15282
134 Ga0114129_11140321 3300009147 Bacteria 974
135 Ga0105243_10539368 3300009148 Bacteria 1113
136 Ga0105243_11393311 3300009148 Unclassified 721
137 Ga0105243_11455149 3300009148 Bacteria 707
138 Ga0105243_12486313 3300009148 Bacteria 557
139 Ga0105241_10015494 3300009174 Bacteria 5586
140 Ga0105241_10225819 3300009174 Unclassified 1576
141 Ga0105242_10259014 3300009176 Bacteria 1571
142 Ga0105248_10004932 3300009177 Bacteria 14743
143 Ga0105248_10030054 3300009177 Bacteria 6063
144 Ga0105248_10330798 3300009177 Bacteria 1716
145 Ga0105248_10604712 3300009177 Unclassified 1237
146 Ga0105237_10095020 3300009545 Bacteria 2970
147 Ga0105237_10367692 3300009545 Unclassified 1443
148 Ga0105238_10266480 3300009551 Bacteria 1693
149 Ga0105238_10329036 3300009551 Unclassified 1515
150 Ga0105238_10601977 3300009551 Bacteria 1107
151 Ga0105238_10907552 3300009551 Unclassified 900
152 Ga0105249_10001932 3300009553 Bacteria 17999
153 Ga0105249_10120412 3300009553 Bacteria 2493
154 Ga0105249_11141336 3300009553 Bacteria 850
155 Ga0099796_10070998 3300010159 Bacteria 1257
156 Ga0099796_10453123 3300010159 Bacteria 571
157 Ga0099796_10556965 3300010159 Unclassified 516
158 Ga0105239_10119641 3300010375 Bacteria 2923
159 Ga0105239_10137283 3300010375 Unclassified 2723
160 Ga0105239_10292290 3300010375 Bacteria 1835
161 Ga0105239_11179770 3300010375 Bacteria 882
162 Ga0105239_12014512 3300010375 Bacteria 670
163 Ga0105239_12769461 3300010375 Unclassified 572
164 Ga0105246_10202036 3300011119 Unclassified 1546
165 Ga0105246_10359428 3300011119 Bacteria 1196
166 Ga0105246_11248954 3300011119 Bacteria 686
167 Ga0157328_1003372 3300012478 Bacteria 831
168 Ga0157324_1046467 3300012506 Unclassified 550
169 Ga0157373_10034513 3300013100 Bacteria 3633
170 Ga0157373_10042014 3300013100 Unclassified 3269
171 Ga0157371_10294356 3300013102 Unclassified 1174
172 Ga0157370_10050789 3300013104 Bacteria 3962
173 Ga0157369_10031364 3300013105 Bacteria 5852
174 Ga0157369_10035330 3300013105 Bacteria 5482
175 Ga0157369_10151622 3300013105 Bacteria 2450
176 Ga0157369_10749319 3300013105 Bacteria 1005
177 Ga0157369_11929462 3300013105 Bacteria 599
178 Ga0157374_10001442 3300013296 Bacteria 20103
179 Ga0157374_10004514 3300013296 Bacteria 11698
180 Ga0157374_10070576 3300013296 Bacteria 3292
181 Ga0157374_10255572 3300013296 Bacteria 1725
182 Ga0157374_11579701 3300013296 Bacteria 680
183 Ga0157378_10000103 3300013297 Bacteria 80099
184 Ga0157378_10000405 3300013297 Bacteria 42598
185 Ga0157378_10001015 3300013297 Bacteria 25643
186 Ga0163162_10055840 3300013306 Bacteria 3977
187 Ga0163162_10323755 3300013306 Bacteria 1674
188 Ga0163162_10432960 3300013306 Bacteria 1447
189 Ga0163162_10595052 3300013306 Bacteria 1233
190 Ga0163162_10609342 3300013306 Bacteria 1218
191 Ga0157372_10005057 3300013307 Bacteria 14012
192 Ga0157372_10043267 3300013307 Bacteria 4985
193 Ga0157375_10550832 3300013308 Bacteria 1315
194 Ga0157375_10574600 3300013308 Unclassified 1288
195 Ga0163163_10191551 3300014325 Unclassified 2093
196 Ga0163163_10332887 3300014325 Bacteria 1573
197 Ga0163163_10358075 3300014325 Unclassified 1515
198 Ga0163163_11536784 3300014325 Bacteria 727
199 Ga0157380_10011102 3300014326 Bacteria 6496
200 Ga0157380_10035723 3300014326 Bacteria 3840
201 Ga0157380_10133006 3300014326 Bacteria 2125
202 Ga0157380_10334566 3300014326 Bacteria 1410
203 Ga0157380_10392123 3300014326 Bacteria 1314
204 Ga0157380_11879218 3300014326 Bacteria 659
205 Ga0157377_10915354 3300014745 Bacteria 657
206 Ga0157379_10304025 3300014968 Bacteria 1454
207 Ga0157379_10442803 3300014968 Bacteria 1198
208 Ga0157379_11339892 3300014968 Bacteria 692
209 Ga0157376_10021171 3300014969 Bacteria 5047
210 Ga0157376_10055403 3300014969 Bacteria 3308
211 Ga0157376_10867204 3300014969 Unclassified 919
212 Ga0157376_10921155 3300014969 Bacteria 893
213 Ga0209026_1036926 3300025250 Bacteria 714
214 Ga0207682_10002458 3300025893 Bacteria 8293
215 Ga0207688_10141584 3300025901 Bacteria 1416
216 Ga0207680_10432577 3300025903 Bacteria 933
217 Ga0207680_11254151 3300025903 Bacteria 528
218 Ga0207647_10056587 3300025904 Unclassified 2406
219 Ga0207647_10194002 3300025904 Bacteria 1176
220 Ga0207647_10496152 3300025904 Unclassified 681
221 Ga0207699_11411324 3300025906 Unclassified 515
222 Ga0207643_10086205 3300025908 Unclassified 1825
223 Ga0207654_10364575 3300025911 Bacteria 998
224 Ga0207654_10423401 3300025911 Unclassified 929
225 Ga0207707_10207236 3300025912 Bacteria 1708
226 Ga0207707_10819991 3300025912 Unclassified 774
227 Ga0207695_10448547 3300025913 Bacteria 1173
228 Ga0207671_10355403 3300025914 Unclassified 1162
229 Ga0207693_11287657 3300025915 Bacteria 547
230 Ga0207663_10303883 3300025916 Bacteria 1193
231 Ga0207660_10102377 3300025917 Bacteria 2141
232 Ga0207649_10706490 3300025920 Bacteria 782
233 Ga0207652_10060357 3300025921 Bacteria 3272
234 Ga0207652_10158700 3300025921 Bacteria 2027
235 Ga0207652_10321606 3300025921 Bacteria 1397
236 Ga0207681_10057760 3300025923 Bacteria 2653
237 Ga0207681_11015835 3300025923 Bacteria 696
238 Ga0207694_10909491 3300025924 Unclassified 744
239 Ga0207694_11033794 3300025924 Bacteria 695
240 Ga0207650_10029617 3300025925 Unclassified 3937
241 Ga0207659_10328691 3300025926 Bacteria 1263
242 Ga0207659_10622597 3300025926 Bacteria 921
243 Ga0207659_11457020 3300025926 Unclassified 586
244 Ga0207659_11645325 3300025926 Bacteria 547
245 Ga0207700_10170614 3300025928 Bacteria 1815
246 Ga0207700_10540817 3300025928 Bacteria 1033
247 Ga0207644_11707453 3300025931 Unclassified 527
248 Ga0207706_11107267 3300025933 Bacteria 661
249 Ga0207670_10244335 3300025936 Bacteria 1384
250 Ga0207669_10001561 3300025937 Bacteria 9768
251 Ga0207704_10042054 3300025938 Bacteria 2686
252 Ga0207704_10342942 3300025938 Bacteria 1160
253 Ga0207704_10434867 3300025938 Bacteria 1044
254 Ga0207704_10964110 3300025938 Bacteria 720
255 Ga0207665_10129355 3300025939 Bacteria 1791
256 Ga0207691_10244630 3300025940 Bacteria 1550
257 Ga0207691_11223976 3300025940 Bacteria 622
258 Ga0207711_10049884 3300025941 Bacteria 3583
259 Ga0207711_10111038 3300025941 Bacteria 2439
260 Ga0207689_10010678 3300025942 Bacteria 7900
261 Ga0207689_10092655 3300025942 Unclassified 2482
262 Ga0207679_10120361 3300025945 Unclassified 2088
263 Ga0207651_10064369 3300025960 Bacteria 2566
264 Ga0207651_10178352 3300025960 Unclassified 1683
265 Ga0207651_10369126 3300025960 Bacteria 1213
266 Ga0207712_10063103 3300025961 Bacteria 2636
267 Ga0207668_10452741 3300025972 Bacteria 1096
268 Ga0207640_10160660 3300025981 Bacteria 1662
269 Ga0207677_10127285 3300026023 Bacteria 1927
270 Ga0207677_10139497 3300026023 Bacteria 1854
271 Ga0207703_10218621 3300026035 Bacteria 1702
272 Ga0207703_10620199 3300026035 Bacteria 1024
273 Ga0207703_11803694 3300026035 Bacteria 588
274 Ga0207639_10669069 3300026041 Unclassified 961
275 Ga0207639_10803872 3300026041 Unclassified 876
276 Ga0207639_11010929 3300026041 Unclassified 779
277 Ga0207678_10577071 3300026067 Unclassified 985
278 Ga0207708_10156041 3300026075 Bacteria 1800
279 Ga0207708_11028488 3300026075 Bacteria 716
280 Ga0207702_10000844 3300026078 Bacteria 32126
281 Ga0207702_10257643 3300026078 Bacteria 1641
282 Ga0207702_10696084 3300026078 Bacteria 1001
283 Ga0207641_10009425 3300026088 Bacteria 8044
284 Ga0207648_10070570 3300026089 Bacteria 3046
285 Ga0207648_12171667 3300026089 Bacteria 516
286 Ga0207674_10190007 3300026116 Unclassified 2003
287 Ga0207675_100098862 3300026118 Bacteria 2748
288 Ga0207675_100583431 3300026118 Bacteria 1120
289 Ga0207683_10536384 3300026121 Unclassified 1081
290 Ga0207683_10661298 3300026121 Bacteria 968
291 Ga0209967_1028444 3300027364 Bacteria 833
292 Ga0210002_1011485 3300027617 Bacteria 1368
293 Ga0209588_1069528 3300027671 Unclassified 1137
294 Ga0265354_1008455 3300028016 Unclassified 994
295 Ga0265357_1003326 3300028023 Unclassified 1387
296 Ga0268266_10380338 3300028379 Bacteria 1331
297 Ga0268265_10131198 3300028380 Bacteria 2082
298 Ga0268265_10258779 3300028380 Bacteria 1546
299 Ga0268265_10343001 3300028380 Bacteria 1361
300 Ga0268265_10529947 3300028380 Bacteria 1115
301 Ga0268265_11223343 3300028380 Bacteria 749
302 Ga0268265_11276687 3300028380 Unclassified 734
303 Ga0268264_10034597 3300028381 Bacteria 4157
304 Ga0268264_10179215 3300028381 Bacteria 1923
305 Ga0268264_10307875 3300028381 Bacteria 1493
306 Ga0265338_10526714 3300028800 Unclassified 830
307 Ga0265770_1000978 3300030878 Bacteria 3950
308 Ga0265765_1000362 3300030879 Bacteria 3442
309 Ga0265760_10007945 3300031090 Bacteria 3030
310 Ga0265320_10469534 3300031240 Unclassified 556
311 Ga0265340_10002505 3300031247 Bacteria 10438
312 Ga0265314_10093661 3300031711 Bacteria 1950
313 Ga0265314_10401826 3300031711 Bacteria 741
314 Ga0307405_11498582 3300031731 Unclassified 592
315 Ga0307410_10333272 3300031852 Bacteria 1207
316 Ga0307406_10936791 3300031901 Unclassified 739
317 Ga0307406_11501475 3300031901 Unclassified 593
318 Ga0307407_10008892 3300031903 Unclassified 4642
319 Ga0307412_10200805 3300031911 Bacteria 1514
320 Ga0307409_100258611 3300031995 Bacteria 1596
321 Ga0307409_100671811 3300031995 Bacteria 1032
322 Ga0307409_100983692 3300031995 Bacteria 861
323 Ga0307416_100004584 3300032002 Bacteria 8355
324 Ga0307416_100762578 3300032002 Bacteria 1061
325 Ga0307414_10173374 3300032004 Unclassified 1727
326 Ga0307411_10249576 3300032005 Bacteria 1394
327 Ga0307415_102167304 3300032126 Unclassified 543
328 Ga0307415_102359211 3300032126 Bacteria 523
329 Ga0316214_1004126 3300033545 Bacteria 1861
330 Ga0316212_1008551 3300033547 Unclassified 1472
331 Ga0373948_0122252 3300034817 Bacteria 630
332 Ga0373958_0031127 3300034819 Bacteria 1047
333 Ga0373959_0109997 3300034820 Bacteria 664
334 Ga0373949_0094220 3300035090 Bacteria 813
335 Ga0373932_0323771 3300035112 Bacteria 580
336 Ga0373939_0229652 3300035114 Bacteria 714
337 Ga0373941_0176576 3300035115 Bacteria 799
338 Ga0373954_0030842 3300035118 Bacteria 2473
339 Ga0373946_0087099 3300035171 Unclassified 1378
340 Ga0373955_0830639 3300035172 Bacteria 568
341 Ga0373931_0018476 3300035691 Bacteria 3469
342 Ga0373931_0074889 3300035691 Bacteria 1855
343 Ga0373931_0160829 3300035691 Unclassified 1316
344 Ga0373931_1138361 3300035691 Unclassified 532
345 Ga0373947_0682976 3300035725 Unclassified 700
346 Ga0373937_1536927 3300036401 Bacteria 613
347 Ga0373925_1012967 3300037068 Unclassified 684
348 Ga0395900_0445523 3300037418 Bacteria 1252
349 Ga0436361_0184512 3300039447 Unclassified 1861
350 Ga0451807_1863609 3300041486 Bacteria 616
351 Ga0451807_2693972 3300041486 Bacteria 838
352 Ga0451853_3391609 3300041512 Unclassified 699
353 Ga0439431_0045272 3300041997 Bacteria 1130
354 Ga0439449_0042129 3300042007 Unclassified 1697
355 Ga0439435_0102216 3300042436 Bacteria 882
356 Ga0439444_0151223 3300042437 Bacteria 561
357 Ga0439460_0058841 3300042461 Bacteria 1169
358 Ga0439440_0043376 3300042993 Bacteria 1103
359 Ga0466959_1016131 3300045049 Bacteria 552
360 Ga0451576_0114788 3300045051 Bacteria 2804
361 Ga0451576_0424312 3300045051 Bacteria 1395
362 Ga0495629_0133097 3300046459 Bacteria 1732
363 Ga0495629_0494296 3300046459 Bacteria 825
364 Ga0495653_0797858 3300046463 Bacteria 568
365 Ga0495580_0149538 3300046472 Bacteria 1618
366 Ga0495580_0462287 3300046472 Unclassified 850
367 Ga0495639_0034415 3300046475 Unclassified 2266
368 Ga0495628_0459569 3300046516 Bacteria 924
369 Ga0495666_0218495 3300046526 Unclassified 873
370 Ga0495652_0816599 3300046529 Unclassified 620
371 Ga0495640_0578137 3300046533 Bacteria 680
372 Ga0495640_0869358 3300046533 Bacteria 535
373 Ga0495586_0178136 3300046535 Unclassified 1202
374 Ga0495587_0194862 3300046536 Bacteria 1147
375 Ga0495645_0022666 3300046543 Unclassified 4544
376 Ga0495667_0496503 3300046559 Bacteria 765
377 Ga0495625_0024580 3300046660 Bacteria 4583
378 Ga0495659_0451950 3300046664 Bacteria 559
379 Ga0495588_0453523 3300046674 Unclassified 673
380 Ga0495599_0133421 3300046678 Bacteria 1542
381 Ga0495647_0218753 3300046681 Unclassified 840
382 Ga0495613_0021566 3300046689 Bacteria 4799
383 Ga0495613_0542740 3300046689 Bacteria 779
384 Ga0495649_0274711 3300046694 Bacteria 862
385 Ga0495581_0810785 3300047315 Unclassified 537
386 Ga0495674_0394970 3300047319 Bacteria 1117
387 Ga0495674_0806377 3300047319 Bacteria 730
388 Ga0495675_0732499 3300047444 Unclassified 552
389 Ga0495684_0443773 3300047471 Bacteria 903
390 Ga0495602_1154229 3300048088 Bacteria 506
391 Ga0496100_0041651 3300048903 Bacteria 2929
392 Ga0496101_0105819 3300048904 Bacteria 2112
393 Ga0496101_0987713 3300048904 Bacteria 662
394 Ga0496101_1359191 3300048904 Bacteria 555
395 Ga0496102_0004825 3300048905 Bacteria 11401
396 Ga0496102_0202974 3300048905 Unclassified 1869
397 Ga0496102_1368973 3300048905 Bacteria 627
398 Ga0496104_0014900 3300048907 Bacteria 7029
399 Ga0496104_0631820 3300048907 Unclassified 980
400 Ga0496105_0102718 3300048908 Bacteria 2361
401 Ga0496106_1370561 3300048909 Unclassified 547
402 Ga0496107_0607410 3300048910 Bacteria 808
403 Ga0496111_1279027 3300048914 Unclassified 517
404 Ga0496112_0074220 3300048915 Unclassified 3363
405 Ga0496112_0368297 3300048915 Bacteria 1378
406 Ga0496112_0660816 3300048915 Bacteria 974
407 Ga0496114_0418692 3300048917 Bacteria 1186
408 Ga0496115_0091475 3300048918 Bacteria 2486
409 Ga0496115_0196804 3300048918 Viruses 1665
410 Ga0501031_0006691 3300049568 Bacteria 7518
411 Ga0501031_0887672 3300049568 Bacteria 571
412 Ga0501032_0006106 3300049569 Bacteria 8873
413 Ga0501033_0015480 3300049570 Bacteria 5785
414 Ga0501034_0028094 3300049571 Bacteria 5721
415 Ga0501036_0000622 3300049572 Bacteria 25771
416 Ga0501037_0005063 3300049573 Bacteria 9587
417 Ga0501038_0001249 3300049574 Bacteria 23071
418 Ga0501042_0096888 3300049578 Bacteria 2120
419 Ga0501042_0760605 3300049578 Unclassified 705
420 Ga0501043_0009254 3300049579 Bacteria 7740
421 Ga0501043_1208824 3300049579 Unclassified 530
422 Ga0501046_0037233 3300049580 Bacteria 3910
423 Ga0501047_0008607 3300049581 Bacteria 9636
424 Ga0501048_0080898 3300049582 Bacteria 2292
425 Ga0501067_0004280 3300049583 Bacteria 7868
426 Ga0501068_0000222 3300049584 Bacteria 27576
427 Ga0501068_1128252 3300049584 Unclassified 519
428 Ga0501069_0001774 3300049585 Bacteria 10784
429 Ga0501070_0020701 3300049586 Bacteria 5518
430 Ga0501072_0000469 3300049588 Bacteria 28958
431 Ga0501073_0001916 3300049589 Bacteria 15500
432 Ga0501074_0031611 3300049590 Bacteria 3834
433 Ga0501074_0389231 3300049590 Unclassified 989
434 Ga0501076_0528543 3300049592 Bacteria 972
435 Ga0501077_0001326 3300049593 Bacteria 14945
436 Ga0501077_0274305 3300049593 Bacteria 1073
437 Ga0501249_067748 3300049679 Unclassified 832
438 Ga0501079_0008456 3300049741 Bacteria 7802
439 Ga0501079_0056672 3300049741 Bacteria 3024
440 Ga0501079_0191545 3300049741 Unclassified 1596
441 Ga0501080_0000068 3300049742 Bacteria 68760
442 Ga0501083_0003135 3300049744 Bacteria 11500
443 Ga0501267_002049 3300049764 Bacteria 1782
444 Ga0501035_0030661 3300049822 Bacteria 4901
445 Ga0501044_0011573 3300049823 Bacteria 9561
446 Ga0501044_0167052 3300049823 Bacteria 2174
447 Ga0501045_0756680 3300049824 Unclassified 716
448 nmdc:mga0k408_392354_c1 3300050493 Bacteria 826
449 nmdc:mga0k408_823268_c1 3300050493 Bacteria 540
450 nmdc:mga06z11_602235_c1 3300050494 Bacteria 668
451 nmdc:mga04h51_339286_c1 3300050495 Bacteria 619
452 nmdc:mga05p37_1522628_c1 3300050507 Bacteria 664
453 nmdc:mga05p37_22092_c1 3300050507 Bacteria 7712
454 nmdc:mga09592_1662_c1 3300050508 Bacteria 17911
455 nmdc:mga09592_54766_c1 3300050508 Bacteria 3370
456 nmdc:mga09592_701784_c1 3300050508 Bacteria 861
457 nmdc:mga0qj67_149081_c1 3300050509 Bacteria 1897
458 nmdc:mga0qj67_2993_c1 3300050509 Bacteria 12125
459 nmdc:mga06r32_13982_c1 3300050510 Bacteria 7281
460 nmdc:mga06r32_386615_c1 3300050510 Bacteria 1382
461 nmdc:mga06r32_768248_c1 3300050510 Bacteria 926
462 nmdc:mga06r32_787359_c1 3300050510 Unclassified 912
463 nmdc:mga08y16_100681_c1 3300050511 Bacteria 3009
464 nmdc:mga08y16_10377_c1 3300050511 Bacteria 9771
465 nmdc:mga08y16_1340177_c1 3300050511 Bacteria 681
466 nmdc:mga0n895_946482_c1 3300050512 Bacteria 845
467 nmdc:mga0rr50_139293_c1 3300050513 Bacteria 1950
468 nmdc:mga0a205_320_c1 3300050515 Bacteria 35863
469 nmdc:mga0a205_627491_c1 3300050515 Bacteria 927
470 Ga0495601_0829367 3300053077 Bacteria 586
471 Ga0500559_0107283 3300053136 Bacteria 1292
472 Ga0500622_0134557 3300053156 Bacteria 1185
473 Ga0500596_000141 3300053735 Bacteria 10821
474 Ga0501084_0002883 3300054114 Bacteria 13907
475 Ga0590071_002873 3300059421 Bacteria 4307
476 Ga0590075_003952 3300059424 Bacteria 3511
477 Ga0590077_002850 3300059426 Bacteria 3637
478 Ga0501082_0021849 3300060353 Bacteria 5515
479 Ga0501082_0291103 3300060353 Bacteria 1422
480 Ga0501082_0670236 3300060353 Bacteria 908
481 Ga0530510_0870049 3300061734 Bacteria 688
482 Ga0065715_10099007
483 MBSR1b_contig_6681625
484 JGI25406J46586_10021694
485 Ga0065714_10460544
486 Ga0065712_10020233
487 Ga0065715_10494408
488 Ga0070658_10496561
489 Ga0070683_100001021
490 Ga0070683_100104655
491 Ga0070683_100585023
492 Ga0070670_100023852
493 Ga0070677_10111713
494 Ga0068869_100022363
495 Ga0068868_100158124
496 Ga0068868_100179261
497 Ga0070661_100512619
498 Ga0070661_100643254
499 Ga0070692_10424199
500 Ga0070669_101081510
501 Ga0070675_100132871
502 Ga0070675_100326099
503 Ga0070671_100324765
504 Ga0070674_100267671
505 Ga0070674_100778865
506 Ga0070688_100637587
507 Ga0070667_100452736
508 Ga0070709_10505013
509 Ga0070709_11279146
510 Ga0070714_101295597
511 Ga0070713_100378431
512 Ga0070710_10213256
513 Ga0070711_100444811
514 Ga0070711_100702737
515 Ga0070705_100136590
516 Ga0070700_100120067
517 Ga0070700_100657348
518 Ga0070700_101417844
519 Ga0070694_100230392
520 Ga0070708_102085923
521 Ga0070663_100476874
522 Ga0070678_100908305
523 Ga0070678_101791941
524 Ga0070678_102199177
525 Ga0070662_100380395
526 Ga0070681_10135383
527 Ga0070681_10197229
528 Ga0070681_11652214
529 Ga0068867_100475776
530 Ga0068867_101226726
531 Ga0070698_100356759
532 Ga0070698_100611769
533 Ga0070699_100004508
534 Ga0070679_100053449
535 Ga0070679_100127741
536 Ga0070679_100362868
537 Ga0070684_100506022
538 Ga0070684_101000346
539 Ga0070684_101014889
540 Ga0068853_100428273
541 Ga0068853_100760272
542 Ga0070672_100017440
543 Ga0070672_100456681
544 Ga0070672_100806997
545 Ga0070686_100464662
546 Ga0070695_100455619
547 Ga0070665_100282602
548 Ga0070704_100501467
549 Ga0070704_100537476
550 Ga0070704_100565444
551 Ga0070704_101196612
552 Ga0068855_100762627
553 Ga0068855_100766338
554 Ga0068855_100801288
555 Ga0070664_100083674
556 Ga0070664_100305511
557 Ga0068857_100247897
558 Ga0068854_100144630
559 Ga0068854_100587864
560 Ga0068856_100002025
561 Ga0068856_100006849
562 Ga0068856_100209604
563 Ga0068856_100666179
564 Ga0068856_100954066
565 Ga0068852_102199574
566 Ga0068859_100143606
567 Ga0068859_101974777
568 Ga0068864_100000446
569 Ga0068864_100380185
570 Ga0068866_10290138
571 Ga0068861_100256287
572 Ga0068861_100564438
573 Ga0068858_100509011
574 Ga0068860_100062541
575 Ga0068860_100199186
576 Ga0068862_100361406
577 Ga0068862_100501313
578 Ga0068862_100969854
579 Ga0081539_10000373
580 Ga0070717_10030171
581 Ga0070716_100606930
582 Ga0070712_100591687
583 Ga0075366_11048125
584 Ga0097621_100070131
585 Ga0097621_100454315
586 Ga0068871_100009327
587 Ga0068871_100155816
588 Ga0068871_100557720
589 Ga0068871_100577635
590 Ga0068871_100780988
591 Ga0068871_100930730
592 Ga0075428_100977389
593 Ga0075430_100133230
594 Ga0075430_100562488
595 Ga0075431_100053642
596 Ga0075431_102245849
597 Ga0075434_100705605
598 Ga0068865_100269980
599 Ga0068865_101824172
600 Ga0075436_100343441
601 Ga0097620_100143612
602 Ga0097620_101283188
603 Ga0097620_101974869
604 Ga0099794_10139718
605 Ga0099795_10053565
606 Ga0099795_10615457
607 Ga0105240_10027505
608 Ga0105240_10165320
609 Ga0111539_10007761
610 Ga0111539_10137842
611 Ga0111539_11001032
612 Ga0111539_13167572
613 Ga0105247_10334738
614 Ga0114129_10007747
615 Ga0114129_11140321
616 Ga0105243_10539368
617 Ga0105243_11393311
618 Ga0105243_11455149
619 Ga0105243_12486313
620 Ga0105241_10015494
621 Ga0105241_10225819
622 Ga0105242_10259014
623 Ga0105248_10004932
624 Ga0105248_10030054
625 Ga0105248_10330798
626 Ga0105248_10604712
627 Ga0105237_10095020
628 Ga0105237_10367692
629 Ga0105238_10266480
630 Ga0105238_10329036
631 Ga0105238_10601977
632 Ga0105238_10907552
633 Ga0105249_10001932
634 Ga0105249_10120412
635 Ga0105249_11141336
636 Ga0099796_10070998
637 Ga0099796_10453123
638 Ga0099796_10556965
639 Ga0105239_10119641
640 Ga0105239_10137283
641 Ga0105239_10292290
642 Ga0105239_11179770
643 Ga0105239_12014512
644 Ga0105239_12769461
645 Ga0105246_10202036
646 Ga0105246_10359428
647 Ga0105246_11248954
648 Ga0157328_1003372
649 Ga0157324_1046467
650 Ga0157373_10034513
651 Ga0157373_10042014
652 Ga0157371_10294356
653 Ga0157370_10050789
654 Ga0157369_10031364
655 Ga0157369_10035330
656 Ga0157369_10151622
657 Ga0157369_10749319
658 Ga0157369_11929462
659 Ga0157374_10001442
660 Ga0157374_10004514
661 Ga0157374_10070576
662 Ga0157374_10255572
663 Ga0157374_11579701
664 Ga0157378_10000103
665 Ga0157378_10000405
666 Ga0157378_10001015
667 Ga0163162_10055840
668 Ga0163162_10323755
669 Ga0163162_10432960
670 Ga0163162_10595052
671 Ga0163162_10609342
672 Ga0157372_10005057
673 Ga0157372_10043267
674 Ga0157375_10550832
675 Ga0157375_10574600
676 Ga0163163_10191551
677 Ga0163163_10332887
678 Ga0163163_10358075
679 Ga0163163_11536784
680 Ga0157380_10011102
681 Ga0157380_10035723
682 Ga0157380_10133006
683 Ga0157380_10334566
684 Ga0157380_10392123
685 Ga0157380_11879218
686 Ga0157377_10915354
687 Ga0157379_10304025
688 Ga0157379_10442803
689 Ga0157379_11339892
690 Ga0157376_10021171
691 Ga0157376_10055403
692 Ga0157376_10867204
693 Ga0157376_10921155
694 Ga0209026_1036926
695 Ga0207682_10002458
696 Ga0207688_10141584
697 Ga0207680_10432577
698 Ga0207680_11254151
699 Ga0207647_10056587
700 Ga0207647_10194002
701 Ga0207647_10496152
702 Ga0207699_11411324
703 Ga0207643_10086205
704 Ga0207654_10364575
705 Ga0207654_10423401
706 Ga0207707_10207236
707 Ga0207707_10819991
708 Ga0207695_10448547
709 Ga0207671_10355403
710 Ga0207693_11287657
711 Ga0207663_10303883
712 Ga0207660_10102377
713 Ga0207649_10706490
714 Ga0207652_10060357
715 Ga0207652_10158700
716 Ga0207652_10321606
717 Ga0207681_10057760
718 Ga0207681_11015835
719 Ga0207694_10909491
720 Ga0207694_11033794
721 Ga0207650_10029617
722 Ga0207659_10328691
723 Ga0207659_10622597
724 Ga0207659_11457020
725 Ga0207659_11645325
726 Ga0207700_10170614
727 Ga0207700_10540817
728 Ga0207644_11707453
729 Ga0207706_11107267
730 Ga0207670_10244335
731 Ga0207669_10001561
732 Ga0207704_10042054
733 Ga0207704_10342942
734 Ga0207704_10434867
735 Ga0207704_10964110
736 Ga0207665_10129355
737 Ga0207691_10244630
738 Ga0207691_11223976
739 Ga0207711_10049884
740 Ga0207711_10111038
741 Ga0207689_10010678
742 Ga0207689_10092655
743 Ga0207679_10120361
744 Ga0207651_10064369
745 Ga0207651_10178352
746 Ga0207651_10369126
747 Ga0207712_10063103
748 Ga0207668_10452741
749 Ga0207640_10160660
750 Ga0207677_10127285
751 Ga0207677_10139497
752 Ga0207703_10218621
753 Ga0207703_10620199
754 Ga0207703_11803694
755 Ga0207639_10669069
756 Ga0207639_10803872
757 Ga0207639_11010929
758 Ga0207678_10577071
759 Ga0207708_10156041
760 Ga0207708_11028488
761 Ga0207702_10000844
762 Ga0207702_10257643
763 Ga0207702_10696084
764 Ga0207641_10009425
765 Ga0207648_10070570
766 Ga0207648_12171667
767 Ga0207674_10190007
768 Ga0207675_100098862
769 Ga0207675_100583431
770 Ga0207683_10536384
771 Ga0207683_10661298
772 Ga0209967_1028444
773 Ga0210002_1011485
774 Ga0209588_1069528
775 Ga0265354_1008455
776 Ga0265357_1003326
777 Ga0268266_10380338
778 Ga0268265_10131198
779 Ga0268265_10258779
780 Ga0268265_10343001
781 Ga0268265_10529947
782 Ga0268265_11223343
783 Ga0268265_11276687
784 Ga0268264_10034597
785 Ga0268264_10179215
786 Ga0268264_10307875
787 Ga0265338_10526714
788 Ga0265770_1000978
789 Ga0265765_1000362
790 Ga0265760_10007945
791 Ga0265320_10469534
792 Ga0265340_10002505
793 Ga0265314_10093661
794 Ga0265314_10401826
795 Ga0307405_11498582
796 Ga0307410_10333272
797 Ga0307406_10936791
798 Ga0307406_11501475
799 Ga0307407_10008892
800 Ga0307412_10200805
801 Ga0307409_100258611
802 Ga0307409_100671811
803 Ga0307409_100983692
804 Ga0307416_100004584
805 Ga0307416_100762578
806 Ga0307414_10173374
807 Ga0307411_10249576
808 Ga0307415_102167304
809 Ga0307415_102359211
810 Ga0316214_1004126
811 Ga0316212_1008551
812 Ga0373948_0122252
813 Ga0373958_0031127
814 Ga0373959_0109997
815 Ga0373949_0094220
816 Ga0373932_0323771
817 Ga0373939_0229652
818 Ga0373941_0176576
819 Ga0373954_0030842
820 Ga0373946_0087099
821 Ga0373955_0830639
822 Ga0373931_0018476
823 Ga0373931_0074889
824 Ga0373931_0160829
825 Ga0373931_1138361
826 Ga0373947_0682976
827 Ga0373937_1536927
828 Ga0373925_1012967
829 Ga0395900_0445523
830 Ga0436361_0184512
831 Ga0451807_1863609
832 Ga0451807_2693972
833 Ga0451853_3391609
834 Ga0439431_0045272
835 Ga0439449_0042129
836 Ga0439435_0102216
837 Ga0439444_0151223
838 Ga0439460_0058841
839 Ga0439440_0043376
840 Ga0466959_1016131
841 Ga0451576_0114788
842 Ga0451576_0424312
843 Ga0495629_0133097
844 Ga0495629_0494296
845 Ga0495653_0797858
846 Ga0495580_0149538
847 Ga0495580_0462287
848 Ga0495639_0034415
849 Ga0495628_0459569
850 Ga0495666_0218495
851 Ga0495652_0816599
852 Ga0495640_0578137
853 Ga0495640_0869358
854 Ga0495586_0178136
855 Ga0495587_0194862
856 Ga0495645_0022666
857 Ga0495667_0496503
858 Ga0495625_0024580
859 Ga0495659_0451950
860 Ga0495588_0453523
861 Ga0495599_0133421
862 Ga0495647_0218753
863 Ga0495613_0021566
864 Ga0495613_0542740
865 Ga0495649_0274711
866 Ga0495581_0810785
867 Ga0495674_0394970
868 Ga0495674_0806377
869 Ga0495675_0732499
870 Ga0495684_0443773
871 Ga0495602_1154229
872 Ga0496100_0041651
873 Ga0496101_0105819
874 Ga0496101_0987713
875 Ga0496101_1359191
876 Ga0496102_0004825
877 Ga0496102_0202974
878 Ga0496102_1368973
879 Ga0496104_0014900
880 Ga0496104_0631820
881 Ga0496105_0102718
882 Ga0496106_1370561
883 Ga0496107_0607410
884 Ga0496111_1279027
885 Ga0496112_0074220
886 Ga0496112_0368297
887 Ga0496112_0660816
888 Ga0496114_0418692
889 Ga0496115_0091475
890 Ga0496115_0196804
891 Ga0501031_0006691
892 Ga0501031_0887672
893 Ga0501032_0006106
894 Ga0501033_0015480
895 Ga0501034_0028094
896 Ga0501036_0000622
897 Ga0501037_0005063
898 Ga0501038_0001249
899 Ga0501042_0096888
900 Ga0501042_0760605
901 Ga0501043_0009254
902 Ga0501043_1208824
903 Ga0501046_0037233
904 Ga0501047_0008607
905 Ga0501048_0080898
906 Ga0501067_0004280
907 Ga0501068_0000222
908 Ga0501068_1128252
909 Ga0501069_0001774
910 Ga0501070_0020701
911 Ga0501072_0000469
912 Ga0501073_0001916
913 Ga0501074_0031611
914 Ga0501074_0389231
915 Ga0501076_0528543
916 Ga0501077_0001326
917 Ga0501077_0274305
918 Ga0501249_067748
919 Ga0501079_0008456
920 Ga0501079_0056672
921 Ga0501079_0191545
922 Ga0501080_0000068
923 Ga0501083_0003135
924 Ga0501267_002049
925 Ga0501035_0030661
926 Ga0501044_0011573
927 Ga0501044_0167052
928 Ga0501045_0756680
929 nmdc:mga0k408_392354_c1
930 nmdc:mga0k408_823268_c1
931 nmdc:mga06z11_602235_c1
932 nmdc:mga04h51_339286_c1
933 nmdc:mga05p37_1522628_c1
934 nmdc:mga05p37_22092_c1
935 nmdc:mga09592_1662_c1
936 nmdc:mga09592_54766_c1
937 nmdc:mga09592_701784_c1
938 nmdc:mga0qj67_149081_c1
939 nmdc:mga0qj67_2993_c1
940 nmdc:mga06r32_13982_c1
941 nmdc:mga06r32_386615_c1
942 nmdc:mga06r32_768248_c1
943 nmdc:mga06r32_787359_c1
944 nmdc:mga08y16_100681_c1
945 nmdc:mga08y16_10377_c1
946 nmdc:mga08y16_1340177_c1
947 nmdc:mga0n895_946482_c1
948 nmdc:mga0rr50_139293_c1
949 nmdc:mga0a205_320_c1
950 nmdc:mga0a205_627491_c1
951 Ga0495601_0829367
952 Ga0500559_0107283
953 Ga0500622_0134557
954 Ga0500596_000141
955 Ga0501084_0002883
956 Ga0590071_002873
957 Ga0590075_003952
958 Ga0590077_002850
959 Ga0501082_0021849
960 Ga0501082_0291103
961 Ga0501082_0670236
962 Ga0530510_0870049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

38

107

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ejo-assembly1.cif.gz_A-2 crystal structure of padr family transcriptional regulator from eggerthella lenta dsm 2243 0.9731 4 108
4ejo-assembly2.cif.gz_B-3 crystal structure of padr family transcriptional regulator from eggerthella lenta dsm 2243 0.9334 1 106
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9257 11 108
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9227 10 106
6abt-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9174 16 106
ID Description Score Start End Superfamily
4ejoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9332 1 108 1.10.10.10
3ri2B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9166 1 106 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9143 17 108 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9138 18 93 1.10.10.10
4ejoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9086 1 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7R8AXL1-F1-model_v4 deleted 0.9972 1 106
AF-A0A1S6FNF3-F1-model_v4 PadR family transcriptional regulator 0.9933 6 108
AF-A0A2Z5FX60-F1-model_v4 Transcriptional regulator, PadR family 0.9878 4 108
AF-A0A0M2VD03-F1-model_v4 PadR family transcriptional regulator 0.9843 1 106
AF-A0A519L127-F1-model_v4 PadR family transcriptional regulator 0.9835 10 105

Map