F452301

General Info

Members Datasets Scaffolds Average Seq Length
480 248 960 329

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0245565|Ga0501071_0245565_211_1317
Length 368
Sequence MSATASAADETTLSMGLHVSASGVPRVGQVSLPTHDWSRVRLHVVTGKGGTGKSTVAASLALALASHGKHVLLCEVEGRQGIARMFDVDPLPYAERRIATGLRSDEPPNDTPGDVHALHIDPEDALMEYLSMYYRLGRAGRALDRFGVVEFATTIAPGVRDVLLTGKVYEAVQRNSRNKGAREYDAVVLDAPPTGRITQFLNVSDELAGLAKVGPVRHQAETMMTLFRSPRTAIHFVTVLEEMPVQETADGIAQVRAAGLPVGAVVVNLLRPRDLRVKDLVAVRNGGLDREAIAADLVSGGVEVSDELLDGXXXEARDHAVRRSLEDGQRKLVKAMGVPTYELPRLPEGVDLGGLYELAARLRDQGLA

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
134 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
135 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
224 2643221561 Nocardioides sp. Root151 Isolate Unclassified
225 2643221576 Nocardioides sp. Root614 Isolate Unclassified
226 2643221590 Nocardioides sp. Root682 Isolate Unclassified
227 2643221615 Nocardioides sp. Root224 Isolate Unclassified
228 2643221617 Nocardioides sp. Root79 Isolate Unclassified
229 2643221620 Nocardioides sp. Root240 Isolate Unclassified
230 2643221641 Nocardioides sp. Root122 Isolate Unclassified
231 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
232 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
233 2643221696 Nocardioides sp. Root140 Isolate Unclassified
234 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
235 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
236 2738541305 Nocardioides sp. CF167 Isolate Unclassified
237 2739367898 Nocardioides sp. CF479 Isolate Unclassified
238 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
239 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
240 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
241 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
242 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
243 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
244 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
245 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
246 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
247 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
248 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.17
Metatranscriptomes 0.62
Isolates 5.21

Biome Distribution

Category Percentage (%)
Aerial Root 0.62
Bulb 0
Endosphere 10.21
Nodule 0.21
Rhizoplane 8.33
Rhizosphere 74.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0245565 3300049587 Bacteria 1350
2 JGI24746J21847_1010184 3300001977 Bacteria 1393
3 JGI24739J22299_10013565 3300001989 Bacteria 2973
4 JGI24735J21928_10018897 3300002067 Bacteria 2123
5 JGI25407J50210_10010173 3300003373 Bacteria 2390
6 JGI25405J52794_10009168 3300003911 Bacteria 1864
7 Ga0070658_10088364 3300005327 Bacteria 2552
8 Ga0070683_100001487 3300005329 Bacteria 18080
9 Ga0070683_100023273 3300005329 Bacteria 5540
10 Ga0070683_100024800 3300005329 Bacteria 5377
11 Ga0070683_100085385 3300005329 Bacteria 2959
12 Ga0070683_100089558 3300005329 Bacteria 2888
13 Ga0070683_100099949 3300005329 Bacteria 2731
14 Ga0070683_100495938 3300005329 Bacteria 1166
15 Ga0070670_100248572 3300005331 Bacteria 1549
16 Ga0068869_100122183 3300005334 Bacteria 1993
17 Ga0070682_100010949 3300005337 Bacteria 5169
18 Ga0070682_100029469 3300005337 Bacteria 3305
19 Ga0068868_100415144 3300005338 Bacteria 1164
20 Ga0070660_100006162 3300005339 Bacteria 8299
21 Ga0070660_100024218 3300005339 Bacteria 4503
22 Ga0070689_100108369 3300005340 Bacteria 2207
23 Ga0070691_10076507 3300005341 Bacteria 1632
24 Ga0070692_10007370 3300005345 Bacteria 4843
25 Ga0070669_100247982 3300005353 Bacteria 1417
26 Ga0070675_100041469 3300005354 Bacteria 3760
27 Ga0070675_100139033 3300005354 Bacteria 2075
28 Ga0070674_100050519 3300005356 Bacteria 2863
29 Ga0070674_100089034 3300005356 Bacteria 2223
30 Ga0070659_100016728 3300005366 Bacteria 5510
31 Ga0070659_100139259 3300005366 Bacteria 1975
32 Ga0070667_100012200 3300005367 Bacteria 7110
33 Ga0070714_100029013 3300005435 Bacteria 4597
34 Ga0070701_10004758 3300005438 Bacteria 5545
35 Ga0070663_100089896 3300005455 Bacteria 2273
36 Ga0070681_10048876 3300005458 Bacteria 4225
37 Ga0068867_100049192 3300005459 Bacteria 3103
38 Ga0070685_10131820 3300005466 Bacteria 1564
39 Ga0070679_100006485 3300005530 Bacteria 10908
40 Ga0070684_100000262 3300005535 Bacteria 36422
41 Ga0070684_100034962 3300005535 Bacteria 4298
42 Ga0070684_100162435 3300005535 Bacteria 2027
43 Ga0070684_100354184 3300005535 Bacteria 1350
44 Ga0068853_100270099 3300005539 Bacteria 1566
45 Ga0070665_100145168 3300005548 Bacteria 2376
46 Ga0068855_100328519 3300005563 Bacteria 1689
47 Ga0070664_100036660 3300005564 Bacteria 4120
48 Ga0068857_100015867 3300005577 Bacteria 6593
49 Ga0068857_100365609 3300005577 Bacteria 1338
50 Ga0068856_100107842 3300005614 Bacteria 2781
51 Ga0070702_100016860 3300005615 Bacteria 3758
52 Ga0068852_100080277 3300005616 Bacteria 2892
53 Ga0068852_100083472 3300005616 Bacteria 2841
54 Ga0068852_100447190 3300005616 Bacteria 1279
55 Ga0068864_100017499 3300005618 Bacteria 5976
56 Ga0068860_100000865 3300005843 Bacteria 33675
57 Ga0068860_100049466 3300005843 Bacteria 4004
58 Ga0068862_100233890 3300005844 Bacteria 1668
59 Ga0081455_10000611 3300005937 Bacteria 46255
60 Ga0081455_10012434 3300005937 Bacteria 8494
61 Ga0081538_10000083 3300005981 Bacteria 90853
62 Ga0081539_10019671 3300005985 Bacteria 4608
63 Ga0075365_10021558 3300006038 Bacteria 4022
64 Ga0075365_10031541 3300006038 Bacteria 3400
65 Ga0075365_10064420 3300006038 Bacteria 2455
66 Ga0075365_10095869 3300006038 Bacteria 2027
67 Ga0075365_10117886 3300006038 Bacteria 1829
68 Ga0075368_10085235 3300006042 Bacteria 1288
69 Ga0075363_100008599 3300006048 Bacteria 4764
70 Ga0075363_100016453 3300006048 Bacteria 3653
71 Ga0075363_100029236 3300006048 Bacteria 2843
72 Ga0075363_100034617 3300006048 Bacteria 2638
73 Ga0075364_10003765 3300006051 Bacteria 8670
74 Ga0075364_10006392 3300006051 Bacteria 6928
75 Ga0075364_10010788 3300006051 Bacteria 5530
76 Ga0075364_10017656 3300006051 Bacteria 4461
77 Ga0075364_10042006 3300006051 Bacteria 2970
78 Ga0075364_10068737 3300006051 Bacteria 2330
79 Ga0075362_10057477 3300006177 Bacteria 1753
80 Ga0075362_10078941 3300006177 Bacteria 1514
81 Ga0075367_10060599 3300006178 Bacteria 2256
82 Ga0075367_10063262 3300006178 Bacteria 2211
83 Ga0075367_10082521 3300006178 Bacteria 1946
84 Ga0075367_10095037 3300006178 Bacteria 1817
85 Ga0075367_10099718 3300006178 Bacteria 1774
86 Ga0075370_10037081 3300006353 Bacteria 2740
87 Ga0068871_100114936 3300006358 Bacteria 2268
88 Ga0075428_100072862 3300006844 Bacteria 3751
89 Ga0075430_100014972 3300006846 Bacteria 6605
90 Ga0075430_100103564 3300006846 Bacteria 2376
91 Ga0075431_100013012 3300006847 Bacteria 8402
92 Ga0075431_100035042 3300006847 Bacteria 5170
93 Ga0075433_10413143 3300006852 Bacteria 1190
94 Ga0075429_100001139 3300006880 Bacteria 21433
95 Ga0075429_100027541 3300006880 Bacteria 4933
96 Ga0068865_100005308 3300006881 Bacteria 7798
97 Ga0068865_100103347 3300006881 Bacteria 2090
98 Ga0075435_100306759 3300007076 Bacteria 1358
99 Ga0111539_10024691 3300009094 Bacteria 7372
100 Ga0111539_10047110 3300009094 Bacteria 5154
101 Ga0111539_10540870 3300009094 Bacteria 1357
102 Ga0105245_10004239 3300009098 Bacteria 12720
103 Ga0105245_10008373 3300009098 Bacteria 9034
104 Ga0105245_10105578 3300009098 Bacteria 2613
105 Ga0114129_10049945 3300009147 Bacteria 5876
106 Ga0114129_10169708 3300009147 Bacteria 2975
107 Ga0105242_10404339 3300009176 Bacteria 1275
108 Ga0105248_10037832 3300009177 Bacteria 5399
109 Ga0105248_10186144 3300009177 Bacteria 2340
110 Ga0105238_10024211 3300009551 Bacteria 6189
111 Ga0105249_10200663 3300009553 Bacteria 1952
112 Ga0105249_10750279 3300009553 Bacteria 1038
113 Ga0105239_10100546 3300010375 Bacteria 3199
114 Ga0105239_10106242 3300010375 Bacteria 3110
115 Ga0105239_10320485 3300010375 Bacteria 1748
116 Ga0105246_10000654 3300011119 Bacteria 19374
117 Ga0105246_10075321 3300011119 Bacteria 2389
118 Ga0105246_10186895 3300011119 Bacteria 1600
119 Ga0105246_10285330 3300011119 Bacteria 1326
120 Ga0157369_10165352 3300013105 Bacteria 2334
121 Ga0157378_10531048 3300013297 Bacteria 1179
122 Ga0163162_10022413 3300013306 Bacteria 6222
123 Ga0157372_10001247 3300013307 Bacteria 27513
124 Ga0157372_10102281 3300013307 Bacteria 3272
125 Ga0157372_10358492 3300013307 Bacteria 1699
126 Ga0157372_10756533 3300013307 Bacteria 1130
127 Ga0157375_10039174 3300013308 Bacteria 4559
128 Ga0157375_10055117 3300013308 Bacteria 3918
129 Ga0157375_10309874 3300013308 Bacteria 1743
130 Ga0157375_10413881 3300013308 Bacteria 1514
131 Ga0157375_10542622 3300013308 Bacteria 1325
132 Ga0163163_10135169 3300014325 Bacteria 2507
133 Ga0157380_10010852 3300014326 Bacteria 6568
134 Ga0157377_10027886 3300014745 Bacteria 3035
135 Ga0157377_10119315 3300014745 Bacteria 1596
136 Ga0157379_10013730 3300014968 Bacteria 7098
137 Ga0206353_10647266 3300020082 Bacteria 2233
138 Ga0206353_11716301 3300020082 Bacteria 4424
139 Ga0213875_10014267 3300021388 Bacteria 3880
140 Ga0224712_10004627 3300022467 Bacteria 3732
141 Ga0207688_10014761 3300025901 Bacteria 4239
142 Ga0207647_10013361 3300025904 Bacteria 5697
143 Ga0207647_10028874 3300025904 Bacteria 3597
144 Ga0207643_10019327 3300025908 Bacteria 3733
145 Ga0207705_10011105 3300025909 Bacteria 6530
146 Ga0207671_10218816 3300025914 Bacteria 1491
147 Ga0207657_10008625 3300025919 Bacteria 10319
148 Ga0207657_10023634 3300025919 Bacteria 5718
149 Ga0207681_10223512 3300025923 Bacteria 1458
150 Ga0207694_10062527 3300025924 Bacteria 2898
151 Ga0207650_10290220 3300025925 Bacteria 1334
152 Ga0207659_10166381 3300025926 Bacteria 1736
153 Ga0207687_10006142 3300025927 Bacteria 7946
154 Ga0207687_10068629 3300025927 Bacteria 2526
155 Ga0207687_10310331 3300025927 Bacteria 1273
156 Ga0207664_10015324 3300025929 Bacteria 5558
157 Ga0207690_10071545 3300025932 Bacteria 2392
158 Ga0207690_10104662 3300025932 Bacteria 2028
159 Ga0207690_10208799 3300025932 Bacteria 1487
160 Ga0207709_10028565 3300025935 Bacteria 3225
161 Ga0207670_10098743 3300025936 Bacteria 2081
162 Ga0207669_10089302 3300025937 Bacteria 2001
163 Ga0207704_10008373 3300025938 Bacteria 4941
164 Ga0207704_10175475 3300025938 Bacteria 1542
165 Ga0207691_10088474 3300025940 Bacteria 2777
166 Ga0207711_10581072 3300025941 Bacteria 1045
167 Ga0207661_10002532 3300025944 Bacteria 12574
168 Ga0207661_10013829 3300025944 Bacteria 5900
169 Ga0207661_10047591 3300025944 Bacteria 3405
170 Ga0207661_10072567 3300025944 Bacteria 2816
171 Ga0207661_10231622 3300025944 Bacteria 1636
172 Ga0207679_10014044 3300025945 Bacteria 5254
173 Ga0207712_10079955 3300025961 Bacteria 2376
174 Ga0207658_10123608 3300025986 Bacteria 2067
175 Ga0207677_10228205 3300026023 Bacteria 1498
176 Ga0207639_10082839 3300026041 Bacteria 2544
177 Ga0207639_10154517 3300026041 Bacteria 1926
178 Ga0207678_10097069 3300026067 Bacteria 2518
179 Ga0207678_10171041 3300026067 Bacteria 1855
180 Ga0207678_10243344 3300026067 Bacteria 1541
181 Ga0207708_10000152 3300026075 Bacteria 55641
182 Ga0207708_10024783 3300026075 Bacteria 4539
183 Ga0207702_10120882 3300026078 Bacteria 2344
184 Ga0207648_10010906 3300026089 Bacteria 8587
185 Ga0207648_10290428 3300026089 Bacteria 1464
186 Ga0207676_10266346 3300026095 Bacteria 1550
187 Ga0207674_10009716 3300026116 Bacteria 10965
188 Ga0207674_10179033 3300026116 Bacteria 2072
189 Ga0207675_100010622 3300026118 Bacteria 8625
190 Ga0207683_10188742 3300026121 Bacteria 1871
191 Ga0207698_10067190 3300026142 Bacteria 2826
192 Ga0207698_10101791 3300026142 Bacteria 2383
193 Ga0209813_10002518 3300027866 Bacteria 4197
194 Ga0207428_10022289 3300027907 Bacteria 5348
195 Ga0207428_10060327 3300027907 Bacteria 3006
196 Ga0268266_10003653 3300028379 Bacteria 15203
197 Ga0268264_10000343 3300028381 Bacteria 71702
198 Ga0268264_10047034 3300028381 Bacteria 3586
199 Ga0316181_1060778 3300030744 Bacteria 1212
200 Ga0307413_10139863 3300031824 Bacteria 1671
201 Ga0307410_10012357 3300031852 Bacteria 4935
202 Ga0307410_10290871 3300031852 Bacteria 1286
203 Ga0307412_10074583 3300031911 Bacteria 2325
204 Ga0307409_100177245 3300031995 Bacteria 1883
205 Ga0307416_100007478 3300032002 Bacteria 6951
206 Ga0307416_100091589 3300032002 Bacteria 2612
207 Ga0307416_100127138 3300032002 Bacteria 2285
208 Ga0307414_10219788 3300032004 Bacteria 1559
209 Ga0307415_100145619 3300032126 Bacteria 1816
210 Ga0307415_100162618 3300032126 Bacteria 1732
211 Ga0395899_0043777 3300037312 Bacteria 3337
212 Ga0395900_0047742 3300037418 Bacteria 4410
213 Ga0395900_0146056 3300037418 Bacteria 2418
214 Ga0395905_0218150 3300037471 Bacteria 1786
215 Ga0395905_0393858 3300037471 Bacteria 1280
216 Ga0436364_0648623 3300037853 Bacteria 4252
217 Ga0436364_0658340 3300037853 Bacteria 1074
218 Ga0395901_0048065 3300038443 Bacteria 4431
219 Ga0395901_0205061 3300038443 Bacteria 2066
220 Ga0451837_0044753 3300041494 Bacteria 1620
221 Ga0451853_0259456 3300041512 Bacteria 15059
222 Ga0451853_3905993 3300041512 Bacteria 1357
223 Ga0439431_0004315 3300041997 Bacteria 3123
224 Ga0439457_008412 3300042014 Bacteria 2436
225 Ga0450907_002053 3300042146 Bacteria 4005
226 Ga0439446_0035735 3300042156 Bacteria 1450
227 Ga0466969_0035458 3300044656 Bacteria 2523
228 Ga0466972_0067201 3300044658 Bacteria 1713
229 Ga0466965_0061980 3300044683 Bacteria 1870
230 Ga0466966_0068167 3300044684 Bacteria 2234
231 Ga0466966_0135209 3300044684 Bacteria 1508
232 Ga0466961_0003451 3300044693 Bacteria 9859
233 Ga0466961_0010476 3300044693 Bacteria 5914
234 Ga0466961_0112036 3300044693 Bacteria 1716
235 Ga0466963_0015585 3300044694 Bacteria 4711
236 Ga0466963_0023457 3300044694 Bacteria 3919
237 Ga0466963_0087808 3300044694 Bacteria 2115
238 Ga0466963_0333265 3300044694 Bacteria 1068
239 Ga0466964_0001426 3300044706 Bacteria 8162
240 Ga0466971_0006474 3300044719 Bacteria 5089
241 Ga0466971_0079927 3300044719 Bacteria 1490
242 Ga0466970_0002483 3300044765 Bacteria 8916
243 Ga0466970_0004608 3300044765 Bacteria 6801
244 Ga0466970_0007979 3300044765 Bacteria 5317
245 Ga0466970_0020506 3300044765 Bacteria 3435
246 Ga0466970_0029436 3300044765 Bacteria 2891
247 Ga0466970_0032327 3300044765 Bacteria 2764
248 Ga0466970_0046365 3300044765 Bacteria 2315
249 Ga0466970_0088257 3300044765 Bacteria 1682
250 Ga0466957_0029145 3300044842 Bacteria 3290
251 Ga0466957_0082632 3300044842 Bacteria 2002
252 Ga0466957_0115071 3300044842 Bacteria 1709
253 Ga0466957_0354600 3300044842 Bacteria 996
254 Ga0466960_0002630 3300044901 Bacteria 6764
255 Ga0466960_0004846 3300044901 Bacteria 5288
256 Ga0466960_0007228 3300044901 Bacteria 4497
257 Ga0466960_0028056 3300044901 Bacteria 2574
258 Ga0466960_0031456 3300044901 Bacteria 2449
259 Ga0466960_0048941 3300044901 Bacteria 2033
260 Ga0466959_0048605 3300045049 Bacteria 3117
261 Ga0466959_0116061 3300045049 Bacteria 1907
262 Ga0466958_0036260 3300045836 Bacteria 2951
263 Ga0466958_0060943 3300045836 Bacteria 2297
264 Ga0466958_0067966 3300045836 Bacteria 2178
265 Ga0466967_0004074 3300045976 Bacteria 9756
266 Ga0466967_0005536 3300045976 Bacteria 8768
267 Ga0466967_0011351 3300045976 Bacteria 6740
268 Ga0466967_0017780 3300045976 Bacteria 5659
269 Ga0466967_0080615 3300045976 Bacteria 2937
270 Ga0466967_0090235 3300045976 Bacteria 2783
271 Ga0466967_0158647 3300045976 Bacteria 2122
272 Ga0495664_0154526 3300046477 Bacteria 1392
273 Ga0495585_0021559 3300046492 Bacteria 3699
274 Ga0495625_0187214 3300046660 Bacteria 1373
275 Ga0495658_0079676 3300046683 Bacteria 1920
276 Ga0496101_0004070 3300048904 Bacteria 9143
277 Ga0496102_0021748 3300048905 Bacteria 5675
278 Ga0496102_0069566 3300048905 Bacteria 3231
279 Ga0496102_0103219 3300048905 Bacteria 2651
280 Ga0496102_0556154 3300048905 Bacteria 1070
281 Ga0496103_0177604 3300048906 Bacteria 1368
282 Ga0496104_0008596 3300048907 Bacteria 9081
283 Ga0496104_0452746 3300048907 Bacteria 1195
284 Ga0496105_0023402 3300048908 Bacteria 5009
285 Ga0496106_0029223 3300048909 Bacteria 4107
286 Ga0496106_0032529 3300048909 Bacteria 3889
287 Ga0496106_0133524 3300048909 Bacteria 1948
288 Ga0496107_0013094 3300048910 Bacteria 5794
289 Ga0496107_0046068 3300048910 Bacteria 3138
290 Ga0496108_0007708 3300048911 Bacteria 8722
291 Ga0496108_0025814 3300048911 Bacteria 4844
292 Ga0496108_0100583 3300048911 Bacteria 2466
293 Ga0496108_0108099 3300048911 Bacteria 2376
294 Ga0496109_0015138 3300048912 Bacteria 6714
295 Ga0496109_0026263 3300048912 Bacteria 5193
296 Ga0496109_0032626 3300048912 Bacteria 4682
297 Ga0496109_0080801 3300048912 Bacteria 2995
298 Ga0496109_0104316 3300048912 Bacteria 2632
299 Ga0496109_0158474 3300048912 Bacteria 2120
300 Ga0496110_0017162 3300048913 Bacteria 6052
301 Ga0496110_0176604 3300048913 Bacteria 1938
302 Ga0496110_0288712 3300048913 Bacteria 1494
303 Ga0496111_0005217 3300048914 Bacteria 8288
304 Ga0496111_0168326 3300048914 Bacteria 1628
305 Ga0496112_0368475 3300048915 Bacteria 1378
306 Ga0496113_0311359 3300048916 Bacteria 1261
307 Ga0496114_0002242 3300048917 Bacteria 14731
308 Ga0496114_0004492 3300048917 Bacteria 10829
309 Ga0496114_0020293 3300048917 Bacteria 5392
310 Ga0496114_0020872 3300048917 Bacteria 5319
311 Ga0496114_0027500 3300048917 Bacteria 4660
312 Ga0496114_0056035 3300048917 Bacteria 3288
313 Ga0496114_0215940 3300048917 Bacteria 1683
314 Ga0496115_0006725 3300048918 Bacteria 8434
315 Ga0496115_0052089 3300048918 Bacteria 3283
316 Ga0496123_0019653 3300048926 Bacteria 5319
317 Ga0496124_0018702 3300048927 Bacteria 6481
318 Ga0501031_0012293 3300049568 Bacteria 5581
319 Ga0501031_0043888 3300049568 Bacteria 2917
320 Ga0501031_0061729 3300049568 Bacteria 2442
321 Ga0501032_0091408 3300049569 Bacteria 2019
322 Ga0501033_0049901 3300049570 Bacteria 3106
323 Ga0501034_0059531 3300049571 Bacteria 3836
324 Ga0501034_0085922 3300049571 Bacteria 3147
325 Ga0501034_0129269 3300049571 Bacteria 2510
326 Ga0501034_0224308 3300049571 Bacteria 1831
327 Ga0501036_0014597 3300049572 Bacteria 6542
328 Ga0501036_0016203 3300049572 Bacteria 6224
329 Ga0501036_0039455 3300049572 Bacteria 3996
330 Ga0501036_0267244 3300049572 Bacteria 1432
331 Ga0501036_0297856 3300049572 Bacteria 1349
332 Ga0501037_0003601 3300049573 Bacteria 11236
333 Ga0501037_0061204 3300049573 Bacteria 2745
334 Ga0501038_0117003 3300049574 Bacteria 2202
335 Ga0501039_0050391 3300049575 Bacteria 3221
336 Ga0501039_0053193 3300049575 Bacteria 3133
337 Ga0501039_0076998 3300049575 Bacteria 2594
338 Ga0501039_0149647 3300049575 Bacteria 1834
339 Ga0501039_0221767 3300049575 Bacteria 1486
340 Ga0501040_0011591 3300049576 Bacteria 5770
341 Ga0501040_0214025 3300049576 Bacteria 1370
342 Ga0501041_0011434 3300049577 Bacteria 5245
343 Ga0501041_0039067 3300049577 Bacteria 2880
344 Ga0501042_0013773 3300049578 Bacteria 5509
345 Ga0501042_0052265 3300049578 Bacteria 2914
346 Ga0501042_0273028 3300049578 Bacteria 1221
347 Ga0501046_0000356 3300049580 Bacteria 46124
348 Ga0501046_0096979 3300049580 Bacteria 2265
349 Ga0501047_0001918 3300049581 Bacteria 19985
350 Ga0501048_0018298 3300049582 Bacteria 5154
351 Ga0501048_0022057 3300049582 Bacteria 4660
352 Ga0501048_0107361 3300049582 Bacteria 1971
353 Ga0501048_0210355 3300049582 Bacteria 1379
354 Ga0501048_0427723 3300049582 Bacteria 947
355 Ga0501067_0001734 3300049583 Bacteria 11990
356 Ga0501067_0014748 3300049583 Bacteria 4323
357 Ga0501067_0033913 3300049583 Bacteria 2833
358 Ga0501067_0043759 3300049583 Bacteria 2487
359 Ga0501067_0107081 3300049583 Bacteria 1554
360 Ga0501068_0025279 3300049584 Bacteria 3493
361 Ga0501068_0034859 3300049584 Bacteria 3003
362 Ga0501069_0008000 3300049585 Bacteria 5551
363 Ga0501069_0030337 3300049585 Bacteria 2969
364 Ga0501069_0034129 3300049585 Bacteria 2802
365 Ga0501069_0038107 3300049585 Bacteria 2653
366 Ga0501070_0003822 3300049586 Bacteria 13000
367 Ga0501070_0003973 3300049586 Bacteria 12728
368 Ga0501070_0022881 3300049586 Bacteria 5231
369 Ga0501070_0080463 3300049586 Bacteria 2696
370 Ga0501070_0102757 3300049586 Bacteria 2363
371 Ga0501070_0216239 3300049586 Bacteria 1572
372 Ga0501071_0006089 3300049587 Bacteria 7821
373 Ga0501071_0006731 3300049587 Bacteria 7477
374 Ga0501071_0032601 3300049587 Bacteria 3700
375 Ga0501071_0055378 3300049587 Bacteria 2863
376 Ga0501072_0009457 3300049588 Bacteria 7412
377 Ga0501072_0016782 3300049588 Bacteria 5622
378 Ga0501072_0033596 3300049588 Bacteria 4020
379 Ga0501072_0121112 3300049588 Bacteria 2084
380 Ga0501072_0166227 3300049588 Bacteria 1760
381 Ga0501073_0004466 3300049589 Bacteria 10506
382 Ga0501074_0001125 3300049590 Bacteria 17494
383 Ga0501074_0020190 3300049590 Bacteria 4842
384 Ga0501074_0037250 3300049590 Bacteria 3526
385 Ga0501075_0035346 3300049591 Bacteria 3726
386 Ga0501075_0202381 3300049591 Bacteria 1514
387 Ga0501075_0435509 3300049591 Bacteria 1000
388 Ga0501076_0016375 3300049592 Bacteria 5622
389 Ga0501076_0029433 3300049592 Bacteria 4272
390 Ga0501076_0123682 3300049592 Bacteria 2095
391 Ga0501076_0272844 3300049592 Bacteria 1385
392 Ga0501077_0173297 3300049593 Bacteria 1371
393 Ga0501077_0193677 3300049593 Bacteria 1291
394 Ga0501079_0089926 3300049741 Bacteria 2378
395 Ga0501079_0142589 3300049741 Bacteria 1866
396 Ga0501079_0153251 3300049741 Bacteria 1796
397 Ga0501080_0005543 3300049742 Bacteria 11272
398 Ga0501080_0019451 3300049742 Bacteria 6289
399 Ga0501080_0045039 3300049742 Bacteria 4107
400 Ga0501080_0061814 3300049742 Bacteria 3486
401 Ga0501081_0098576 3300049743 Bacteria 2064
402 Ga0501083_0007972 3300049744 Bacteria 7499
403 Ga0501083_0036020 3300049744 Bacteria 3377
404 Ga0501035_0002174 3300049822 Bacteria 19443
405 Ga0501035_0218478 3300049822 Bacteria 1628
406 Ga0501035_0424084 3300049822 Bacteria 1104
407 Ga0501044_0007434 3300049823 Bacteria 12046
408 Ga0501044_0248830 3300049823 Bacteria 1719
409 Ga0501045_0170815 3300049824 Bacteria 1619
410 nmdc:mga03n38_60381_c1 3300050490 Bacteria 1724
411 nmdc:mga03n38_7182_c1 3300050490 Bacteria 3925
412 nmdc:mga03n38_871_c1 3300050490 Bacteria 8104
413 nmdc:mga03n38_9842_c1 3300050490 Bacteria 3493
414 nmdc:mga00v17_13407_c1 3300050491 Bacteria 4550
415 nmdc:mga00v17_14499_c1 3300050491 Bacteria 4401
416 nmdc:mga00v17_47470_c1 3300050491 Bacteria 2601
417 nmdc:mga00v17_8454_c1 3300050491 Bacteria 5540
418 nmdc:mga0yw44_100258_c1 3300050492 Bacteria 1844
419 nmdc:mga0yw44_134837_c1 3300050492 Bacteria 1601
420 nmdc:mga0yw44_21162_c1 3300050492 Bacteria 3624
421 nmdc:mga0yw44_6150_c1 3300050492 Bacteria 5769
422 nmdc:mga0yw44_65904_c1 3300050492 Bacteria 2234
423 nmdc:mga0yw44_82841_c1 3300050492 Bacteria 2013
424 nmdc:mga06z11_25372_c1 3300050494 Bacteria 2809
425 nmdc:mga06z11_80409_c1 3300050494 Bacteria 1747
426 nmdc:mga04h51_2016_c1 3300050495 Bacteria 4755
427 nmdc:mga04h51_6782_c1 3300050495 Bacteria 2991
428 nmdc:mga07m45_141350_c1 3300050496 Bacteria 1394
429 nmdc:mga07m45_5629_c1 3300050496 Bacteria 6258
430 nmdc:mga05p37_304_c1 3300050507 Bacteria 51652
431 nmdc:mga05p37_57319_c1 3300050507 Bacteria 4798
432 nmdc:mga09592_403454_c1 3300050508 Bacteria 1182
433 nmdc:mga09592_79439_c1 3300050508 Bacteria 2793
434 nmdc:mga0qj67_3591_c1 3300050509 Bacteria 11193
435 nmdc:mga06r32_7022_c1 3300050510 Bacteria 10128
436 nmdc:mga06r32_83_c1 3300050510 Bacteria 64174
437 nmdc:mga06r32_94852_c1 3300050510 Bacteria 2920
438 nmdc:mga08y16_39397_c1 3300050511 Bacteria 4959
439 nmdc:mga0sz30_24961_c1 3300050516 Bacteria 2443
440 Ga0495619_0214433 3300053085 Bacteria 1333
441 Ga0500641_0079456 3300053096 Bacteria 1390
442 Ga0500556_0001590 3300053104 Bacteria 9084
443 Ga0500593_002019 3300053117 Bacteria 7366
444 Ga0501084_0008123 3300054114 Bacteria 8646
445 Ga0501084_0031586 3300054114 Bacteria 4426
446 Ga0501084_0051759 3300054114 Bacteria 3437
447 Ga0501084_0121956 3300054114 Bacteria 2192
448 Ga0501084_0157171 3300054114 Bacteria 1918
449 Ga0590075_018868 3300059424 Bacteria 1709
450 Ga0501082_0118818 3300060353 Bacteria 2290
451 Ga0501082_0329335 3300060353 Bacteria 1331
452 Ga0466962_0058050 3300061719 Bacteria 1848
453 Ga0530510_0023499 3300061734 Bacteria 4393
454 Ga0530510_0095129 3300061734 Bacteria 2176
455 Ga0530510_0166511 3300061734 Bacteria 1632
456 2643824877 2643221561 Bacteria 4984412
457 2643892722 2643221576 Bacteria 5214352
458 2643962171 2643221590 Bacteria 5214697
459 2644093323 2643221615 Bacteria 5487866
460 2644100087 2643221617 Bacteria 5139111
461 2644117693 2643221620 Bacteria 5134593
462 2644232066 2643221641 Bacteria 4490190
463 2644322933 2643221657 Bacteria 5490246
464 2644454928 2643221681 Bacteria 3707866
465 2644532572 2643221696 Bacteria 5431823
466 2645721888 2643221961 Bacteria 3919167
467 2645724166 2643221962 Bacteria 3874254
468 2738870909 2738541305 Bacteria 4910150
469 2740168560 2739367898 Bacteria 4367674
470 2774395071 2773857762 Bacteria 5971770
471 2812334980 2811994874 Bacteria 5367947
472 2812348827 2811994878 Bacteria 5992952
473 2816422724 2816332119 Bacteria 8120218
474 2855390146 2855386786 Bacteria 4752232
475 2857485326 2857481737 Bacteria 4761446
476 2891973409 2891968417 Bacteria 5821697
477 2984577758 2984576629 Bacteria 4248407
478 2984593451 2984592036 Bacteria 3670284
479 2990260543 2990256926 Bacteria 4252839
480 8054611471 8054609563 Bacteria 5170090
481 Ga0501071_0245565
482 JGI24746J21847_1010184
483 JGI24739J22299_10013565
484 JGI24735J21928_10018897
485 JGI25407J50210_10010173
486 JGI25405J52794_10009168
487 Ga0070658_10088364
488 Ga0070683_100001487
489 Ga0070683_100023273
490 Ga0070683_100024800
491 Ga0070683_100085385
492 Ga0070683_100089558
493 Ga0070683_100099949
494 Ga0070683_100495938
495 Ga0070670_100248572
496 Ga0068869_100122183
497 Ga0070682_100010949
498 Ga0070682_100029469
499 Ga0068868_100415144
500 Ga0070660_100006162
501 Ga0070660_100024218
502 Ga0070689_100108369
503 Ga0070691_10076507
504 Ga0070692_10007370
505 Ga0070669_100247982
506 Ga0070675_100041469
507 Ga0070675_100139033
508 Ga0070674_100050519
509 Ga0070674_100089034
510 Ga0070659_100016728
511 Ga0070659_100139259
512 Ga0070667_100012200
513 Ga0070714_100029013
514 Ga0070701_10004758
515 Ga0070663_100089896
516 Ga0070681_10048876
517 Ga0068867_100049192
518 Ga0070685_10131820
519 Ga0070679_100006485
520 Ga0070684_100000262
521 Ga0070684_100034962
522 Ga0070684_100162435
523 Ga0070684_100354184
524 Ga0068853_100270099
525 Ga0070665_100145168
526 Ga0068855_100328519
527 Ga0070664_100036660
528 Ga0068857_100015867
529 Ga0068857_100365609
530 Ga0068856_100107842
531 Ga0070702_100016860
532 Ga0068852_100080277
533 Ga0068852_100083472
534 Ga0068852_100447190
535 Ga0068864_100017499
536 Ga0068860_100000865
537 Ga0068860_100049466
538 Ga0068862_100233890
539 Ga0081455_10000611
540 Ga0081455_10012434
541 Ga0081538_10000083
542 Ga0081539_10019671
543 Ga0075365_10021558
544 Ga0075365_10031541
545 Ga0075365_10064420
546 Ga0075365_10095869
547 Ga0075365_10117886
548 Ga0075368_10085235
549 Ga0075363_100008599
550 Ga0075363_100016453
551 Ga0075363_100029236
552 Ga0075363_100034617
553 Ga0075364_10003765
554 Ga0075364_10006392
555 Ga0075364_10010788
556 Ga0075364_10017656
557 Ga0075364_10042006
558 Ga0075364_10068737
559 Ga0075362_10057477
560 Ga0075362_10078941
561 Ga0075367_10060599
562 Ga0075367_10063262
563 Ga0075367_10082521
564 Ga0075367_10095037
565 Ga0075367_10099718
566 Ga0075370_10037081
567 Ga0068871_100114936
568 Ga0075428_100072862
569 Ga0075430_100014972
570 Ga0075430_100103564
571 Ga0075431_100013012
572 Ga0075431_100035042
573 Ga0075433_10413143
574 Ga0075429_100001139
575 Ga0075429_100027541
576 Ga0068865_100005308
577 Ga0068865_100103347
578 Ga0075435_100306759
579 Ga0111539_10024691
580 Ga0111539_10047110
581 Ga0111539_10540870
582 Ga0105245_10004239
583 Ga0105245_10008373
584 Ga0105245_10105578
585 Ga0114129_10049945
586 Ga0114129_10169708
587 Ga0105242_10404339
588 Ga0105248_10037832
589 Ga0105248_10186144
590 Ga0105238_10024211
591 Ga0105249_10200663
592 Ga0105249_10750279
593 Ga0105239_10100546
594 Ga0105239_10106242
595 Ga0105239_10320485
596 Ga0105246_10000654
597 Ga0105246_10075321
598 Ga0105246_10186895
599 Ga0105246_10285330
600 Ga0157369_10165352
601 Ga0157378_10531048
602 Ga0163162_10022413
603 Ga0157372_10001247
604 Ga0157372_10102281
605 Ga0157372_10358492
606 Ga0157372_10756533
607 Ga0157375_10039174
608 Ga0157375_10055117
609 Ga0157375_10309874
610 Ga0157375_10413881
611 Ga0157375_10542622
612 Ga0163163_10135169
613 Ga0157380_10010852
614 Ga0157377_10027886
615 Ga0157377_10119315
616 Ga0157379_10013730
617 Ga0206353_10647266
618 Ga0206353_11716301
619 Ga0213875_10014267
620 Ga0224712_10004627
621 Ga0207688_10014761
622 Ga0207647_10013361
623 Ga0207647_10028874
624 Ga0207643_10019327
625 Ga0207705_10011105
626 Ga0207671_10218816
627 Ga0207657_10008625
628 Ga0207657_10023634
629 Ga0207681_10223512
630 Ga0207694_10062527
631 Ga0207650_10290220
632 Ga0207659_10166381
633 Ga0207687_10006142
634 Ga0207687_10068629
635 Ga0207687_10310331
636 Ga0207664_10015324
637 Ga0207690_10071545
638 Ga0207690_10104662
639 Ga0207690_10208799
640 Ga0207709_10028565
641 Ga0207670_10098743
642 Ga0207669_10089302
643 Ga0207704_10008373
644 Ga0207704_10175475
645 Ga0207691_10088474
646 Ga0207711_10581072
647 Ga0207661_10002532
648 Ga0207661_10013829
649 Ga0207661_10047591
650 Ga0207661_10072567
651 Ga0207661_10231622
652 Ga0207679_10014044
653 Ga0207712_10079955
654 Ga0207658_10123608
655 Ga0207677_10228205
656 Ga0207639_10082839
657 Ga0207639_10154517
658 Ga0207678_10097069
659 Ga0207678_10171041
660 Ga0207678_10243344
661 Ga0207708_10000152
662 Ga0207708_10024783
663 Ga0207702_10120882
664 Ga0207648_10010906
665 Ga0207648_10290428
666 Ga0207676_10266346
667 Ga0207674_10009716
668 Ga0207674_10179033
669 Ga0207675_100010622
670 Ga0207683_10188742
671 Ga0207698_10067190
672 Ga0207698_10101791
673 Ga0209813_10002518
674 Ga0207428_10022289
675 Ga0207428_10060327
676 Ga0268266_10003653
677 Ga0268264_10000343
678 Ga0268264_10047034
679 Ga0316181_1060778
680 Ga0307413_10139863
681 Ga0307410_10012357
682 Ga0307410_10290871
683 Ga0307412_10074583
684 Ga0307409_100177245
685 Ga0307416_100007478
686 Ga0307416_100091589
687 Ga0307416_100127138
688 Ga0307414_10219788
689 Ga0307415_100145619
690 Ga0307415_100162618
691 Ga0395899_0043777
692 Ga0395900_0047742
693 Ga0395900_0146056
694 Ga0395905_0218150
695 Ga0395905_0393858
696 Ga0436364_0648623
697 Ga0436364_0658340
698 Ga0395901_0048065
699 Ga0395901_0205061
700 Ga0451837_0044753
701 Ga0451853_0259456
702 Ga0451853_3905993
703 Ga0439431_0004315
704 Ga0439457_008412
705 Ga0450907_002053
706 Ga0439446_0035735
707 Ga0466969_0035458
708 Ga0466972_0067201
709 Ga0466965_0061980
710 Ga0466966_0068167
711 Ga0466966_0135209
712 Ga0466961_0003451
713 Ga0466961_0010476
714 Ga0466961_0112036
715 Ga0466963_0015585
716 Ga0466963_0023457
717 Ga0466963_0087808
718 Ga0466963_0333265
719 Ga0466964_0001426
720 Ga0466971_0006474
721 Ga0466971_0079927
722 Ga0466970_0002483
723 Ga0466970_0004608
724 Ga0466970_0007979
725 Ga0466970_0020506
726 Ga0466970_0029436
727 Ga0466970_0032327
728 Ga0466970_0046365
729 Ga0466970_0088257
730 Ga0466957_0029145
731 Ga0466957_0082632
732 Ga0466957_0115071
733 Ga0466957_0354600
734 Ga0466960_0002630
735 Ga0466960_0004846
736 Ga0466960_0007228
737 Ga0466960_0028056
738 Ga0466960_0031456
739 Ga0466960_0048941
740 Ga0466959_0048605
741 Ga0466959_0116061
742 Ga0466958_0036260
743 Ga0466958_0060943
744 Ga0466958_0067966
745 Ga0466967_0004074
746 Ga0466967_0005536
747 Ga0466967_0011351
748 Ga0466967_0017780
749 Ga0466967_0080615
750 Ga0466967_0090235
751 Ga0466967_0158647
752 Ga0495664_0154526
753 Ga0495585_0021559
754 Ga0495625_0187214
755 Ga0495658_0079676
756 Ga0496101_0004070
757 Ga0496102_0021748
758 Ga0496102_0069566
759 Ga0496102_0103219
760 Ga0496102_0556154
761 Ga0496103_0177604
762 Ga0496104_0008596
763 Ga0496104_0452746
764 Ga0496105_0023402
765 Ga0496106_0029223
766 Ga0496106_0032529
767 Ga0496106_0133524
768 Ga0496107_0013094
769 Ga0496107_0046068
770 Ga0496108_0007708
771 Ga0496108_0025814
772 Ga0496108_0100583
773 Ga0496108_0108099
774 Ga0496109_0015138
775 Ga0496109_0026263
776 Ga0496109_0032626
777 Ga0496109_0080801
778 Ga0496109_0104316
779 Ga0496109_0158474
780 Ga0496110_0017162
781 Ga0496110_0176604
782 Ga0496110_0288712
783 Ga0496111_0005217
784 Ga0496111_0168326
785 Ga0496112_0368475
786 Ga0496113_0311359
787 Ga0496114_0002242
788 Ga0496114_0004492
789 Ga0496114_0020293
790 Ga0496114_0020872
791 Ga0496114_0027500
792 Ga0496114_0056035
793 Ga0496114_0215940
794 Ga0496115_0006725
795 Ga0496115_0052089
796 Ga0496123_0019653
797 Ga0496124_0018702
798 Ga0501031_0012293
799 Ga0501031_0043888
800 Ga0501031_0061729
801 Ga0501032_0091408
802 Ga0501033_0049901
803 Ga0501034_0059531
804 Ga0501034_0085922
805 Ga0501034_0129269
806 Ga0501034_0224308
807 Ga0501036_0014597
808 Ga0501036_0016203
809 Ga0501036_0039455
810 Ga0501036_0267244
811 Ga0501036_0297856
812 Ga0501037_0003601
813 Ga0501037_0061204
814 Ga0501038_0117003
815 Ga0501039_0050391
816 Ga0501039_0053193
817 Ga0501039_0076998
818 Ga0501039_0149647
819 Ga0501039_0221767
820 Ga0501040_0011591
821 Ga0501040_0214025
822 Ga0501041_0011434
823 Ga0501041_0039067
824 Ga0501042_0013773
825 Ga0501042_0052265
826 Ga0501042_0273028
827 Ga0501046_0000356
828 Ga0501046_0096979
829 Ga0501047_0001918
830 Ga0501048_0018298
831 Ga0501048_0022057
832 Ga0501048_0107361
833 Ga0501048_0210355
834 Ga0501048_0427723
835 Ga0501067_0001734
836 Ga0501067_0014748
837 Ga0501067_0033913
838 Ga0501067_0043759
839 Ga0501067_0107081
840 Ga0501068_0025279
841 Ga0501068_0034859
842 Ga0501069_0008000
843 Ga0501069_0030337
844 Ga0501069_0034129
845 Ga0501069_0038107
846 Ga0501070_0003822
847 Ga0501070_0003973
848 Ga0501070_0022881
849 Ga0501070_0080463
850 Ga0501070_0102757
851 Ga0501070_0216239
852 Ga0501071_0006089
853 Ga0501071_0006731
854 Ga0501071_0032601
855 Ga0501071_0055378
856 Ga0501072_0009457
857 Ga0501072_0016782
858 Ga0501072_0033596
859 Ga0501072_0121112
860 Ga0501072_0166227
861 Ga0501073_0004466
862 Ga0501074_0001125
863 Ga0501074_0020190
864 Ga0501074_0037250
865 Ga0501075_0035346
866 Ga0501075_0202381
867 Ga0501075_0435509
868 Ga0501076_0016375
869 Ga0501076_0029433
870 Ga0501076_0123682
871 Ga0501076_0272844
872 Ga0501077_0173297
873 Ga0501077_0193677
874 Ga0501079_0089926
875 Ga0501079_0142589
876 Ga0501079_0153251
877 Ga0501080_0005543
878 Ga0501080_0019451
879 Ga0501080_0045039
880 Ga0501080_0061814
881 Ga0501081_0098576
882 Ga0501083_0007972
883 Ga0501083_0036020
884 Ga0501035_0002174
885 Ga0501035_0218478
886 Ga0501035_0424084
887 Ga0501044_0007434
888 Ga0501044_0248830
889 Ga0501045_0170815
890 nmdc:mga03n38_60381_c1
891 nmdc:mga03n38_7182_c1
892 nmdc:mga03n38_871_c1
893 nmdc:mga03n38_9842_c1
894 nmdc:mga00v17_13407_c1
895 nmdc:mga00v17_14499_c1
896 nmdc:mga00v17_47470_c1
897 nmdc:mga00v17_8454_c1
898 nmdc:mga0yw44_100258_c1
899 nmdc:mga0yw44_134837_c1
900 nmdc:mga0yw44_21162_c1
901 nmdc:mga0yw44_6150_c1
902 nmdc:mga0yw44_65904_c1
903 nmdc:mga0yw44_82841_c1
904 nmdc:mga06z11_25372_c1
905 nmdc:mga06z11_80409_c1
906 nmdc:mga04h51_2016_c1
907 nmdc:mga04h51_6782_c1
908 nmdc:mga07m45_141350_c1
909 nmdc:mga07m45_5629_c1
910 nmdc:mga05p37_304_c1
911 nmdc:mga05p37_57319_c1
912 nmdc:mga09592_403454_c1
913 nmdc:mga09592_79439_c1
914 nmdc:mga0qj67_3591_c1
915 nmdc:mga06r32_7022_c1
916 nmdc:mga06r32_83_c1
917 nmdc:mga06r32_94852_c1
918 nmdc:mga08y16_39397_c1
919 nmdc:mga0sz30_24961_c1
920 Ga0495619_0214433
921 Ga0500641_0079456
922 Ga0500556_0001590
923 Ga0500593_002019
924 Ga0501084_0008123
925 Ga0501084_0031586
926 Ga0501084_0051759
927 Ga0501084_0121956
928 Ga0501084_0157171
929 Ga0590075_018868
930 Ga0501082_0118818
931 Ga0501082_0329335
932 Ga0466962_0058050
933 Ga0530510_0023499
934 Ga0530510_0095129
935 Ga0530510_0166511
936 2643824877
937 2643892722
938 2643962171
939 2644093323
940 2644100087
941 2644117693
942 2644232066
943 2644322933
944 2644454928
945 2644532572
946 2645721888
947 2645724166
948 2738870909
949 2740168560
950 2774395071
951 2812334980
952 2812348827
953 2816422724
954 2855390146
955 2857485326
956 2891973409
957 2984577758
958 2984593451
959 2990260543
960 8054611471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02374

ArsA_ATPase

Anion-transporting ATPase

40

230

0.84

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

39

101

0.8

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

42

285

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bs5-assembly1.cif.gz_A crystal structure of amp-pnp-bound bacterial get3-like a and b in mycobacterium tuberculosis 0.8744 6 325
6bs5-assembly1.cif.gz_A crystal structure of amp-pnp-bound bacterial get3-like a and b in mycobacterium tuberculosis 0.8594 6 325
3iqx-assembly1.cif.gz_B adp complex of c.therm. get3 in closed form 0.7541 8 319
4xtr-assembly1.cif.gz_B structure of get3 bound to the transmembrane domain of pep12 0.7422 5 321
2woj-assembly2.cif.gz_A adp-alf4 complex of s. cerevisiae get3 0.742 5 321
ID Description Score Start End Superfamily
af_P9WKX5_18_338_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9075 11 322 3.40.50.300
af_P9WKX5_18_338_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8808 11 322 3.40.50.300
af_I6Y498_6_381_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7299 11 320 3.40.50.300
af_Q12154_1_354_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6992 9 321 3.40.50.300
af_I6Y498_6_381_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6976 11 320 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3N2CP60-F1-model_v4 Arsenite efflux ATP-binding protein ArsA 0.9409 1 325 GO:0005524
GO:0016887
AF-A0A3N2CP60-F1-model_v4 Arsenite efflux ATP-binding protein ArsA 0.9381 1 325 GO:0005524
GO:0016887
AF-A0A6J7BR50-F1-model_v4 Unannotated protein 0.9376 147 325
AF-A0A6G3XVQ4-F1-model_v4 ArsA family ATPase 0.9339 154 289
AF-A0A7V9U8Y3-F1-model_v4 ATPase 0.9333 31 325 GO:0005524
GO:0016887

Map