F452236

General Info

Members Datasets Scaffolds Average Seq Length
480 260 960 190

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10143165|Ga0207664_101431651
Length 221
Sequence MIKIAIILGSTRPGRNGEAVAKWVYDVAKKRSDAEFELVDIKDFNLPLLDEPVPPIMGQYSKPHTKRWAAKVAAFDAYVFVTPEYNHGTSGALKNAIDFLFAEWNNKAGGFVSYGGASGARAVEQLRLVLAEVQMATVRNQVLLSMYTDFENFSVFKPGPTKEQSVNDMLDQLIAWGGALKHFVTNLETEKASNGKSASARSADGERAKTETDEIPPLPGA

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
167 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
168 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
226 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
234 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
235 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
236 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
237 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
238 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
239 2857472729 Cohnella sp. R-74144 Isolate Unclassified
240 2858882152 Micromonospora noduli MED15 Isolate Nodule
241 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
242 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
243 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
244 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
245 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
246 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
247 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
248 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
249 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
250 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
251 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
252 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
253 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
254 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
255 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
256 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
257 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
258 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
259 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
260 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0.42
Isolates 5.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 1.25
Rhizoplane 6.88
Rhizosphere 83.75
Stem 0
Stem Tuber 0
Unclassified 16.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10143165 3300025929 Bacteria 2025
2 SwRhRL2b_contig_1766635 2162886007 Unclassified 2209
3 JGI24035J26624_1002848 3300002126 Bacteria 1614
4 JGI25165J46597_1008733 3300003214 Bacteria 1567
5 JGI25165J46597_1008876 3300003214 Bacteria 1545
6 rootL2_10027723 3300003322 Bacteria 1358
7 rootH1_10201189 3300003323 Bacteria 9908
8 JGI25407J50210_10000324 3300003373 Archaea 8873
9 Ga0058861_11473692 3300004800 Bacteria 601
10 Ga0065704_10181508 3300005289 Bacteria 1229
11 Ga0065712_10001241 3300005290 Bacteria 6376
12 Ga0065712_10081260 3300005290 Bacteria 3009
13 Ga0065715_10196913 3300005293 Bacteria 1382
14 Ga0065707_10025747 3300005295 Bacteria 1767
15 Ga0065707_10093148 3300005295 Bacteria 3667
16 Ga0065707_10399240 3300005295 Bacteria 855
17 Ga0065707_10439031 3300005295 Bacteria 812
18 Ga0070676_10034222 3300005328 Bacteria 2917
19 Ga0070676_10241909 3300005328 Bacteria 1201
20 Ga0070676_10364514 3300005328 Bacteria 997
21 Ga0070683_100039521 3300005329 Bacteria 4331
22 Ga0070690_100177649 3300005330 Bacteria 1469
23 Ga0070690_100521904 3300005330 Bacteria 891
24 Ga0070690_100525699 3300005330 Bacteria 888
25 Ga0070670_100675210 3300005331 Unclassified 928
26 Ga0070677_10095873 3300005333 Bacteria 1299
27 Ga0070677_10098573 3300005333 Bacteria 1284
28 Ga0068869_100494639 3300005334 Unclassified 1020
29 Ga0070666_10067881 3300005335 Bacteria 2421
30 Ga0070689_100117984 3300005340 Unclassified 2117
31 Ga0070689_100128630 3300005340 Unclassified 2029
32 Ga0070689_100487307 3300005340 Bacteria 1054
33 Ga0070689_100735086 3300005340 Unclassified 864
34 Ga0070661_100546630 3300005344 Bacteria 931
35 Ga0070692_10246459 3300005345 Unclassified 1067
36 Ga0070668_100000151 3300005347 Bacteria 44059
37 Ga0070668_100049577 3300005347 Bacteria 3231
38 Ga0070668_100838352 3300005347 Bacteria 819
39 Ga0070668_101137288 3300005347 Bacteria 706
40 Ga0070669_100053497 3300005353 Bacteria 2955
41 Ga0070675_100055069 3300005354 Bacteria 3273
42 Ga0070675_100072617 3300005354 Bacteria 2857
43 Ga0070675_100226135 3300005354 Bacteria 1631
44 Ga0070675_100997741 3300005354 Bacteria 769
45 Ga0070671_100121927 3300005355 Bacteria 2194
46 Ga0070671_100352871 3300005355 Bacteria 1255
47 Ga0070671_100449590 3300005355 Bacteria 1105
48 Ga0070673_100097373 3300005364 Bacteria 2416
49 Ga0070673_100442287 3300005364 Bacteria 1168
50 Ga0070688_100044241 3300005365 Unclassified 2747
51 Ga0070688_100048835 3300005365 Bacteria 2631
52 Ga0070659_100148719 3300005366 Unclassified 1910
53 Ga0070659_101026150 3300005366 Bacteria 725
54 Ga0070667_100153796 3300005367 Bacteria 2022
55 Ga0070667_100663111 3300005367 Bacteria 964
56 Ga0070703_10106099 3300005406 Unclassified 998
57 Ga0070709_10012505 3300005434 Bacteria 4752
58 Ga0070709_10122066 3300005434 Unclassified 1767
59 Ga0070709_10186152 3300005434 Bacteria 1461
60 Ga0070709_10303019 3300005434 Unclassified 1167
61 Ga0070714_100592202 3300005435 Unclassified 1064
62 Ga0070713_100160245 3300005436 Unclassified 2008
63 Ga0070713_100358339 3300005436 Bacteria 1355
64 Ga0070713_100376172 3300005436 Bacteria 1322
65 Ga0070713_100442597 3300005436 Bacteria 1219
66 Ga0070713_100623448 3300005436 Bacteria 1026
67 Ga0070713_101020065 3300005436 Bacteria 798
68 Ga0070710_10104988 3300005437 Bacteria 1688
69 Ga0070710_10165753 3300005437 Unclassified 1373
70 Ga0070710_10185197 3300005437 Unclassified 1306
71 Ga0070710_10399851 3300005437 Bacteria 920
72 Ga0070711_100009962 3300005439 Bacteria 5863
73 Ga0070711_100098546 3300005439 Bacteria 2122
74 Ga0070711_100253555 3300005439 Bacteria 1381
75 Ga0070711_100314345 3300005439 Bacteria 1249
76 Ga0070711_100384413 3300005439 Bacteria 1136
77 Ga0070705_100088469 3300005440 Bacteria 1922
78 Ga0070705_100258496 3300005440 Unclassified 1226
79 Ga0070700_100066755 3300005441 Bacteria 2284
80 Ga0070694_101146637 3300005444 Bacteria 650
81 Ga0070708_100210776 3300005445 Bacteria 1820
82 Ga0070708_100229511 3300005445 Bacteria 1742
83 Ga0070708_100397465 3300005445 Bacteria 1300
84 Ga0070708_100592114 3300005445 Bacteria 1045
85 Ga0070708_100627082 3300005445 Bacteria 1013
86 Ga0070663_100773709 3300005455 Bacteria 821
87 Ga0070678_100094703 3300005456 Bacteria 2299
88 Ga0070662_100270197 3300005457 Bacteria 1373
89 Ga0070706_100004054 3300005467 Bacteria 14231
90 Ga0070706_100006028 3300005467 Bacteria 11457
91 Ga0070706_100038392 3300005467 Bacteria 4419
92 Ga0070706_100108804 3300005467 Bacteria 2579
93 Ga0070706_100214393 3300005467 Bacteria 1797
94 Ga0070706_100267120 3300005467 Bacteria 1597
95 Ga0070706_100400513 3300005467 Bacteria 1278
96 Ga0070707_100051728 3300005468 Bacteria 3937
97 Ga0070707_100097824 3300005468 Bacteria 2843
98 Ga0070707_100104476 3300005468 Unclassified 2746
99 Ga0070707_101334567 3300005468 Bacteria 684
100 Ga0070698_100019935 3300005471 Bacteria 7033
101 Ga0070698_100087816 3300005471 Bacteria 3095
102 Ga0070698_100728250 3300005471 Bacteria 934
103 Ga0070699_100175583 3300005518 Bacteria 1899
104 Ga0070699_100175882 3300005518 Bacteria 1898
105 Ga0070699_100254549 3300005518 Bacteria 1569
106 Ga0070699_100446373 3300005518 Bacteria 1172
107 Ga0070697_100014667 3300005536 Bacteria 6153
108 Ga0070697_100034534 3300005536 Bacteria 4078
109 Ga0070697_100103878 3300005536 Bacteria 2362
110 Ga0070697_100141932 3300005536 Bacteria 2020
111 Ga0070697_100228637 3300005536 Bacteria 1586
112 Ga0070697_100342251 3300005536 Bacteria 1291
113 Ga0068853_100008561 3300005539 Bacteria 8222
114 Ga0070686_100663101 3300005544 Bacteria 828
115 Ga0070696_100557704 3300005546 Bacteria 919
116 Ga0070665_100010314 3300005548 Bacteria 9450
117 Ga0070665_100611334 3300005548 Bacteria 1103
118 Ga0070665_101455607 3300005548 Bacteria 694
119 Ga0070704_100050645 3300005549 Bacteria 2920
120 Ga0070704_100403608 3300005549 Bacteria 1167
121 Ga0070704_100561927 3300005549 Bacteria 998
122 Ga0070664_100415101 3300005564 Bacteria 1232
123 Ga0068857_100311538 3300005577 Bacteria 1452
124 Ga0068856_100920820 3300005614 Bacteria 893
125 Ga0070702_100143432 3300005615 Unclassified 1524
126 Ga0068859_100144696 3300005617 Unclassified 2451
127 Ga0068859_100177918 3300005617 Bacteria 2209
128 Ga0068859_100189092 3300005617 Bacteria 2143
129 Ga0068859_101042421 3300005617 Bacteria 899
130 Ga0068864_100333867 3300005618 Unclassified 1427
131 Ga0068861_100662286 3300005719 Bacteria 966
132 Ga0068863_100025843 3300005841 Bacteria 5602
133 Ga0068863_100786054 3300005841 Bacteria 949
134 Ga0068858_100135282 3300005842 Unclassified 2312
135 Ga0068858_100323149 3300005842 Bacteria 1475
136 Ga0068860_100199587 3300005843 Unclassified 1938
137 Ga0068860_100635383 3300005843 Bacteria 1075
138 Ga0068860_100956633 3300005843 Bacteria 874
139 Ga0068862_100029226 3300005844 Bacteria 4644
140 Ga0068862_100718619 3300005844 Bacteria 969
141 Ga0081538_10007973 3300005981 Archaea 9062
142 Ga0081538_10154754 3300005981 Archaea 1031
143 Ga0070717_10015258 3300006028 Bacteria 5929
144 Ga0070717_10048773 3300006028 Unclassified 3474
145 Ga0070717_10695879 3300006028 Bacteria 923
146 Ga0070715_10019337 3300006163 Unclassified 2611
147 Ga0070715_10092972 3300006163 Bacteria 1391
148 Ga0070716_100118687 3300006173 Bacteria 1652
149 Ga0070716_100203900 3300006173 Bacteria 1316
150 Ga0070716_100358578 3300006173 Bacteria 1035
151 Ga0070716_100589583 3300006173 Bacteria 834
152 Ga0070712_100064064 3300006175 Bacteria 2605
153 Ga0070712_100075682 3300006175 Unclassified 2422
154 Ga0070712_100081374 3300006175 Bacteria 2346
155 Ga0070712_100099223 3300006175 Unclassified 2149
156 Ga0070712_100187066 3300006175 Bacteria 1618
157 Ga0070712_100283455 3300006175 Bacteria 1335
158 Ga0070712_100411193 3300006175 Bacteria 1119
159 Ga0070712_100839810 3300006175 Bacteria 790
160 Ga0068871_100322325 3300006358 Bacteria 1361
161 Ga0068871_100583823 3300006358 Bacteria 1015
162 Ga0075428_100358012 3300006844 Bacteria 1566
163 Ga0075428_100423370 3300006844 Bacteria 1427
164 Ga0075428_100945132 3300006844 Bacteria 913
165 Ga0075433_10139121 3300006852 Bacteria 2158
166 Ga0075434_100711594 3300006871 Bacteria 1022
167 Ga0075434_100941105 3300006871 Bacteria 878
168 Ga0075429_100479529 3300006880 Bacteria 1090
169 Ga0097620_100144696 3300006931 Unclassified 2451
170 Ga0097620_100177917 3300006931 Bacteria 2209
171 Ga0097620_100189099 3300006931 Bacteria 2143
172 Ga0097620_101042508 3300006931 Bacteria 899
173 Ga0099794_10008650 3300007265 Bacteria 4237
174 Ga0099795_10087983 3300007788 Bacteria 1200
175 Ga0111539_10011709 3300009094 Bacteria 11005
176 Ga0111539_10530511 3300009094 Unclassified 1371
177 Ga0111539_11537249 3300009094 Unclassified 772
178 Ga0114129_10002554 3300009147 Bacteria 25291
179 Ga0114129_10134207 3300009147 Bacteria 3398
180 Ga0114129_10178298 3300009147 Bacteria 2893
181 Ga0114129_10623690 3300009147 Bacteria 1394
182 Ga0114129_11539572 3300009147 Bacteria 816
183 Ga0114129_12165595 3300009147 Bacteria 669
184 Ga0105243_10576861 3300009148 Bacteria 1079
185 Ga0105242_10500668 3300009176 Bacteria 1155
186 Ga0105242_10568518 3300009176 Bacteria 1090
187 Ga0105248_10221694 3300009177 Unclassified 2129
188 Ga0105248_10574858 3300009177 Unclassified 1271
189 Ga0105237_10000071 3300009545 Bacteria 135695
190 Ga0105237_10192392 3300009545 Unclassified 2040
191 Ga0105249_10068593 3300009553 Bacteria 3271
192 Ga0105249_10095039 3300009553 Unclassified 2794
193 Ga0105249_10700413 3300009553 Bacteria 1073
194 Ga0099796_10043835 3300010159 Bacteria 1526
195 Ga0099796_10098101 3300010159 Bacteria 1098
196 Ga0099796_10110349 3300010159 Bacteria 1046
197 Ga0105239_10002016 3300010375 Bacteria 26350
198 Ga0105239_10748235 3300010375 Unclassified 1119
199 Ga0105239_11252286 3300010375 Bacteria 855
200 Ga0157374_10030164 3300013296 Bacteria 4921
201 Ga0157374_10054354 3300013296 Bacteria 3735
202 Ga0157374_10301731 3300013296 Bacteria 1585
203 Ga0157378_10233067 3300013297 Bacteria 1755
204 Ga0157378_10304720 3300013297 Bacteria 1543
205 Ga0157378_10420723 3300013297 Bacteria 1320
206 Ga0157378_10546016 3300013297 Bacteria 1163
207 Ga0157378_11152991 3300013297 Unclassified 813
208 Ga0163162_10029619 3300013306 Bacteria 5418
209 Ga0163162_10517346 3300013306 Unclassified 1323
210 Ga0163162_10713047 3300013306 Bacteria 1124
211 Ga0163162_10948191 3300013306 Bacteria 972
212 Ga0157375_10018379 3300013308 Bacteria 6339
213 Ga0157375_10722780 3300013308 Unclassified 1148
214 Ga0163163_10213260 3300014325 Unclassified 1980
215 Ga0163163_10695656 3300014325 Bacteria 1080
216 Ga0157377_10543325 3300014745 Unclassified 820
217 Ga0157379_10050079 3300014968 Unclassified 3728
218 Ga0157379_10106177 3300014968 Bacteria 2521
219 Ga0157376_10311444 3300014969 Unclassified 1494
220 Ga0157376_10444773 3300014969 Bacteria 1263
221 Ga0157376_10907271 3300014969 Bacteria 899
222 Ga0157376_11129665 3300014969 Bacteria 810
223 Ga0224712_10042527 3300022467 Bacteria 1722
224 Ga0207427_106666 3300025231 Bacteria 1437
225 Ga0209233_1000328 3300025261 Bacteria 49534
226 Ga0209130_1014258 3300025284 Bacteria 2002
227 Ga0207673_1001405 3300025290 Bacteria 2623
228 Ga0209758_1008881 3300025297 Bacteria 6384
229 Ga0207426_1013281 3300025302 Bacteria 3057
230 Ga0207697_10067669 3300025315 Unclassified 1493
231 Ga0207653_10123269 3300025885 Bacteria 935
232 Ga0207682_10028852 3300025893 Bacteria 2217
233 Ga0207692_10065260 3300025898 Unclassified 1898
234 Ga0207692_10110443 3300025898 Unclassified 1524
235 Ga0207692_10118908 3300025898 Bacteria 1477
236 Ga0207688_10009125 3300025901 Bacteria 5400
237 Ga0207688_10148995 3300025901 Bacteria 1381
238 Ga0207647_10029082 3300025904 Bacteria 3581
239 Ga0207685_10023105 3300025905 Unclassified 2112
240 Ga0207685_10029939 3300025905 Unclassified 1933
241 Ga0207685_10139543 3300025905 Bacteria 1085
242 Ga0207699_10198716 3300025906 Bacteria 1357
243 Ga0207645_10048630 3300025907 Bacteria 2709
244 Ga0207645_10184047 3300025907 Unclassified 1371
245 Ga0207645_10288481 3300025907 Bacteria 1091
246 Ga0207645_10441467 3300025907 Bacteria 878
247 Ga0207684_10000126 3300025910 Bacteria 140178
248 Ga0207684_10004669 3300025910 Bacteria 12863
249 Ga0207684_10027978 3300025910 Bacteria 4802
250 Ga0207684_10152459 3300025910 Bacteria 1989
251 Ga0207684_10366376 3300025910 Bacteria 1240
252 Ga0207684_10469862 3300025910 Bacteria 1079
253 Ga0207684_10473180 3300025910 Bacteria 1075
254 Ga0207684_10652866 3300025910 Unclassified 896
255 Ga0207671_10000099 3300025914 Bacteria 132378
256 Ga0207693_10017490 3300025915 Bacteria 5718
257 Ga0207693_10091856 3300025915 Bacteria 2380
258 Ga0207693_10099319 3300025915 Bacteria 2282
259 Ga0207693_10240288 3300025915 Bacteria 1422
260 Ga0207693_10740829 3300025915 Bacteria 760
261 Ga0207693_10811759 3300025915 Bacteria 721
262 Ga0207663_10153254 3300025916 Bacteria 1619
263 Ga0207663_10165859 3300025916 Bacteria 1564
264 Ga0207663_10299156 3300025916 Bacteria 1201
265 Ga0207663_10340702 3300025916 Bacteria 1132
266 Ga0207662_10041986 3300025918 Unclassified 2694
267 Ga0207662_10052458 3300025918 Bacteria 2427
268 Ga0207657_10350409 3300025919 Bacteria 1164
269 Ga0207657_10611990 3300025919 Bacteria 849
270 Ga0207646_10008822 3300025922 Bacteria 10054
271 Ga0207646_10018368 3300025922 Bacteria 6524
272 Ga0207646_10087670 3300025922 Unclassified 2785
273 Ga0207646_10113613 3300025922 Bacteria 2431
274 Ga0207646_10166664 3300025922 Bacteria 1989
275 Ga0207646_10198887 3300025922 Bacteria 1810
276 Ga0207646_11270991 3300025922 Bacteria 644
277 Ga0207681_10021701 3300025923 Bacteria 4086
278 Ga0207650_10201893 3300025925 Bacteria 1593
279 Ga0207650_10495255 3300025925 Unclassified 1021
280 Ga0207659_10055871 3300025926 Bacteria 2825
281 Ga0207659_10153523 3300025926 Bacteria 1800
282 Ga0207659_10302134 3300025926 Bacteria 1315
283 Ga0207700_10031365 3300025928 Unclassified 3775
284 Ga0207700_10079063 3300025928 Bacteria 2560
285 Ga0207664_10308627 3300025929 Bacteria 1393
286 Ga0207690_10423619 3300025932 Bacteria 1065
287 Ga0207670_10016908 3300025936 Bacteria 4397
288 Ga0207670_10621932 3300025936 Unclassified 888
289 Ga0207669_10066208 3300025937 Bacteria 2245
290 Ga0207669_10302852 3300025937 Bacteria 1216
291 Ga0207665_10042984 3300025939 Bacteria 3021
292 Ga0207665_10048353 3300025939 Bacteria 2855
293 Ga0207665_10173783 3300025939 Bacteria 1557
294 Ga0207665_10253649 3300025939 Bacteria 1301
295 Ga0207665_10940909 3300025939 Bacteria 686
296 Ga0207691_10007727 3300025940 Bacteria 10350
297 Ga0207691_10151832 3300025940 Bacteria 2036
298 Ga0207691_10482655 3300025940 Unclassified 1053
299 Ga0207711_10122734 3300025941 Unclassified 2321
300 Ga0207689_10498597 3300025942 Bacteria 1020
301 Ga0207679_10266302 3300025945 Unclassified 1464
302 Ga0207679_10830339 3300025945 Bacteria 843
303 Ga0207651_10172794 3300025960 Bacteria 1706
304 Ga0207712_10016100 3300025961 Unclassified 4836
305 Ga0207712_10815673 3300025961 Bacteria 821
306 Ga0207668_10003840 3300025972 Bacteria 8856
307 Ga0207640_10930126 3300025981 Bacteria 761
308 Ga0207677_10570260 3300026023 Unclassified 989
309 Ga0207703_10071655 3300026035 Bacteria 2863
310 Ga0207639_10003212 3300026041 Bacteria 10987
311 Ga0207678_10782855 3300026067 Bacteria 842
312 Ga0207702_10325088 3300026078 Bacteria 1466
313 Ga0207641_10032474 3300026088 Bacteria 4333
314 Ga0207676_10223561 3300026095 Unclassified 1678
315 Ga0207674_10268851 3300026116 Bacteria 1652
316 Ga0207675_100257959 3300026118 Bacteria 1689
317 Ga0207683_10015439 3300026121 Bacteria 6506
318 Ga0207683_10026518 3300026121 Bacteria 5001
319 Ga0210000_1016422 3300027462 Bacteria 1118
320 Ga0209588_1006387 3300027671 Bacteria 3424
321 Ga0209588_1041492 3300027671 Bacteria 1485
322 Ga0207428_10091371 3300027907 Bacteria 2363
323 Ga0268266_10000391 3300028379 Bacteria 66400
324 Ga0268266_10915184 3300028379 Bacteria 848
325 Ga0268266_11724678 3300028379 Unclassified 601
326 Ga0268265_10491178 3300028380 Bacteria 1155
327 Ga0268265_10552367 3300028380 Bacteria 1093
328 Ga0268265_10878465 3300028380 Bacteria 879
329 Ga0268264_10925524 3300028381 Bacteria 876
330 Ga0307515_10000307 3300028794 Bacteria 121172
331 Ga0307515_10229467 3300028794 Bacteria 1653
332 Ga0307515_10348419 3300028794 Bacteria 1129
333 Ga0265338_10017397 3300028800 Bacteria 7751
334 Ga0307513_10000611 3300031456 Bacteria 51109
335 Ga0307513_10001197 3300031456 Bacteria 37689
336 Ga0307513_10120083 3300031456 Bacteria 2599
337 Ga0307508_10100457 3300031616 Bacteria 2488
338 Ga0307410_10016735 3300031852 Bacteria 4383
339 Ga0307406_10006818 3300031901 Bacteria 6320
340 Ga0307407_10041962 3300031903 Bacteria 2562
341 Ga0307416_100179736 3300032002 Bacteria 1981
342 Ga0307414_10318236 3300032004 Bacteria 1323
343 Ga0373943_0050180 3300035170 Bacteria 2050
344 Ga0373935_0031783 3300035692 Bacteria 3278
345 Ga0373935_0083612 3300035692 Bacteria 2078
346 Ga0373927_0370968 3300035695 Unclassified 944
347 Ga0395900_0835965 3300037418 Bacteria 847
348 Ga0395900_0967283 3300037418 Bacteria 772
349 Ga0395905_0000736 3300037471 Bacteria 43138
350 Ga0395905_0091543 3300037471 Bacteria 2851
351 Ga0395905_0180672 3300037471 Bacteria 1981
352 Ga0395905_0214794 3300037471 Bacteria 1801
353 Ga0395901_0098400 3300038443 Bacteria 3067
354 Ga0395901_0665529 3300038443 Bacteria 1043
355 Ga0436363_0440332 3300039450 Bacteria 811
356 Ga0451791_1674464 3300041451 Bacteria 756
357 Ga0451800_0359186 3300041459 Bacteria 1202
358 Ga0451800_1536082 3300041459 Bacteria 1183
359 Ga0451807_0866278 3300041486 Bacteria 3828
360 Ga0466968_0040994 3300044735 Bacteria 1953
361 Ga0451576_0594352 3300045051 Bacteria 1163
362 Ga0466967_0181558 3300045976 Bacteria 1985
363 Ga0495629_0300794 3300046459 Bacteria 1099
364 Ga0495638_0093585 3300046460 Bacteria 1807
365 Ga0495584_0017820 3300046491 Bacteria 3612
366 Ga0495584_0372989 3300046491 Bacteria 725
367 Ga0495585_0109692 3300046492 Unclassified 1469
368 Ga0495583_0082751 3300046506 Bacteria 1392
369 Ga0495630_0563916 3300046517 Bacteria 873
370 Ga0495632_0262048 3300046519 Bacteria 773
371 Ga0495648_0011635 3300046524 Bacteria 6611
372 Ga0495598_0223861 3300046537 Unclassified 688
373 Ga0495625_0349940 3300046660 Bacteria 934
374 Ga0495687_027438 3300047443 Bacteria 2664
375 Ga0495626_0053714 3300048091 Bacteria 1853
376 Ga0496100_0021852 3300048903 Bacteria 3861
377 Ga0496101_0052244 3300048904 Bacteria 2946
378 Ga0496102_0028347 3300048905 Bacteria 5000
379 Ga0496102_0107116 3300048905 Bacteria 2602
380 Ga0496103_0174066 3300048906 Bacteria 1383
381 Ga0496104_0310989 3300048907 Bacteria 1488
382 Ga0496104_0632671 3300048907 Bacteria 979
383 Ga0496106_0033180 3300048909 Bacteria 3851
384 Ga0496106_0407397 3300048909 Bacteria 1093
385 Ga0496107_0012764 3300048910 Bacteria 5870
386 Ga0496108_0012367 3300048911 Bacteria 6945
387 Ga0496108_0199349 3300048911 Bacteria 1737
388 Ga0496108_0403988 3300048911 Bacteria 1193
389 Ga0496108_0534146 3300048911 Bacteria 1024
390 Ga0496109_0149972 3300048912 Bacteria 2183
391 Ga0496109_0201404 3300048912 Bacteria 1871
392 Ga0496109_0345620 3300048912 Bacteria 1405
393 Ga0496110_0117472 3300048913 Unclassified 2395
394 Ga0496110_0457352 3300048913 Unclassified 1163
395 Ga0496111_0117824 3300048914 Bacteria 1960
396 Ga0496111_0290645 3300048914 Unclassified 1212
397 Ga0496112_0020966 3300048915 Bacteria 6206
398 Ga0496112_0030258 3300048915 Bacteria 5238
399 Ga0496112_0075321 3300048915 Bacteria 3338
400 Ga0496112_0204098 3300048915 Bacteria 1935
401 Ga0496113_0051745 3300048916 Bacteria 3066
402 Ga0496113_0079690 3300048916 Bacteria 2508
403 Ga0496113_0233495 3300048916 Unclassified 1467
404 Ga0496115_0313983 3300048918 Bacteria 1283
405 Ga0496117_0000346 3300048920 Bacteria 81937
406 Ga0501031_0137719 3300049568 Archaea 1595
407 Ga0501034_0082923 3300049571 Bacteria 3208
408 Ga0501036_0047481 3300049572 Archaea 3636
409 Ga0501037_0098924 3300049573 Unclassified 2107
410 Ga0501041_0187734 3300049577 Bacteria 1294
411 Ga0501042_0521926 3300049578 Bacteria 863
412 Ga0501043_0414547 3300049579 Bacteria 1016
413 Ga0501047_0587395 3300049581 Unclassified 936
414 Ga0501048_0067967 3300049582 Unclassified 2518
415 Ga0501068_0344215 3300049584 Bacteria 958
416 Ga0501068_0435545 3300049584 Bacteria 847
417 Ga0501070_0039731 3300049586 Bacteria 3923
418 Ga0501070_0131532 3300049586 Bacteria 2067
419 Ga0501071_0060538 3300049587 Archaea 2741
420 Ga0501072_0051522 3300049588 Archaea 3240
421 Ga0501074_0000672 3300049590 Bacteria 21334
422 Ga0501075_0105158 3300049591 Unclassified 2145
423 Ga0501076_0056610 3300049592 Unclassified 3112
424 Ga0501079_0042670 3300049741 Archaea 3502
425 Ga0501081_0124632 3300049743 Unclassified 1837
426 Ga0501081_0201797 3300049743 Bacteria 1442
427 Ga0501044_0161671 3300049823 Bacteria 2216
428 Ga0501045_0026935 3300049824 Archaea 4138
429 nmdc:mga05p37_234217_c1 3300050507 Bacteria 2211
430 nmdc:mga05p37_255337_c1 3300050507 Unclassified 2101
431 nmdc:mga05p37_318764_c1 3300050507 Bacteria 1840
432 nmdc:mga05p37_3601_c1 3300050507 Bacteria 18098
433 nmdc:mga0qj67_510603_c1 3300050509 Bacteria 966
434 nmdc:mga0qj67_585067_c1 3300050509 Bacteria 894
435 nmdc:mga06r32_330294_c1 3300050510 Bacteria 1510
436 nmdc:mga08y16_1071560_c1 3300050511 Bacteria 782
437 nmdc:mga08y16_1568549_c1 3300050511 Unclassified 617
438 nmdc:mga08y16_443977_c1 3300050511 Bacteria 1324
439 nmdc:mga0n895_195410_c1 3300050512 Bacteria 2054
440 nmdc:mga0n895_980632_c1 3300050512 Bacteria 827
441 nmdc:mga08x19_341452_c1 3300050514 Bacteria 1044
442 nmdc:mga08x19_734658_c1 3300050514 Unclassified 701
443 Ga0500556_0107799 3300053104 Bacteria 1078
444 Ga0500608_023308 3300053122 Bacteria 2880
445 Ga0500616_0000078 3300053153 Bacteria 202009
446 Ga0500616_0018961 3300053153 Bacteria 3886
447 Ga0500622_0000697 3300053156 Bacteria 29561
448 Ga0500645_035729 3300053730 Bacteria 1480
449 Ga0590075_003677 3300059424 Archaea 3639
450 Ga0501082_0076178 3300060353 Unclassified 2891
451 Ga0501082_0361585 3300060353 Bacteria 1266
452 Ga0530510_0012439 3300061734 Archaea 5978
453 2772645874 2772190715 Bacteria 6959372
454 2795795515 2795385472 Bacteria 6627535
455 2816420707 2816332119 Bacteria 8120218
456 2855675039 2855670206 Bacteria 7120389
457 2855680002 2855676851 Bacteria 7063653
458 2857293466 2857288857 Bacteria 7189066
459 2857476260 2857472729 Bacteria 6568124
460 2858882343 2858882152 Bacteria 7230291
461 2858892816 2858888857 Bacteria 7060307
462 2858895733 2858895516 Bacteria 7378898
463 2858908047 2858902515 Bacteria 7086037
464 2862995177 2862993130 Bacteria 3860849
465 2867302492 2867302475 Bacteria 7087181
466 2867350656 2867346516 Bacteria 7608576
467 2869055059 2869048445 Bacteria 6875584
468 2869062817 2869061728 Bacteria 7112407
469 2869072478 2869068681 Bacteria 7205615
470 2880491007 2880489317 Bacteria 7096270
471 2880501491 2880495981 Bacteria 7340502
472 2929229972 2929226422 Bacteria 7248583
473 2960605780 2960603979 Bacteria 6898737
474 8003834265 8003830390 Bacteria 6541657
475 8003876224 8003870546 Bacteria 7396674
476 8025538564 8025530807 Bacteria 8495698
477 8054709184 8054704163 Bacteria 7247792
478 8054728582 8054727385 Bacteria 7558670
479 8054736971 8054734606 Bacteria 6947278
480 8057347981 8057345674 Bacteria 4160394
481 Ga0207664_10143165
482 SwRhRL2b_contig_1766635
483 JGI24035J26624_1002848
484 JGI25165J46597_1008733
485 JGI25165J46597_1008876
486 rootL2_10027723
487 rootH1_10201189
488 JGI25407J50210_10000324
489 Ga0058861_11473692
490 Ga0065704_10181508
491 Ga0065712_10001241
492 Ga0065712_10081260
493 Ga0065715_10196913
494 Ga0065707_10025747
495 Ga0065707_10093148
496 Ga0065707_10399240
497 Ga0065707_10439031
498 Ga0070676_10034222
499 Ga0070676_10241909
500 Ga0070676_10364514
501 Ga0070683_100039521
502 Ga0070690_100177649
503 Ga0070690_100521904
504 Ga0070690_100525699
505 Ga0070670_100675210
506 Ga0070677_10095873
507 Ga0070677_10098573
508 Ga0068869_100494639
509 Ga0070666_10067881
510 Ga0070689_100117984
511 Ga0070689_100128630
512 Ga0070689_100487307
513 Ga0070689_100735086
514 Ga0070661_100546630
515 Ga0070692_10246459
516 Ga0070668_100000151
517 Ga0070668_100049577
518 Ga0070668_100838352
519 Ga0070668_101137288
520 Ga0070669_100053497
521 Ga0070675_100055069
522 Ga0070675_100072617
523 Ga0070675_100226135
524 Ga0070675_100997741
525 Ga0070671_100121927
526 Ga0070671_100352871
527 Ga0070671_100449590
528 Ga0070673_100097373
529 Ga0070673_100442287
530 Ga0070688_100044241
531 Ga0070688_100048835
532 Ga0070659_100148719
533 Ga0070659_101026150
534 Ga0070667_100153796
535 Ga0070667_100663111
536 Ga0070703_10106099
537 Ga0070709_10012505
538 Ga0070709_10122066
539 Ga0070709_10186152
540 Ga0070709_10303019
541 Ga0070714_100592202
542 Ga0070713_100160245
543 Ga0070713_100358339
544 Ga0070713_100376172
545 Ga0070713_100442597
546 Ga0070713_100623448
547 Ga0070713_101020065
548 Ga0070710_10104988
549 Ga0070710_10165753
550 Ga0070710_10185197
551 Ga0070710_10399851
552 Ga0070711_100009962
553 Ga0070711_100098546
554 Ga0070711_100253555
555 Ga0070711_100314345
556 Ga0070711_100384413
557 Ga0070705_100088469
558 Ga0070705_100258496
559 Ga0070700_100066755
560 Ga0070694_101146637
561 Ga0070708_100210776
562 Ga0070708_100229511
563 Ga0070708_100397465
564 Ga0070708_100592114
565 Ga0070708_100627082
566 Ga0070663_100773709
567 Ga0070678_100094703
568 Ga0070662_100270197
569 Ga0070706_100004054
570 Ga0070706_100006028
571 Ga0070706_100038392
572 Ga0070706_100108804
573 Ga0070706_100214393
574 Ga0070706_100267120
575 Ga0070706_100400513
576 Ga0070707_100051728
577 Ga0070707_100097824
578 Ga0070707_100104476
579 Ga0070707_101334567
580 Ga0070698_100019935
581 Ga0070698_100087816
582 Ga0070698_100728250
583 Ga0070699_100175583
584 Ga0070699_100175882
585 Ga0070699_100254549
586 Ga0070699_100446373
587 Ga0070697_100014667
588 Ga0070697_100034534
589 Ga0070697_100103878
590 Ga0070697_100141932
591 Ga0070697_100228637
592 Ga0070697_100342251
593 Ga0068853_100008561
594 Ga0070686_100663101
595 Ga0070696_100557704
596 Ga0070665_100010314
597 Ga0070665_100611334
598 Ga0070665_101455607
599 Ga0070704_100050645
600 Ga0070704_100403608
601 Ga0070704_100561927
602 Ga0070664_100415101
603 Ga0068857_100311538
604 Ga0068856_100920820
605 Ga0070702_100143432
606 Ga0068859_100144696
607 Ga0068859_100177918
608 Ga0068859_100189092
609 Ga0068859_101042421
610 Ga0068864_100333867
611 Ga0068861_100662286
612 Ga0068863_100025843
613 Ga0068863_100786054
614 Ga0068858_100135282
615 Ga0068858_100323149
616 Ga0068860_100199587
617 Ga0068860_100635383
618 Ga0068860_100956633
619 Ga0068862_100029226
620 Ga0068862_100718619
621 Ga0081538_10007973
622 Ga0081538_10154754
623 Ga0070717_10015258
624 Ga0070717_10048773
625 Ga0070717_10695879
626 Ga0070715_10019337
627 Ga0070715_10092972
628 Ga0070716_100118687
629 Ga0070716_100203900
630 Ga0070716_100358578
631 Ga0070716_100589583
632 Ga0070712_100064064
633 Ga0070712_100075682
634 Ga0070712_100081374
635 Ga0070712_100099223
636 Ga0070712_100187066
637 Ga0070712_100283455
638 Ga0070712_100411193
639 Ga0070712_100839810
640 Ga0068871_100322325
641 Ga0068871_100583823
642 Ga0075428_100358012
643 Ga0075428_100423370
644 Ga0075428_100945132
645 Ga0075433_10139121
646 Ga0075434_100711594
647 Ga0075434_100941105
648 Ga0075429_100479529
649 Ga0097620_100144696
650 Ga0097620_100177917
651 Ga0097620_100189099
652 Ga0097620_101042508
653 Ga0099794_10008650
654 Ga0099795_10087983
655 Ga0111539_10011709
656 Ga0111539_10530511
657 Ga0111539_11537249
658 Ga0114129_10002554
659 Ga0114129_10134207
660 Ga0114129_10178298
661 Ga0114129_10623690
662 Ga0114129_11539572
663 Ga0114129_12165595
664 Ga0105243_10576861
665 Ga0105242_10500668
666 Ga0105242_10568518
667 Ga0105248_10221694
668 Ga0105248_10574858
669 Ga0105237_10000071
670 Ga0105237_10192392
671 Ga0105249_10068593
672 Ga0105249_10095039
673 Ga0105249_10700413
674 Ga0099796_10043835
675 Ga0099796_10098101
676 Ga0099796_10110349
677 Ga0105239_10002016
678 Ga0105239_10748235
679 Ga0105239_11252286
680 Ga0157374_10030164
681 Ga0157374_10054354
682 Ga0157374_10301731
683 Ga0157378_10233067
684 Ga0157378_10304720
685 Ga0157378_10420723
686 Ga0157378_10546016
687 Ga0157378_11152991
688 Ga0163162_10029619
689 Ga0163162_10517346
690 Ga0163162_10713047
691 Ga0163162_10948191
692 Ga0157375_10018379
693 Ga0157375_10722780
694 Ga0163163_10213260
695 Ga0163163_10695656
696 Ga0157377_10543325
697 Ga0157379_10050079
698 Ga0157379_10106177
699 Ga0157376_10311444
700 Ga0157376_10444773
701 Ga0157376_10907271
702 Ga0157376_11129665
703 Ga0224712_10042527
704 Ga0207427_106666
705 Ga0209233_1000328
706 Ga0209130_1014258
707 Ga0207673_1001405
708 Ga0209758_1008881
709 Ga0207426_1013281
710 Ga0207697_10067669
711 Ga0207653_10123269
712 Ga0207682_10028852
713 Ga0207692_10065260
714 Ga0207692_10110443
715 Ga0207692_10118908
716 Ga0207688_10009125
717 Ga0207688_10148995
718 Ga0207647_10029082
719 Ga0207685_10023105
720 Ga0207685_10029939
721 Ga0207685_10139543
722 Ga0207699_10198716
723 Ga0207645_10048630
724 Ga0207645_10184047
725 Ga0207645_10288481
726 Ga0207645_10441467
727 Ga0207684_10000126
728 Ga0207684_10004669
729 Ga0207684_10027978
730 Ga0207684_10152459
731 Ga0207684_10366376
732 Ga0207684_10469862
733 Ga0207684_10473180
734 Ga0207684_10652866
735 Ga0207671_10000099
736 Ga0207693_10017490
737 Ga0207693_10091856
738 Ga0207693_10099319
739 Ga0207693_10240288
740 Ga0207693_10740829
741 Ga0207693_10811759
742 Ga0207663_10153254
743 Ga0207663_10165859
744 Ga0207663_10299156
745 Ga0207663_10340702
746 Ga0207662_10041986
747 Ga0207662_10052458
748 Ga0207657_10350409
749 Ga0207657_10611990
750 Ga0207646_10008822
751 Ga0207646_10018368
752 Ga0207646_10087670
753 Ga0207646_10113613
754 Ga0207646_10166664
755 Ga0207646_10198887
756 Ga0207646_11270991
757 Ga0207681_10021701
758 Ga0207650_10201893
759 Ga0207650_10495255
760 Ga0207659_10055871
761 Ga0207659_10153523
762 Ga0207659_10302134
763 Ga0207700_10031365
764 Ga0207700_10079063
765 Ga0207664_10308627
766 Ga0207690_10423619
767 Ga0207670_10016908
768 Ga0207670_10621932
769 Ga0207669_10066208
770 Ga0207669_10302852
771 Ga0207665_10042984
772 Ga0207665_10048353
773 Ga0207665_10173783
774 Ga0207665_10253649
775 Ga0207665_10940909
776 Ga0207691_10007727
777 Ga0207691_10151832
778 Ga0207691_10482655
779 Ga0207711_10122734
780 Ga0207689_10498597
781 Ga0207679_10266302
782 Ga0207679_10830339
783 Ga0207651_10172794
784 Ga0207712_10016100
785 Ga0207712_10815673
786 Ga0207668_10003840
787 Ga0207640_10930126
788 Ga0207677_10570260
789 Ga0207703_10071655
790 Ga0207639_10003212
791 Ga0207678_10782855
792 Ga0207702_10325088
793 Ga0207641_10032474
794 Ga0207676_10223561
795 Ga0207674_10268851
796 Ga0207675_100257959
797 Ga0207683_10015439
798 Ga0207683_10026518
799 Ga0210000_1016422
800 Ga0209588_1006387
801 Ga0209588_1041492
802 Ga0207428_10091371
803 Ga0268266_10000391
804 Ga0268266_10915184
805 Ga0268266_11724678
806 Ga0268265_10491178
807 Ga0268265_10552367
808 Ga0268265_10878465
809 Ga0268264_10925524
810 Ga0307515_10000307
811 Ga0307515_10229467
812 Ga0307515_10348419
813 Ga0265338_10017397
814 Ga0307513_10000611
815 Ga0307513_10001197
816 Ga0307513_10120083
817 Ga0307508_10100457
818 Ga0307410_10016735
819 Ga0307406_10006818
820 Ga0307407_10041962
821 Ga0307416_100179736
822 Ga0307414_10318236
823 Ga0373943_0050180
824 Ga0373935_0031783
825 Ga0373935_0083612
826 Ga0373927_0370968
827 Ga0395900_0835965
828 Ga0395900_0967283
829 Ga0395905_0000736
830 Ga0395905_0091543
831 Ga0395905_0180672
832 Ga0395905_0214794
833 Ga0395901_0098400
834 Ga0395901_0665529
835 Ga0436363_0440332
836 Ga0451791_1674464
837 Ga0451800_0359186
838 Ga0451800_1536082
839 Ga0451807_0866278
840 Ga0466968_0040994
841 Ga0451576_0594352
842 Ga0466967_0181558
843 Ga0495629_0300794
844 Ga0495638_0093585
845 Ga0495584_0017820
846 Ga0495584_0372989
847 Ga0495585_0109692
848 Ga0495583_0082751
849 Ga0495630_0563916
850 Ga0495632_0262048
851 Ga0495648_0011635
852 Ga0495598_0223861
853 Ga0495625_0349940
854 Ga0495687_027438
855 Ga0495626_0053714
856 Ga0496100_0021852
857 Ga0496101_0052244
858 Ga0496102_0028347
859 Ga0496102_0107116
860 Ga0496103_0174066
861 Ga0496104_0310989
862 Ga0496104_0632671
863 Ga0496106_0033180
864 Ga0496106_0407397
865 Ga0496107_0012764
866 Ga0496108_0012367
867 Ga0496108_0199349
868 Ga0496108_0403988
869 Ga0496108_0534146
870 Ga0496109_0149972
871 Ga0496109_0201404
872 Ga0496109_0345620
873 Ga0496110_0117472
874 Ga0496110_0457352
875 Ga0496111_0117824
876 Ga0496111_0290645
877 Ga0496112_0020966
878 Ga0496112_0030258
879 Ga0496112_0075321
880 Ga0496112_0204098
881 Ga0496113_0051745
882 Ga0496113_0079690
883 Ga0496113_0233495
884 Ga0496115_0313983
885 Ga0496117_0000346
886 Ga0501031_0137719
887 Ga0501034_0082923
888 Ga0501036_0047481
889 Ga0501037_0098924
890 Ga0501041_0187734
891 Ga0501042_0521926
892 Ga0501043_0414547
893 Ga0501047_0587395
894 Ga0501048_0067967
895 Ga0501068_0344215
896 Ga0501068_0435545
897 Ga0501070_0039731
898 Ga0501070_0131532
899 Ga0501071_0060538
900 Ga0501072_0051522
901 Ga0501074_0000672
902 Ga0501075_0105158
903 Ga0501076_0056610
904 Ga0501079_0042670
905 Ga0501081_0124632
906 Ga0501081_0201797
907 Ga0501044_0161671
908 Ga0501045_0026935
909 nmdc:mga05p37_234217_c1
910 nmdc:mga05p37_255337_c1
911 nmdc:mga05p37_318764_c1
912 nmdc:mga05p37_3601_c1
913 nmdc:mga0qj67_510603_c1
914 nmdc:mga0qj67_585067_c1
915 nmdc:mga06r32_330294_c1
916 nmdc:mga08y16_1071560_c1
917 nmdc:mga08y16_1568549_c1
918 nmdc:mga08y16_443977_c1
919 nmdc:mga0n895_195410_c1
920 nmdc:mga0n895_980632_c1
921 nmdc:mga08x19_341452_c1
922 nmdc:mga08x19_734658_c1
923 Ga0500556_0107799
924 Ga0500608_023308
925 Ga0500616_0000078
926 Ga0500616_0018961
927 Ga0500622_0000697
928 Ga0500645_035729
929 Ga0590075_003677
930 Ga0501082_0076178
931 Ga0501082_0361585
932 Ga0530510_0012439
933 2772645874
934 2795795515
935 2816420707
936 2855675039
937 2855680002
938 2857293466
939 2857476260
940 2858882343
941 2858892816
942 2858895733
943 2858908047
944 2862995177
945 2867302492
946 2867350656
947 2869055059
948 2869062817
949 2869072478
950 2880491007
951 2880501491
952 2929229972
953 2960605780
954 8003834265
955 8003876224
956 8025538564
957 8054709184
958 8054728582
959 8054736971
960 8057347981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

2

149

0.95

PF02525

Flavodoxin_2

Flavodoxin-like fold

2

128

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gfr-assembly2.cif.gz_B structure of yhda, d137l variant 0.8204 22 194
7bx9-assembly1.cif.gz_A purification, characterization and x-ray structure of yhda-type azoreductase from bacillus velezensis 0.819 18 193
3gfs-assembly1.cif.gz_A structure of yhda, k109d/d137k variant 0.8166 22 194
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8164 22 196
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.8143 22 196
ID Description Score Start End Superfamily
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9615 21 158 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8137 19 190 3.40.50.360
2q62A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8122 17 195 3.40.50.360
af_Q54QT4_9_187_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8115 21 195 3.40.50.360
1t0iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8102 21 192 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A2V5VHQ0-F1-model_v4 NADPH-dependent FMN reductase 0.9983 19 175 GO:0005829
GO:0010181
GO:0016491
AF-A0A7Y6IFD9-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9969 18 201 GO:0005829
GO:0010181
GO:0016491
AF-A0A1H3C706-F1-model_v4 NAD(P)H-dependent FMN reductase 0.9962 18 200 GO:0005829
GO:0010181
GO:0016491
AF-A0A066U3V4-F1-model_v4 NADPH-dependent FMN reductase-like domain-containing protein 0.9961 18 201 GO:0005829
GO:0010181
GO:0016491
GO:0030638
AF-A0A534WI76-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.996 18 141 GO:0005829
GO:0010181
GO:0016491

Map