metagRoot

F452215

General Info

Members	Datasets	Scaffolds	Average Seq Length
480	248	479	162

Family's Representative Sequence

Representative Sequence	3300009177\|Ga0105248_10002931\|Ga0105248_100029318
Length	184
Sequence	MAIKPGWTGRVFEDFTVGDVYEHPLGRTITQADNIWFTCVTMNTNPIHFDAEYASHTEFKRPLVNSCFTLALVTGQSVIDLTINAVANLGWDAVTLPHPVFEGDTIYARSEVLETRESKSRPTVGIVHVKTAGMNQHGTTVIEFRRTFMIWKRGHVPAFAPGGALAGRPASATGSSKSGTTERA

Samples

	Sample ID	Description	Type	Environment
1	2915358134	Pseudonocardia pini CAP47R	Isolate	Unclassified
2	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
3	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
4	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
5	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
6	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
7	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
8	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
9	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
10	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
11	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
12	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
15	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
16	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
17	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
18	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
19	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
20	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
21	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
22	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
23	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
24	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
25	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
26	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
27	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
28	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
29	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
30	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
31	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
32	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
35	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
36	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
37	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
38	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
39	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
40	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
41	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
42	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
43	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
44	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
45	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
46	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
47	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
48	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
49	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
50	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
51	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
52	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
53	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
54	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
55	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
56	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
57	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
58	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
59	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
60	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
61	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
62	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
63	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
64	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
65	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
66	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
67	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
68	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
69	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
70	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
71	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
72	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
73	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
74	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
76	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
77	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
79	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
80	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
82	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
83	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
84	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
85	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
86	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
87	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
88	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
89	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
90	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
91	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
92	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
93	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
94	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
95	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
96	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
97	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
98	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
99	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
145	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
148	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
149	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
150	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
151	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
152	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
153	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
154	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
155	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
156	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
157	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
158	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
159	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
160	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
161	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
162	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
163	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
164	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
165	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
166	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
167	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
168	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
169	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
170	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
171	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
172	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
173	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
174	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
175	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
176	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
177	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
178	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
179	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
180	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
181	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
182	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
183	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
184	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
185	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
186	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
187	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
188	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
189	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
190	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
191	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
192	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
193	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
194	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
195	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
196	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
197	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
198	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
199	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
200	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
201	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
202	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
203	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
204	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
205	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
206	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
207	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
208	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
209	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
210	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
211	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
212	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
213	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
214	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
215	3300049690	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought	Metagenome	Rhizosphere
216	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
217	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
218	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
219	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
220	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
221	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
222	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
223	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
224	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
225	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
226	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
227	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
228	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
229	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
230	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
231	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
232	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
233	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
234	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
235	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
236	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
237	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
238	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
239	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
240	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
241	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
242	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
243	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
244	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
245	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
246	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
247	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
248	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.79
Metatranscriptomes	0
Isolates	0.21

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.79
Nodule	0
Rhizoplane	0.62
Rhizosphere	94.38
Stem	0
Stem Tuber	0
Unclassified	0.21

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065714_10296507	3300005288	Unclassified	700
2	Ga0065714_10361820	3300005288	Bacteria	624
3	Ga0065704_10036343	3300005289	Bacteria	895
4	Ga0065712_10094785	3300005290	Unclassified	2241
5	Ga0065712_10463840	3300005290	Bacteria	676
6	Ga0065712_10734668	3300005290	Bacteria	534
7	Ga0065715_10053601	3300005293	Unclassified	1158
8	Ga0065715_10061980	3300005293	Unclassified	758
9	Ga0065715_10112116	3300005293	Bacteria	2526
10	Ga0065715_10138036	3300005293	Bacteria	1898
11	Ga0065715_10145971	3300005293	Bacteria	1788
12	Ga0065707_10008330	3300005295	Bacteria	2733
13	Ga0070676_10202995	3300005328	Bacteria	1300
14	Ga0070683_101139998	3300005329	Unclassified	749
15	Ga0070690_100100317	3300005330	Bacteria	1919
16	Ga0070690_100145451	3300005330	Bacteria	1612
17	Ga0070670_100249846	3300005331	Bacteria	1545
18	Ga0070670_101205370	3300005331	Bacteria	692
19	Ga0068869_100224958	3300005334	Bacteria	1489
20	Ga0070666_10065246	3300005335	Bacteria	2470
21	Ga0070666_10104501	3300005335	Bacteria	1955
22	Ga0068868_100086438	3300005338	Bacteria	2521
23	Ga0070689_100070412	3300005340	Bacteria	2731
24	Ga0070689_100222879	3300005340	Bacteria	1547
25	Ga0070689_100506805	3300005340	Unclassified	1035
26	Ga0070689_100639006	3300005340	Bacteria	925
27	Ga0070691_10111902	3300005341	Bacteria	1367
28	Ga0070687_100415226	3300005343	Bacteria	886
29	Ga0070687_100415696	3300005343	Bacteria	886
30	Ga0070687_100563295	3300005343	Unclassified	777
31	Ga0070661_100231293	3300005344	Bacteria	1421
32	Ga0070669_100133900	3300005353	Bacteria	1905
33	Ga0070669_100144197	3300005353	Bacteria	1839
34	Ga0070669_100281728	3300005353	Bacteria	1332
35	Ga0070671_100111635	3300005355	Bacteria	2296
36	Ga0070671_100128996	3300005355	Bacteria	2129
37	Ga0070671_100560609	3300005355	Bacteria	986
38	Ga0070673_100019340	3300005364	Bacteria	4887
39	Ga0070673_100035571	3300005364	Bacteria	3778
40	Ga0070688_100082554	3300005365	Bacteria	2083
41	Ga0070688_100228280	3300005365	Bacteria	1316
42	Ga0070688_100571445	3300005365	Bacteria	862
43	Ga0070659_100369255	3300005366	Bacteria	1207
44	Ga0070667_100439392	3300005367	Bacteria	1191
45	Ga0070667_100475284	3300005367	Bacteria	1144
46	Ga0070703_10332710	3300005406	Bacteria	643
47	Ga0070709_10037835	3300005434	Bacteria	2950
48	Ga0070714_100902681	3300005435	Unclassified	858
49	Ga0070713_100097631	3300005436	Bacteria	2539
50	Ga0070713_100477669	3300005436	Bacteria	1174
51	Ga0070701_10249252	3300005438	Bacteria	1071
52	Ga0070705_100035217	3300005440	Bacteria	2805
53	Ga0070705_101522057	3300005440	Unclassified	561
54	Ga0070700_100112638	3300005441	Bacteria	1811
55	Ga0070694_100220345	3300005444	Bacteria	1423
56	Ga0070708_100556512	3300005445	Unclassified	1082
57	Ga0070662_100088162	3300005457	Bacteria	2325
58	Ga0068867_100053511	3300005459	Bacteria	2982
59	Ga0070685_10279011	3300005466	Bacteria	1118
60	Ga0070706_100108078	3300005467	Bacteria	2588
61	Ga0070706_100164564	3300005467	Archaea	2071
62	Ga0070706_100528901	3300005467	Bacteria	1097
63	Ga0070706_100604202	3300005467	Bacteria	1019
64	Ga0070706_100782061	3300005467	Unclassified	884
65	Ga0070707_100053324	3300005468	Bacteria	3877
66	Ga0070698_100159273	3300005471	Bacteria	2202
67	Ga0070698_100702949	3300005471	Bacteria	953
68	Ga0070699_100183725	3300005518	Unclassified	1856
69	Ga0070699_100246683	3300005518	Bacteria	1595
70	Ga0070697_100112362	3300005536	Archaea	2272
71	Ga0070697_100278029	3300005536	Bacteria	1436
72	Ga0070672_100048120	3300005543	Bacteria	3312
73	Ga0070695_100079164	3300005545	Bacteria	2169
74	Ga0070693_100021392	3300005547	Bacteria	3426
75	Ga0068855_101439838	3300005563	Bacteria	709
76	Ga0070664_100534616	3300005564	Bacteria	1083
77	Ga0068854_100116102	3300005578	Bacteria	2025
78	Ga0070702_100006011	3300005615	Bacteria	5713
79	Ga0070702_100254705	3300005615	Unclassified	1192
80	Ga0068852_100395827	3300005616	Bacteria	1358
81	Ga0068859_100295852	3300005617	Bacteria	1712
82	Ga0068859_100362964	3300005617	Bacteria	1543
83	Ga0068859_100685905	3300005617	Bacteria	1115
84	Ga0068859_101058013	3300005617	Bacteria	892
85	Ga0068859_101341124	3300005617	Unclassified	789
86	Ga0068861_100373453	3300005719	Bacteria	1258
87	Ga0068861_100994794	3300005719	Bacteria	800
88	Ga0068861_101231917	3300005719	Bacteria	725
89	Ga0068863_100001180	3300005841	Bacteria	26124
90	Ga0068863_100113587	3300005841	Bacteria	2580
91	Ga0068863_100573875	3300005841	Archaea	1115
92	Ga0068858_100043721	3300005842	Bacteria	4153
93	Ga0068858_100273141	3300005842	Bacteria	1609
94	Ga0068858_101020166	3300005842	Bacteria	811
95	Ga0068860_100170608	3300005843	Bacteria	2101
96	Ga0068860_100200281	3300005843	Bacteria	1935
97	Ga0068860_100544297	3300005843	Bacteria	1163
98	Ga0068862_100116975	3300005844	Unclassified	2346
99	Ga0068862_100413854	3300005844	Bacteria	1264
100	Ga0081455_10133123	3300005937	Bacteria	1941
101	Ga0070717_10103125	3300006028	Bacteria	2425
102	Ga0075368_10011051	3300006042	Bacteria	3279
103	Ga0075363_100130317	3300006048	Bacteria	1410
104	Ga0075364_10003930	3300006051	Bacteria	8523
105	Ga0075364_10035366	3300006051	Bacteria	3228
106	Ga0075364_10038066	3300006051	Bacteria	3116
107	Ga0070716_100162653	3300006173	Unclassified	1448
108	Ga0075362_10015765	3300006177	Bacteria	3080
109	Ga0075367_10003051	3300006178	Bacteria	7850
110	Ga0075367_10026448	3300006178	Bacteria	3291
111	Ga0075367_10308999	3300006178	Bacteria	996
112	Ga0075366_10000950	3300006195	Bacteria	14119
113	Ga0075366_10032917	3300006195	Bacteria	3053
114	Ga0075370_10007599	3300006353	Bacteria	5529
115	Ga0068871_100845321	3300006358	Bacteria	846
116	Ga0068871_101362213	3300006358	Bacteria	668
117	Ga0075428_100010135	3300006844	Bacteria	10469
118	Ga0075428_100124108	3300006844	Bacteria	2811
119	Ga0075428_100748370	3300006844	Unclassified	1040
120	Ga0075428_100798502	3300006844	Bacteria	1003
121	Ga0075430_100155828	3300006846	Bacteria	1902
122	Ga0075430_100607871	3300006846	Bacteria	902
123	Ga0075431_100089082	3300006847	Bacteria	3185
124	Ga0075431_100177049	3300006847	Bacteria	2190
125	Ga0075431_100783818	3300006847	Bacteria	927
126	Ga0075431_100809372	3300006847	Bacteria	910
127	Ga0075433_10053270	3300006852	Bacteria	3527
128	Ga0075433_10110780	3300006852	Bacteria	2436
129	Ga0075433_10272752	3300006852	Bacteria	1499
130	Ga0075433_11160237	3300006852	Bacteria	671
131	Ga0075433_11262081	3300006852	Unclassified	641
132	Ga0075434_100263599	3300006871	Bacteria	1742
133	Ga0075434_100385136	3300006871	Bacteria	1423
134	Ga0075434_100489581	3300006871	Bacteria	1251
135	Ga0075434_100491195	3300006871	Bacteria	1248
136	Ga0075429_100173228	3300006880	Bacteria	1891
137	Ga0075429_100268295	3300006880	Unclassified	1495
138	Ga0075429_100807361	3300006880	Unclassified	822
139	Ga0068865_100122698	3300006881	Bacteria	1935
140	Ga0075436_100062634	3300006914	Bacteria	2571
141	Ga0075436_100067276	3300006914	Bacteria	2476
142	Ga0075436_100368791	3300006914	Bacteria	1037
143	Ga0075436_100419962	3300006914	Unclassified	971
144	Ga0075436_100916957	3300006914	Bacteria	656
145	Ga0075436_100987187	3300006914	Bacteria	632
146	Ga0075436_101429532	3300006914	Unclassified	524
147	Ga0097620_100295819	3300006931	Bacteria	1712
148	Ga0097620_100362985	3300006931	Bacteria	1543
149	Ga0097620_100685919	3300006931	Bacteria	1115
150	Ga0097620_101058146	3300006931	Bacteria	892
151	Ga0097620_101313295	3300006931	Unclassified	797
152	Ga0097620_101341162	3300006931	Unclassified	789
153	Ga0075435_100001349	3300007076	Bacteria	15810
154	Ga0075435_100020422	3300007076	Bacteria	5076
155	Ga0075435_100258641	3300007076	Bacteria	1483
156	Ga0075435_101224350	3300007076	Bacteria	657
157	Ga0105240_10012551	3300009093	Bacteria	11688
158	Ga0111539_10001275	3300009094	Bacteria	33626
159	Ga0111539_10048053	3300009094	Bacteria	5097
160	Ga0111539_10085467	3300009094	Bacteria	3708
161	Ga0111539_10091169	3300009094	Bacteria	3581
162	Ga0111539_10188760	3300009094	Bacteria	2406
163	Ga0111539_10259122	3300009094	Bacteria	2025
164	Ga0111539_10945623	3300009094	Unclassified	1002
165	Ga0105245_10559423	3300009098	Bacteria	1166
166	Ga0105245_11105350	3300009098	Bacteria	839
167	Ga0105247_10289710	3300009101	Unclassified	1132
168	Ga0114129_10003011	3300009147	Bacteria	23612
169	Ga0114129_10003504	3300009147	Bacteria	22071
170	Ga0114129_10006780	3300009147	Bacteria	16261
171	Ga0114129_10017152	3300009147	Bacteria	10312
172	Ga0114129_10018068	3300009147	Bacteria	10044
173	Ga0114129_10036670	3300009147	Bacteria	6922
174	Ga0114129_10082310	3300009147	Bacteria	4473
175	Ga0114129_10103913	3300009147	Bacteria	3927
176	Ga0114129_10111868	3300009147	Bacteria	3767
177	Ga0114129_10130673	3300009147	Bacteria	3449
178	Ga0114129_10610564	3300009147	Bacteria	1412
179	Ga0114129_10821606	3300009147	Unclassified	1184
180	Ga0114129_11087669	3300009147	Bacteria	1002
181	Ga0105243_10083585	3300009148	Bacteria	2612
182	Ga0105243_11201789	3300009148	Bacteria	771
183	Ga0105243_11364188	3300009148	Bacteria	728
184	Ga0105241_10502891	3300009174	Bacteria	1081
185	Ga0105241_10720806	3300009174	Bacteria	912
186	Ga0105242_10071160	3300009176	Bacteria	2886
187	Ga0105242_10175786	3300009176	Bacteria	1885
188	Ga0105242_10807391	3300009176	Unclassified	929
189	Ga0105248_10002931	3300009177	Bacteria	18941
190	Ga0105248_10043582	3300009177	Bacteria	5031
191	Ga0105248_10489209	3300009177	Bacteria	1387
192	Ga0105237_10738688	3300009545	Bacteria	991
193	Ga0105238_11593685	3300009551	Bacteria	683
194	Ga0105249_10404344	3300009553	Bacteria	1396
195	Ga0105239_10345147	3300010375	Bacteria	1680
196	Ga0157326_1088009	3300012513	Unclassified	518
197	Ga0157378_10433635	3300013297	Unclassified	1301
198	Ga0157378_11124989	3300013297	Unclassified	823
199	Ga0163162_10040241	3300013306	Bacteria	4674
200	Ga0157375_10981382	3300013308	Unclassified	985
201	Ga0157375_11880230	3300013308	Unclassified	710
202	Ga0163163_10000008	3300014325	Bacteria	286490
203	Ga0157380_10077304	3300014326	Bacteria	2712
204	Ga0157380_11182158	3300014326	Unclassified	808
205	Ga0157380_11589289	3300014326	Unclassified	709
206	Ga0157379_10014703	3300014968	Bacteria	6866
207	Ga0157379_10272840	3300014968	Bacteria	1538
208	Ga0157376_10100732	3300014969	Bacteria	2523
209	Ga0157376_10229466	3300014969	Unclassified	1724
210	Ga0163161_10407154	3300017792	Bacteria	1092
211	Ga0213871_10056415	3300021441	Bacteria	1087
212	Ga0207680_10069770	3300025903	Bacteria	2173
213	Ga0207680_10265649	3300025903	Unclassified	1189
214	Ga0207647_10170655	3300025904	Bacteria	1266
215	Ga0207685_10139974	3300025905	Bacteria	1084
216	Ga0207699_10036741	3300025906	Bacteria	2795
217	Ga0207699_10862789	3300025906	Bacteria	667
218	Ga0207645_10018222	3300025907	Bacteria	4624
219	Ga0207684_10049819	3300025910	Bacteria	3553
220	Ga0207684_10120783	3300025910	Archaea	2246
221	Ga0207684_10214174	3300025910	Bacteria	1662
222	Ga0207684_10310963	3300025910	Bacteria	1358
223	Ga0207684_10467363	3300025910	Bacteria	1083
224	Ga0207684_10575802	3300025910	Bacteria	962
225	Ga0207654_10372866	3300025911	Bacteria	987
226	Ga0207707_10795341	3300025912	Unclassified	788
227	Ga0207695_10035487	3300025913	Bacteria	5407
228	Ga0207671_10950724	3300025914	Unclassified	678
229	Ga0207662_10077892	3300025918	Bacteria	2017
230	Ga0207662_10118020	3300025918	Bacteria	1661
231	Ga0207662_10889063	3300025918	Bacteria	630
232	Ga0207652_10756598	3300025921	Bacteria	864
233	Ga0207646_10091298	3300025922	Bacteria	2726
234	Ga0207681_10024591	3300025923	Bacteria	3867
235	Ga0207681_10144342	3300025923	Bacteria	1776
236	Ga0207681_10348162	3300025923	Bacteria	1185
237	Ga0207681_10429476	3300025923	Bacteria	1072
238	Ga0207650_10521845	3300025925	Bacteria	994
239	Ga0207659_10679802	3300025926	Bacteria	881
240	Ga0207687_10133388	3300025927	Bacteria	1875
241	Ga0207700_10442545	3300025928	Bacteria	1144
242	Ga0207700_10456737	3300025928	Unclassified	1126
243	Ga0207664_10151230	3300025929	Bacteria	1972
244	Ga0207644_10009064	3300025931	Bacteria	6524
245	Ga0207644_10020501	3300025931	Bacteria	4494
246	Ga0207706_10249257	3300025933	Bacteria	1551
247	Ga0207686_10237999	3300025934	Bacteria	1323
248	Ga0207670_10199427	3300025936	Bacteria	1519
249	Ga0207670_11502934	3300025936	Unclassified	572
250	Ga0207669_10217284	3300025937	Bacteria	1400
251	Ga0207665_10211185	3300025939	Unclassified	1418
252	Ga0207691_10013618	3300025940	Bacteria	7772
253	Ga0207691_10078883	3300025940	Bacteria	2964
254	Ga0207711_10071145	3300025941	Bacteria	3018
255	Ga0207711_10085677	3300025941	Bacteria	2761
256	Ga0207689_10140182	3300025942	Bacteria	1992
257	Ga0207689_10354065	3300025942	Bacteria	1221
258	Ga0207679_10118788	3300025945	Bacteria	2101
259	Ga0207667_11074867	3300025949	Bacteria	789
260	Ga0207651_10072964	3300025960	Bacteria	2439
261	Ga0207651_10187069	3300025960	Bacteria	1648
262	Ga0207640_10047473	3300025981	Bacteria	2770
263	Ga0207658_10058202	3300025986	Bacteria	2875
264	Ga0207658_10085893	3300025986	Bacteria	2425
265	Ga0207677_10406078	3300026023	Bacteria	1156
266	Ga0207703_10392740	3300026035	Bacteria	1285
267	Ga0207678_10373064	3300026067	Bacteria	1233
268	Ga0207708_10020618	3300026075	Bacteria	4971
269	Ga0207641_10006659	3300026088	Bacteria	9698
270	Ga0207641_10610812	3300026088	Unclassified	1068
271	Ga0207641_11663369	3300026088	Bacteria	640
272	Ga0207648_10005372	3300026089	Bacteria	12914
273	Ga0207648_11573262	3300026089	Bacteria	618
274	Ga0207648_12020528	3300026089	Unclassified	538
275	Ga0207676_11285255	3300026095	Unclassified	726
276	Ga0207674_10754577	3300026116	Bacteria	939
277	Ga0207675_100079425	3300026118	Bacteria	3074
278	Ga0207675_101499876	3300026118	Bacteria	695
279	Ga0207683_10251114	3300026121	Bacteria	1614
280	Ga0207683_10581416	3300026121	Unclassified	1036
281	Ga0207698_10139067	3300026142	Bacteria	2089
282	Ga0209996_1007643	3300027395	Bacteria	1410
283	Ga0207428_10001852	3300027907	Bacteria	21614
284	Ga0207428_10033439	3300027907	Bacteria	4223
285	Ga0207428_10038828	3300027907	Bacteria	3868
286	Ga0207428_10975222	3300027907	Bacteria	596
287	Ga0268265_10386195	3300028380	Bacteria	1290
288	Ga0268265_10457240	3300028380	Bacteria	1194
289	Ga0268265_11163876	3300028380	Bacteria	768
290	Ga0268264_10039677	3300028381	Bacteria	3890
291	Ga0268264_10173067	3300028381	Bacteria	1954
292	Ga0316182_1055166	3300030745	Bacteria	695
293	Ga0307408_100454069	3300031548	Bacteria	1112
294	Ga0307405_10457549	3300031731	Bacteria	1013
295	Ga0307413_10524269	3300031824	Bacteria	956
296	Ga0307412_11334963	3300031911	Unclassified	647
297	Ga0307409_100396109	3300031995	Bacteria	1317
298	Ga0307409_100819969	3300031995	Bacteria	939
299	Ga0307416_100017459	3300032002	Bacteria	5024
300	Ga0307416_100249604	3300032002	Bacteria	1726
301	Ga0307416_100722502	3300032002	Unclassified	1087
302	Ga0307411_10039631	3300032005	Bacteria	2982
303	Ga0307415_100283177	3300032126	Bacteria	1364
304	Ga0307415_102125837	3300032126	Bacteria	548
305	Ga0373934_0000427	3300035086	Bacteria	14739
306	Ga0373936_0150501	3300035113	Bacteria	1009
307	Ga0373936_0244394	3300035113	Bacteria	800
308	Ga0373941_0036828	3300035115	Bacteria	1490
309	Ga0373953_0089791	3300035117	Bacteria	1284
310	Ga0373954_0017659	3300035118	Bacteria	3206
311	Ga0373954_0427171	3300035118	Bacteria	656
312	Ga0373956_0014045	3300035119	Bacteria	3340
313	Ga0373957_0241028	3300035120	Unclassified	759
314	Ga0373960_0007326	3300035121	Bacteria	2611
315	Ga0373955_0010426	3300035172	Bacteria	4389
316	Ga0373955_0235172	3300035172	Unclassified	1097
317	Ga0373955_0342304	3300035172	Bacteria	905
318	Ga0373962_0019742	3300035242	Bacteria	1765
319	Ga0373931_0160905	3300035691	Bacteria	1316
320	Ga0373935_0314154	3300035692	Bacteria	1110
321	Ga0373933_0146177	3300035724	Bacteria	1495
322	Ga0373933_0251834	3300035724	Bacteria	1137
323	Ga0373937_0000108	3300036401	Bacteria	79022
324	Ga0373937_0028308	3300036401	Bacteria	5069
325	Ga0373937_0147145	3300036401	Bacteria	2206
326	Ga0373925_0002470	3300037068	Bacteria	14784
327	Ga0373925_0846984	3300037068	Bacteria	754
328	Ga0373925_0965649	3300037068	Bacteria	702
329	Ga0436360_1357140	3300039438	Bacteria	11037
330	Ga0436362_0520128	3300039453	Unclassified	612
331	Ga0439462_0053324	3300042015	Bacteria	1089
332	Ga0439435_0001518	3300042436	Bacteria	4329
333	Ga0439460_0013360	3300042461	Bacteria	2147
334	Ga0453683_0129388	3300044673	Bacteria	1590
335	Ga0453683_0148224	3300044673	Bacteria	1482
336	Ga0466963_0157425	3300044694	Unclassified	1580
337	Ga0466963_0353165	3300044694	Bacteria	1035
338	Ga0451576_0000492	3300045051	Bacteria	87364
339	Ga0451576_0006870	3300045051	Bacteria	13784
340	Ga0451576_2426517	3300045051	Bacteria	536
341	Ga0466967_2360807	3300045976	Bacteria	527
342	Ga0495592_0147889	3300046454	Bacteria	1627
343	Ga0495590_0347666	3300046457	Bacteria	563
344	Ga0495662_0275200	3300046476	Unclassified	829
345	Ga0495628_0045121	3300046516	Bacteria	3506
346	Ga0495628_0079879	3300046516	Bacteria	2543
347	Ga0495628_0391769	3300046516	Unclassified	1016
348	Ga0495628_0550085	3300046516	Bacteria	829
349	Ga0495640_0496675	3300046533	Bacteria	743
350	Ga0495659_0018450	3300046664	Bacteria	2325
351	Ga0495599_0066176	3300046678	Bacteria	2258
352	Ga0495599_0408899	3300046678	Unclassified	807
353	Ga0495646_0432878	3300046680	Bacteria	681
354	Ga0495674_0256053	3300047319	Bacteria	1439
355	Ga0495674_0498685	3300047319	Bacteria	974
356	Ga0495680_0261512	3300047322	Bacteria	1224
357	Ga0495684_0115581	3300047471	Bacteria	2023
358	Ga0495602_0552300	3300048088	Unclassified	798
359	Ga0496102_0718403	3300048905	Bacteria	922
360	Ga0496110_0751968	3300048913	Unclassified	878
361	Ga0496113_0416615	3300048916	Bacteria	1079
362	Ga0501031_0055431	3300049568	Bacteria	2583
363	Ga0501033_0632130	3300049570	Unclassified	732
364	Ga0501036_0149781	3300049572	Bacteria	1968
365	Ga0501038_0050668	3300049574	Bacteria	3587
366	Ga0501039_0221804	3300049575	Bacteria	1486
367	Ga0501039_0843591	3300049575	Bacteria	714
368	Ga0501040_0028550	3300049576	Bacteria	3762
369	Ga0501040_0064786	3300049576	Bacteria	2516
370	Ga0501041_0141579	3300049577	Bacteria	1500
371	Ga0501042_0227135	3300049578	Unclassified	1346
372	Ga0501043_0854570	3300049579	Unclassified	655
373	Ga0501046_0291994	3300049580	Bacteria	1192
374	Ga0501048_0040565	3300049582	Bacteria	3336
375	Ga0501048_0298740	3300049582	Bacteria	1146
376	Ga0501048_0381228	3300049582	Bacteria	1007
377	Ga0501048_0485521	3300049582	Bacteria	886
378	Ga0501048_0581620	3300049582	Bacteria	804
379	Ga0501067_0061135	3300049583	Bacteria	2085
380	Ga0501069_0152726	3300049585	Bacteria	1327
381	Ga0501071_0303195	3300049587	Bacteria	1211
382	Ga0501072_0447513	3300049588	Bacteria	1023
383	Ga0501075_0029761	3300049591	Bacteria	4040
384	Ga0501075_0143906	3300049591	Bacteria	1817
385	Ga0501075_0149145	3300049591	Bacteria	1782
386	Ga0501075_0303085	3300049591	Bacteria	1217
387	Ga0501076_0052276	3300049592	Bacteria	3236
388	Ga0501077_0029238	3300049593	Bacteria	3504
389	Ga0501202_057417	3300049652	Bacteria	873
390	Ga0501235_104498	3300049669	Bacteria	695
391	Ga0501261_066614	3300049690	Bacteria	623
392	Ga0501221_033784	3300049704	Unclassified	1082
393	Ga0501225_0339115	3300049705	Bacteria	517
394	Ga0501079_0186256	3300049741	Unclassified	1620
395	Ga0501080_0845543	3300049742	Unclassified	800
396	Ga0501081_0031805	3300049743	Bacteria	3577
397	Ga0501081_0051415	3300049743	Bacteria	2842
398	Ga0501081_0078599	3300049743	Bacteria	2306
399	Ga0501081_0533931	3300049743	Bacteria	876
400	Ga0501083_0446339	3300049744	Bacteria	842
401	Ga0501045_0007421	3300049824	Bacteria	7622
402	nmdc:mga03683_26132_c1	3300050489	Bacteria	2301
403	nmdc:mga03n38_493820_c1	3300050490	Bacteria	686
404	nmdc:mga00v17_234525_c1	3300050491	Bacteria	1189
405	nmdc:mga00v17_6186_c1	3300050491	Bacteria	6346
406	nmdc:mga00v17_97723_c1	3300050491	Bacteria	1851
407	nmdc:mga0k408_41633_c1	3300050493	Bacteria	2645
408	nmdc:mga0k408_6738_c1	3300050493	Bacteria	6127
409	nmdc:mga06z11_107983_c1	3300050494	Bacteria	1537
410	nmdc:mga06z11_37729_c1	3300050494	Bacteria	2394
411	nmdc:mga04h51_39851_c1	3300050495	Bacteria	1528
412	nmdc:mga07m45_232901_c1	3300050496	Bacteria	1072
413	nmdc:mga05p37_106097_c1	3300050507	Bacteria	3456
414	nmdc:mga05p37_12607_c1	3300050507	Bacteria	10095
415	nmdc:mga05p37_1631_c1	3300050507	Bacteria	26000
416	nmdc:mga05p37_172780_c1	3300050507	Bacteria	2634
417	nmdc:mga05p37_21514_c2	3300050507	Bacteria	3495
418	nmdc:mga05p37_242206_c1	3300050507	Unclassified	2168
419	nmdc:mga05p37_243791_c1	3300050507	Bacteria	2159
420	nmdc:mga05p37_34019_c1	3300050507	Bacteria	6242
421	nmdc:mga05p37_5_c1	3300050507	Bacteria	158201
422	nmdc:mga05p37_697940_c1	3300050507	Bacteria	1128
423	nmdc:mga05p37_856966_c1	3300050507	Unclassified	986
424	nmdc:mga05p37_918230_c1	3300050507	Bacteria	941
425	nmdc:mga09592_189519_c1	3300050508	Bacteria	1780
426	nmdc:mga09592_224323_c1	3300050508	Bacteria	1628
427	nmdc:mga09592_722844_c1	3300050508	Bacteria	846
428	nmdc:mga0qj67_224684_c1	3300050509	Bacteria	1524
429	nmdc:mga0qj67_292198_c1	3300050509	Bacteria	1321
430	nmdc:mga0qj67_562560_c1	3300050509	Bacteria	914
431	nmdc:mga06r32_1055095_c1	3300050510	Bacteria	763
432	nmdc:mga06r32_720186_c1	3300050510	Bacteria	962
433	nmdc:mga08y16_289040_c1	3300050511	Bacteria	1690
434	nmdc:mga08y16_30257_c1	3300050511	Bacteria	5700
435	nmdc:mga08y16_338088_c1	3300050511	Bacteria	1548
436	nmdc:mga08y16_608953_c1	3300050511	Unclassified	1100
437	nmdc:mga08y16_61995_c1	3300050511	Bacteria	3905
438	nmdc:mga08y16_70364_c1	3300050511	Bacteria	3647
439	nmdc:mga08y16_73224_c1	3300050511	Bacteria	3569
440	nmdc:mga08y16_78812_c1	3300050511	Bacteria	3434
441	nmdc:mga08y16_884_c1	3300050511	Bacteria	28890
442	nmdc:mga0n895_112632_c1	3300050512	Bacteria	2738
443	nmdc:mga0n895_452709_c1	3300050512	Bacteria	1296
444	nmdc:mga0n895_695263_c1	3300050512	Bacteria	1013
445	nmdc:mga0n895_717951_c1	3300050512	Archaea	994
446	nmdc:mga0n895_726401_c1	3300050512	Bacteria	988
447	nmdc:mga0n895_78875_c1	3300050512	Bacteria	3278
448	nmdc:mga0n895_9403_c1	3300050512	Bacteria	8552
449	nmdc:mga0rr50_246376_c1	3300050513	Bacteria	1483
450	nmdc:mga0rr50_273822_c1	3300050513	Bacteria	1407
451	nmdc:mga0rr50_395601_c1	3300050513	Bacteria	1167
452	nmdc:mga08x19_1045488_c1	3300050514	Unclassified	580
453	nmdc:mga08x19_185232_c1	3300050514	Unclassified	1423
454	nmdc:mga08x19_29814_c1	3300050514	Bacteria	3424
455	nmdc:mga08x19_347987_c1	3300050514	Unclassified	1034
456	nmdc:mga08x19_56186_c1	3300050514	Bacteria	2540
457	nmdc:mga08x19_869316_c1	3300050514	Bacteria	640
458	nmdc:mga08x19_95404_c1	3300050514	Bacteria	1968
459	nmdc:mga0a205_125403_c1	3300050515	Bacteria	2467
460	nmdc:mga0a205_156035_c1	3300050515	Bacteria	2181
461	nmdc:mga0a205_169316_c1	3300050515	Bacteria	2080
462	nmdc:mga0a205_939411_c1	3300050515	Bacteria	712
463	nmdc:mga0a205_97063_c1	3300050515	Bacteria	2846
464	nmdc:mga0a205_999916_c1	3300050515	Unclassified	683
465	Ga0495601_0176921	3300053077	Bacteria	1395
466	Ga0495612_0222088	3300053078	Bacteria	837
467	Ga0495595_0307393	3300053084	Bacteria	798
468	Ga0501084_0152064	3300054114	Bacteria	1951
469	Ga0590071_000020	3300059421	Bacteria	42190
470	Ga0590074_000055	3300059423	Bacteria	11354
471	Ga0590075_000513	3300059424	Bacteria	10513
472	Ga0590077_000116	3300059426	Bacteria	21294
473	Ga0501082_0038000	3300060353	Bacteria	4152
474	Ga0501082_0380738	3300060353	Bacteria	1231
475	Ga0501082_0482469	3300060353	Bacteria	1084
476	Ga0530510_0023423	3300061734	Bacteria	4399
477	Ga0530510_0243571	3300061734	Bacteria	1339
478	Ga0530510_0323736	3300061734	Bacteria	1156
479	Ga0530510_0365561	3300061734	Bacteria	1085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300021441	Ga0213871_10056415	Ga0213871_100564152	149
2	3300035691	Ga0373931_0160905	Ga0373931_0160905_14_463	149
3	3300039438	Ga0436360_1357140	Ga0436360_1357140_10269_10718	149
4	3300049705	Ga0501225_0339115	Ga0501225_0339115_26_475	149
5	3300012513	Ga0157326_1088009	Ga0157326_10880091	151
6	3300045976	Ga0466967_2360807	Ga0466967_2360807_12_479	151
7	3300050507	nmdc:mga05p37_12607_c1	nmdc:mga05p37_12607_c1_4436_4900	151
8	3300050515	nmdc:mga0a205_125403_c1	nmdc:mga0a205_125403_c1_202_666	151
9	3300005471	Ga0070698_100702949	Ga0070698_1007029492	152
10	3300006852	Ga0075433_11160237	Ga0075433_111602372	152
11	3300050507	nmdc:mga05p37_172780_c1	nmdc:mga05p37_172780_c1_1632_2090	152
12	3300050515	nmdc:mga0a205_939411_c1	nmdc:mga0a205_939411_c1_88_546	152
13	3300006844	Ga0075428_100798502	Ga0075428_1007985022	154
14	3300006914	Ga0075436_100368791	Ga0075436_1003687911	154
15	3300007076	Ga0075435_101224350	Ga0075435_1012243502	154
16	3300050514	nmdc:mga08x19_1045488_c1	nmdc:mga08x19_1045488_c1_42_530	154
17	3300005467	Ga0070706_100164564	Ga0070706_1001645643	155
18	3300005468	Ga0070707_100053324	Ga0070707_1000533245	155
19	3300005536	Ga0070697_100112362	Ga0070697_1001123621	155
20	3300025910	Ga0207684_10120783	Ga0207684_101207832	155
21	3300025922	Ga0207646_10091298	Ga0207646_100912983	155
22	3300045051	Ga0451576_2426517	Ga0451576_2426517_18_500	155
23	3300050512	nmdc:mga0n895_717951_c1	nmdc:mga0n895_717951_c1_118_600	155
24	3300059421	Ga0590071_000020	Ga0590071_000020_23003_23530	156
25	3300006871	Ga0075434_100489581	Ga0075434_1004895812	157
26	3300009147	Ga0114129_10017152	Ga0114129_100171522	157
27	3300009147	Ga0114129_10111868	Ga0114129_101118683	157
28	3300046457	Ga0495590_0347666	Ga0495590_0347666_13_486	157
29	3300049574	Ga0501038_0050668	Ga0501038_0050668_772_1245	157
30	3300049580	Ga0501046_0291994	Ga0501046_0291994_59_532	157
31	3300049591	Ga0501075_0149145	Ga0501075_0149145_95_568	157
32	3300049743	Ga0501081_0078599	Ga0501081_0078599_1110_1583	157
33	3300049744	Ga0501083_0446339	Ga0501083_0446339_41_514	157
34	3300050507	nmdc:mga05p37_106097_c1	nmdc:mga05p37_106097_c1_2666_3139	157
35	3300050507	nmdc:mga05p37_21514_c2	nmdc:mga05p37_21514_c2_1851_2324	157
36	3300050512	nmdc:mga0n895_452709_c1	nmdc:mga0n895_452709_c1_130_603	157
37	3300050515	nmdc:mga0a205_169316_c1	nmdc:mga0a205_169316_c1_851_1324	157
38	3300054114	Ga0501084_0152064	Ga0501084_0152064_24_497	157
39	iso_pu_bacteria	2915358134	2915358589	157
40	3300005340	Ga0070689_100506805	Ga0070689_1005068051	158
41	3300006173	Ga0070716_100162653	Ga0070716_1001626532	158
42	3300006931	Ga0097620_101313295	Ga0097620_1013132952	158
43	3300025936	Ga0207670_11502934	Ga0207670_115029341	158
44	3300025939	Ga0207665_10211185	Ga0207665_102111852	158
45	3300026089	Ga0207648_12020528	Ga0207648_120205281	158
46	3300046454	Ga0495592_0147889	Ga0495592_0147889_44_532	158
47	3300046516	Ga0495628_0045121	Ga0495628_0045121_2205_2693	158
48	3300046678	Ga0495599_0408899	Ga0495599_0408899_250_738	158
49	3300049582	Ga0501048_0581620	Ga0501048_0581620_46_522	158
50	3300049587	Ga0501071_0303195	Ga0501071_0303195_198_674	158
51	3300005290	Ga0065712_10463840	Ga0065712_104638401	159
52	3300005290	Ga0065712_10734668	Ga0065712_107346681	159
53	3300005293	Ga0065715_10112116	Ga0065715_101121162	159
54	3300005293	Ga0065715_10145971	Ga0065715_101459712	159
55	3300005328	Ga0070676_10202995	Ga0070676_102029952	159
56	3300005330	Ga0070690_100145451	Ga0070690_1001454512	159
57	3300005334	Ga0068869_100224958	Ga0068869_1002249581	159
58	3300005335	Ga0070666_10065246	Ga0070666_100652462	159
59	3300005338	Ga0068868_100086438	Ga0068868_1000864382	159
60	3300005340	Ga0070689_100222879	Ga0070689_1002228792	159
61	3300005341	Ga0070691_10111902	Ga0070691_101119022	159
62	3300005343	Ga0070687_100415696	Ga0070687_1004156962	159
63	3300005344	Ga0070661_100231293	Ga0070661_1002312932	159
64	3300005353	Ga0070669_100144197	Ga0070669_1001441972	159
65	3300005355	Ga0070671_100128996	Ga0070671_1001289962	159
66	3300005364	Ga0070673_100019340	Ga0070673_1000193405	159
67	3300005365	Ga0070688_100082554	Ga0070688_1000825543	159
68	3300005365	Ga0070688_100571445	Ga0070688_1005714451	159
69	3300005366	Ga0070659_100369255	Ga0070659_1003692552	159
70	3300005367	Ga0070667_100475284	Ga0070667_1004752842	159
71	3300005406	Ga0070703_10332710	Ga0070703_103327101	159
72	3300005434	Ga0070709_10037835	Ga0070709_100378353	159
73	3300005436	Ga0070713_100477669	Ga0070713_1004776691	159
74	3300005438	Ga0070701_10249252	Ga0070701_102492522	159
75	3300005440	Ga0070705_100035217	Ga0070705_1000352171	159
76	3300005441	Ga0070700_100112638	Ga0070700_1001126382	159
77	3300005444	Ga0070694_100220345	Ga0070694_1002203452	159
78	3300005457	Ga0070662_100088162	Ga0070662_1000881622	159
79	3300005459	Ga0068867_100053511	Ga0068867_1000535112	159
80	3300005466	Ga0070685_10279011	Ga0070685_102790112	159
81	3300005545	Ga0070695_100079164	Ga0070695_1000791642	159
82	3300005547	Ga0070693_100021392	Ga0070693_1000213923	159
83	3300005578	Ga0068854_100116102	Ga0068854_1001161023	159
84	3300005615	Ga0070702_100006011	Ga0070702_1000060117	159
85	3300005616	Ga0068852_100395827	Ga0068852_1003958271	159
86	3300005617	Ga0068859_100362964	Ga0068859_1003629642	159
87	3300005719	Ga0068861_100373453	Ga0068861_1003734532	159
88	3300005842	Ga0068858_100043721	Ga0068858_1000437213	159
89	3300005843	Ga0068860_100200281	Ga0068860_1002002812	159
90	3300005844	Ga0068862_100413854	Ga0068862_1004138542	159
91	3300006028	Ga0070717_10103125	Ga0070717_101031252	159
92	3300006042	Ga0075368_10011051	Ga0075368_100110513	159
93	3300006048	Ga0075363_100130317	Ga0075363_1001303172	159
94	3300006051	Ga0075364_10003930	Ga0075364_100039307	159
95	3300006051	Ga0075364_10035366	Ga0075364_100353664	159
96	3300006051	Ga0075364_10038066	Ga0075364_100380661	159
97	3300006177	Ga0075362_10015765	Ga0075362_100157653	159
98	3300006178	Ga0075367_10003051	Ga0075367_100030514	159
99	3300006178	Ga0075367_10026448	Ga0075367_100264483	159
100	3300006178	Ga0075367_10308999	Ga0075367_103089991	159
101	3300006195	Ga0075366_10000950	Ga0075366_100009505	159
102	3300006195	Ga0075366_10032917	Ga0075366_100329172	159
103	3300006353	Ga0075370_10007599	Ga0075370_100075994	159
104	3300006358	Ga0068871_100845321	Ga0068871_1008453211	159
105	3300006847	Ga0075431_100783818	Ga0075431_1007838181	159
106	3300006871	Ga0075434_100385136	Ga0075434_1003851362	159
107	3300006881	Ga0068865_100122698	Ga0068865_1001226983	159
108	3300006914	Ga0075436_100987187	Ga0075436_1009871871	159
109	3300006931	Ga0097620_100362985	Ga0097620_1003629852	159
110	3300007076	Ga0075435_100020422	Ga0075435_1000204222	159
111	3300007076	Ga0075435_100258641	Ga0075435_1002586412	159
112	3300009094	Ga0111539_10048053	Ga0111539_100480533	159
113	3300009098	Ga0105245_10559423	Ga0105245_105594232	159
114	3300009148	Ga0105243_10083585	Ga0105243_100835853	159
115	3300009148	Ga0105243_11201789	Ga0105243_112017892	159
116	3300009174	Ga0105241_10502891	Ga0105241_105028912	159
117	3300009176	Ga0105242_10071160	Ga0105242_100711602	159
118	3300009177	Ga0105248_10489209	Ga0105248_104892092	159
119	3300009551	Ga0105238_11593685	Ga0105238_115936852	159
120	3300009553	Ga0105249_10404344	Ga0105249_104043442	159
121	3300010375	Ga0105239_10345147	Ga0105239_103451472	159
122	3300013306	Ga0163162_10040241	Ga0163162_100402414	159
123	3300025903	Ga0207680_10069770	Ga0207680_100697702	159
124	3300025904	Ga0207647_10170655	Ga0207647_101706552	159
125	3300025906	Ga0207699_10036741	Ga0207699_100367412	159
126	3300025906	Ga0207699_10862789	Ga0207699_108627892	159
127	3300025907	Ga0207645_10018222	Ga0207645_100182225	159
128	3300025911	Ga0207654_10372866	Ga0207654_103728662	159
129	3300025918	Ga0207662_10077892	Ga0207662_100778922	159
130	3300025923	Ga0207681_10144342	Ga0207681_101443422	159
131	3300025927	Ga0207687_10133388	Ga0207687_101333882	159
132	3300025928	Ga0207700_10442545	Ga0207700_104425452	159
133	3300025931	Ga0207644_10020501	Ga0207644_100205015	159
134	3300025934	Ga0207686_10237999	Ga0207686_102379992	159
135	3300025940	Ga0207691_10078883	Ga0207691_100788833	159
136	3300025941	Ga0207711_10085677	Ga0207711_100856772	159
137	3300025960	Ga0207651_10187069	Ga0207651_101870692	159
138	3300025981	Ga0207640_10047473	Ga0207640_100474733	159
139	3300025986	Ga0207658_10085893	Ga0207658_100858933	159
140	3300026023	Ga0207677_10406078	Ga0207677_104060782	159
141	3300026035	Ga0207703_10392740	Ga0207703_103927402	159
142	3300026067	Ga0207678_10373064	Ga0207678_103730642	159
143	3300026075	Ga0207708_10020618	Ga0207708_100206185	159
144	3300026089	Ga0207648_10005372	Ga0207648_100053723	159
145	3300026118	Ga0207675_100079425	Ga0207675_1000794253	159
146	3300026121	Ga0207683_10251114	Ga0207683_102511142	159
147	3300026142	Ga0207698_10139067	Ga0207698_101390672	159
148	3300027907	Ga0207428_10975222	Ga0207428_109752222	159
149	3300028380	Ga0268265_10457240	Ga0268265_104572401	159
150	3300028381	Ga0268264_10173067	Ga0268264_101730672	159
151	3300031548	Ga0307408_100454069	Ga0307408_1004540692	159
152	3300031731	Ga0307405_10457549	Ga0307405_104575492	159
153	3300031824	Ga0307413_10524269	Ga0307413_105242692	159
154	3300031995	Ga0307409_100819969	Ga0307409_1008199691	159
155	3300032002	Ga0307416_100017459	Ga0307416_1000174594	159
156	3300032126	Ga0307415_100283177	Ga0307415_1002831771	159
157	3300032126	Ga0307415_102125837	Ga0307415_1021258371	159
158	3300035113	Ga0373936_0150501	Ga0373936_0150501_114_593	159
159	3300035113	Ga0373936_0244394	Ga0373936_0244394_45_524	159
160	3300035115	Ga0373941_0036828	Ga0373941_0036828_202_681	159
161	3300035121	Ga0373960_0007326	Ga0373960_0007326_589_1068	159
162	3300035172	Ga0373955_0342304	Ga0373955_0342304_200_679	159
163	3300035692	Ga0373935_0314154	Ga0373935_0314154_548_1051	159
164	3300035724	Ga0373933_0251834	Ga0373933_0251834_451_930	159
165	3300036401	Ga0373937_0028308	Ga0373937_0028308_4500_4979	159
166	3300037068	Ga0373925_0002470	Ga0373925_0002470_3489_3992	159
167	3300037068	Ga0373925_0846984	Ga0373925_0846984_13_492	159
168	3300046476	Ga0495662_0275200	Ga0495662_0275200_79_582	159
169	3300046516	Ga0495628_0391769	Ga0495628_0391769_74_577	159
170	3300046533	Ga0495640_0496675	Ga0495640_0496675_112_615	159
171	3300046678	Ga0495599_0066176	Ga0495599_0066176_1275_1778	159
172	3300046680	Ga0495646_0432878	Ga0495646_0432878_26_505	159
173	3300047319	Ga0495674_0256053	Ga0495674_0256053_306_785	159
174	3300047471	Ga0495684_0115581	Ga0495684_0115581_308_787	159
175	3300048905	Ga0496102_0718403	Ga0496102_0718403_151_630	159
176	3300048916	Ga0496113_0416615	Ga0496113_0416615_199_678	159
177	3300049568	Ga0501031_0055431	Ga0501031_0055431_541_1020	159
178	3300049570	Ga0501033_0632130	Ga0501033_0632130_24_503	159
179	3300049572	Ga0501036_0149781	Ga0501036_0149781_364_843	159
180	3300049575	Ga0501039_0221804	Ga0501039_0221804_978_1457	159
181	3300049576	Ga0501040_0064786	Ga0501040_0064786_210_689	159
182	3300049577	Ga0501041_0141579	Ga0501041_0141579_806_1285	159
183	3300049578	Ga0501042_0227135	Ga0501042_0227135_119_598	159
184	3300049579	Ga0501043_0854570	Ga0501043_0854570_26_505	159
185	3300049582	Ga0501048_0040565	Ga0501048_0040565_2818_3297	159
186	3300049582	Ga0501048_0298740	Ga0501048_0298740_119_598	159
187	3300049583	Ga0501067_0061135	Ga0501067_0061135_544_1023	159
188	3300049585	Ga0501069_0152726	Ga0501069_0152726_685_1164	159
189	3300049591	Ga0501075_0029761	Ga0501075_0029761_3369_3848	159
190	3300049592	Ga0501076_0052276	Ga0501076_0052276_471_950	159
191	3300049593	Ga0501077_0029238	Ga0501077_0029238_2689_3168	159
192	3300049669	Ga0501235_104498	Ga0501235_104498_125_604	159
193	3300049741	Ga0501079_0186256	Ga0501079_0186256_615_1094	159
194	3300049742	Ga0501080_0845543	Ga0501080_0845543_72_551	159
195	3300049743	Ga0501081_0031805	Ga0501081_0031805_1267_1746	159
196	3300049743	Ga0501081_0533931	Ga0501081_0533931_169_648	159
197	3300049824	Ga0501045_0007421	Ga0501045_0007421_2650_3129	159
198	3300050489	nmdc:mga03683_26132_c1	nmdc:mga03683_26132_c1_1738_2217	159
199	3300050490	nmdc:mga03n38_493820_c1	nmdc:mga03n38_493820_c1_57_536	159
200	3300050491	nmdc:mga00v17_234525_c1	nmdc:mga00v17_234525_c1_286_765	159
201	3300050491	nmdc:mga00v17_6186_c1	nmdc:mga00v17_6186_c1_5230_5709	159
202	3300050491	nmdc:mga00v17_97723_c1	nmdc:mga00v17_97723_c1_973_1452	159
203	3300050493	nmdc:mga0k408_41633_c1	nmdc:mga0k408_41633_c1_1916_2419	159
204	3300050493	nmdc:mga0k408_6738_c1	nmdc:mga0k408_6738_c1_5056_5535	159
205	3300050494	nmdc:mga06z11_107983_c1	nmdc:mga06z11_107983_c1_165_644	159
206	3300050494	nmdc:mga06z11_37729_c1	nmdc:mga06z11_37729_c1_1397_1900	159
207	3300050495	nmdc:mga04h51_39851_c1	nmdc:mga04h51_39851_c1_679_1158	159
208	3300050496	nmdc:mga07m45_232901_c1	nmdc:mga07m45_232901_c1_362_841	159
209	3300050510	nmdc:mga06r32_720186_c1	nmdc:mga06r32_720186_c1_276_755	159
210	3300050511	nmdc:mga08y16_338088_c1	nmdc:mga08y16_338088_c1_183_662	159
211	3300050511	nmdc:mga08y16_70364_c1	nmdc:mga08y16_70364_c1_2966_3445	159
212	3300050512	nmdc:mga0n895_695263_c1	nmdc:mga0n895_695263_c1_422_901	159
213	3300050512	nmdc:mga0n895_78875_c1	nmdc:mga0n895_78875_c1_2210_2689	159
214	3300050513	nmdc:mga0rr50_273822_c1	nmdc:mga0rr50_273822_c1_578_1057	159
215	3300050513	nmdc:mga0rr50_395601_c1	nmdc:mga0rr50_395601_c1_187_666	159
216	3300050514	nmdc:mga08x19_869316_c1	nmdc:mga08x19_869316_c1_82_561	159
217	3300053078	Ga0495612_0222088	Ga0495612_0222088_260_739	159
218	3300060353	Ga0501082_0038000	Ga0501082_0038000_3135_3614	159
219	3300061734	Ga0530510_0023423	Ga0530510_0023423_3247_3726	159
220	3300061734	Ga0530510_0365561	Ga0530510_0365561_336_815	159
221	3300005289	Ga0065704_10036343	Ga0065704_100363432	160
222	3300005295	Ga0065707_10008330	Ga0065707_100083302	160
223	3300005367	Ga0070667_100439392	Ga0070667_1004393921	160
224	3300005445	Ga0070708_100556512	Ga0070708_1005565122	160
225	3300005467	Ga0070706_100108078	Ga0070706_1001080782	160
226	3300006844	Ga0075428_100010135	Ga0075428_1000101355	160
227	3300006852	Ga0075433_10110780	Ga0075433_101107802	160
228	3300006852	Ga0075433_10272752	Ga0075433_102727522	160
229	3300006852	Ga0075433_11262081	Ga0075433_112620812	160
230	3300006880	Ga0075429_100807361	Ga0075429_1008073611	160
231	3300009094	Ga0111539_10085467	Ga0111539_100854672	160
232	3300009147	Ga0114129_10003011	Ga0114129_100030113	160
233	3300009147	Ga0114129_10006780	Ga0114129_1000678013	160
234	3300009147	Ga0114129_10082310	Ga0114129_100823103	160
235	3300025910	Ga0207684_10049819	Ga0207684_100498193	160
236	3300027907	Ga0207428_10038828	Ga0207428_100388284	160
237	3300030745	Ga0316182_1055166	Ga0316182_10551662	160
238	3300031995	Ga0307409_100396109	Ga0307409_1003961092	160
239	3300032002	Ga0307416_100249604	Ga0307416_1002496042	160
240	3300032005	Ga0307411_10039631	Ga0307411_100396312	160
241	3300049652	Ga0501202_057417	Ga0501202_057417_293_775	160
242	3300049690	Ga0501261_066614	Ga0501261_066614_106_588	160
243	3300049704	Ga0501221_033784	Ga0501221_033784_543_1025	160
244	3300050507	nmdc:mga05p37_34019_c1	nmdc:mga05p37_34019_c1_2275_2766	160
245	3300050507	nmdc:mga05p37_5_c1	nmdc:mga05p37_5_c1_8813_9322	160
246	3300050508	nmdc:mga09592_224323_c1	nmdc:mga09592_224323_c1_1068_1577	160
247	3300050508	nmdc:mga09592_722844_c1	nmdc:mga09592_722844_c1_32_562	160
248	3300050511	nmdc:mga08y16_289040_c1	nmdc:mga08y16_289040_c1_170_700	160
249	3300050511	nmdc:mga08y16_30257_c1	nmdc:mga08y16_30257_c1_584_1069	160
250	3300050515	nmdc:mga0a205_999916_c1	nmdc:mga0a205_999916_c1_63_548	160
251	3300005288	Ga0065714_10296507	Ga0065714_102965072	161
252	3300005288	Ga0065714_10361820	Ga0065714_103618201	161
253	3300005290	Ga0065712_10094785	Ga0065712_100947852	161
254	3300005293	Ga0065715_10053601	Ga0065715_100536011	161
255	3300005293	Ga0065715_10061980	Ga0065715_100619802	161
256	3300005293	Ga0065715_10138036	Ga0065715_101380362	161
257	3300005329	Ga0070683_101139998	Ga0070683_1011399981	161
258	3300005330	Ga0070690_100100317	Ga0070690_1001003172	161
259	3300005331	Ga0070670_100249846	Ga0070670_1002498462	161
260	3300005331	Ga0070670_101205370	Ga0070670_1012053701	161
261	3300005335	Ga0070666_10104501	Ga0070666_101045011	161
262	3300005340	Ga0070689_100070412	Ga0070689_1000704122	161
263	3300005340	Ga0070689_100639006	Ga0070689_1006390061	161
264	3300005343	Ga0070687_100415226	Ga0070687_1004152262	161
265	3300005343	Ga0070687_100563295	Ga0070687_1005632952	161
266	3300005353	Ga0070669_100133900	Ga0070669_1001339002	161
267	3300005353	Ga0070669_100281728	Ga0070669_1002817283	161
268	3300005355	Ga0070671_100111635	Ga0070671_1001116353	161
269	3300005355	Ga0070671_100560609	Ga0070671_1005606091	161
270	3300005364	Ga0070673_100035571	Ga0070673_1000355713	161
271	3300005365	Ga0070688_100228280	Ga0070688_1002282802	161
272	3300005435	Ga0070714_100902681	Ga0070714_1009026811	161
273	3300005436	Ga0070713_100097631	Ga0070713_1000976312	161
274	3300005440	Ga0070705_101522057	Ga0070705_1015220571	161
275	3300005467	Ga0070706_100528901	Ga0070706_1005289012	161
276	3300005467	Ga0070706_100604202	Ga0070706_1006042022	161
277	3300005467	Ga0070706_100782061	Ga0070706_1007820611	161
278	3300005471	Ga0070698_100159273	Ga0070698_1001592732	161
279	3300005518	Ga0070699_100183725	Ga0070699_1001837252	161
280	3300005518	Ga0070699_100246683	Ga0070699_1002466832	161
281	3300005536	Ga0070697_100278029	Ga0070697_1002780292	161
282	3300005543	Ga0070672_100048120	Ga0070672_1000481203	161
283	3300005563	Ga0068855_101439838	Ga0068855_1014398381	161
284	3300005564	Ga0070664_100534616	Ga0070664_1005346162	161
285	3300005615	Ga0070702_100254705	Ga0070702_1002547052	161
286	3300005617	Ga0068859_100295852	Ga0068859_1002958522	161
287	3300005617	Ga0068859_100685905	Ga0068859_1006859052	161
288	3300005617	Ga0068859_101058013	Ga0068859_1010580132	161
289	3300005617	Ga0068859_101341124	Ga0068859_1013411242	161
290	3300005719	Ga0068861_100994794	Ga0068861_1009947941	161
291	3300005719	Ga0068861_101231917	Ga0068861_1012319172	161
292	3300005841	Ga0068863_100001180	Ga0068863_10000118021	161
293	3300005841	Ga0068863_100113587	Ga0068863_1001135872	161
294	3300005841	Ga0068863_100573875	Ga0068863_1005738752	161
295	3300005842	Ga0068858_100273141	Ga0068858_1002731412	161
296	3300005842	Ga0068858_101020166	Ga0068858_1010201661	161
297	3300005843	Ga0068860_100170608	Ga0068860_1001706082	161
298	3300005843	Ga0068860_100544297	Ga0068860_1005442972	161
299	3300005844	Ga0068862_100116975	Ga0068862_1001169752	161
300	3300005937	Ga0081455_10133123	Ga0081455_101331232	161
301	3300006358	Ga0068871_101362213	Ga0068871_1013622132	161
302	3300006844	Ga0075428_100124108	Ga0075428_1001241083	161
303	3300006844	Ga0075428_100748370	Ga0075428_1007483702	161
304	3300006846	Ga0075430_100155828	Ga0075430_1001558281	161
305	3300006846	Ga0075430_100607871	Ga0075430_1006078712	161
306	3300006847	Ga0075431_100089082	Ga0075431_1000890821	161
307	3300006847	Ga0075431_100177049	Ga0075431_1001770493	161
308	3300006847	Ga0075431_100809372	Ga0075431_1008093721	161
309	3300006852	Ga0075433_10053270	Ga0075433_100532703	161
310	3300006871	Ga0075434_100263599	Ga0075434_1002635992	161
311	3300006871	Ga0075434_100491195	Ga0075434_1004911951	161
312	3300006880	Ga0075429_100173228	Ga0075429_1001732282	161
313	3300006880	Ga0075429_100268295	Ga0075429_1002682952	161
314	3300006914	Ga0075436_100062634	Ga0075436_1000626342	161
315	3300006914	Ga0075436_100067276	Ga0075436_1000672763	161
316	3300006914	Ga0075436_100419962	Ga0075436_1004199622	161
317	3300006914	Ga0075436_100916957	Ga0075436_1009169572	161
318	3300006914	Ga0075436_101429532	Ga0075436_1014295321	161
319	3300006931	Ga0097620_100295819	Ga0097620_1002958192	161
320	3300006931	Ga0097620_100685919	Ga0097620_1006859192	161
321	3300006931	Ga0097620_101058146	Ga0097620_1010581462	161
322	3300006931	Ga0097620_101341162	Ga0097620_1013411622	161
323	3300007076	Ga0075435_100001349	Ga0075435_10000134912	161
324	3300009093	Ga0105240_10012551	Ga0105240_1001255110	161
325	3300009094	Ga0111539_10001275	Ga0111539_1000127512	161
326	3300009094	Ga0111539_10091169	Ga0111539_100911693	161
327	3300009094	Ga0111539_10188760	Ga0111539_101887602	161
328	3300009094	Ga0111539_10259122	Ga0111539_102591221	161
329	3300009094	Ga0111539_10945623	Ga0111539_109456232	161
330	3300009098	Ga0105245_11105350	Ga0105245_111053501	161
331	3300009101	Ga0105247_10289710	Ga0105247_102897102	161
332	3300009147	Ga0114129_10003504	Ga0114129_100035047	161
333	3300009147	Ga0114129_10018068	Ga0114129_100180682	161
334	3300009147	Ga0114129_10036670	Ga0114129_100366704	161
335	3300009147	Ga0114129_10103913	Ga0114129_101039134	161
336	3300009147	Ga0114129_10130673	Ga0114129_101306732	161
337	3300009147	Ga0114129_10610564	Ga0114129_106105642	161
338	3300009147	Ga0114129_10821606	Ga0114129_108216062	161
339	3300009147	Ga0114129_11087669	Ga0114129_110876692	161
340	3300009148	Ga0105243_11364188	Ga0105243_113641882	161
341	3300009174	Ga0105241_10720806	Ga0105241_107208062	161
342	3300009176	Ga0105242_10175786	Ga0105242_101757863	161
343	3300009176	Ga0105242_10807391	Ga0105242_108073912	161
344	3300009177	Ga0105248_10002931	Ga0105248_100029318	161
345	3300009177	Ga0105248_10043582	Ga0105248_100435825	161
346	3300009545	Ga0105237_10738688	Ga0105237_107386882	161
347	3300013297	Ga0157378_10433635	Ga0157378_104336352	161
348	3300013297	Ga0157378_11124989	Ga0157378_111249891	161
349	3300013308	Ga0157375_10981382	Ga0157375_109813822	161
350	3300013308	Ga0157375_11880230	Ga0157375_118802301	161
351	3300014325	Ga0163163_10000008	Ga0163163_10000008195	161
352	3300014326	Ga0157380_10077304	Ga0157380_100773043	161
353	3300014326	Ga0157380_11182158	Ga0157380_111821582	161
354	3300014326	Ga0157380_11589289	Ga0157380_115892892	161
355	3300014968	Ga0157379_10014703	Ga0157379_100147033	161
356	3300014968	Ga0157379_10272840	Ga0157379_102728402	161
357	3300014969	Ga0157376_10100732	Ga0157376_101007323	161
358	3300014969	Ga0157376_10229466	Ga0157376_102294663	161
359	3300017792	Ga0163161_10407154	Ga0163161_104071542	161
360	3300025903	Ga0207680_10265649	Ga0207680_102656491	161
361	3300025905	Ga0207685_10139974	Ga0207685_101399741	161
362	3300025910	Ga0207684_10214174	Ga0207684_102141742	161
363	3300025910	Ga0207684_10310963	Ga0207684_103109632	161
364	3300025910	Ga0207684_10467363	Ga0207684_104673632	161
365	3300025910	Ga0207684_10575802	Ga0207684_105758022	161
366	3300025912	Ga0207707_10795341	Ga0207707_107953411	161
367	3300025913	Ga0207695_10035487	Ga0207695_100354874	161
368	3300025914	Ga0207671_10950724	Ga0207671_109507242	161
369	3300025918	Ga0207662_10118020	Ga0207662_101180202	161
370	3300025918	Ga0207662_10889063	Ga0207662_108890632	161
371	3300025921	Ga0207652_10756598	Ga0207652_107565982	161
372	3300025923	Ga0207681_10024591	Ga0207681_100245914	161
373	3300025923	Ga0207681_10348162	Ga0207681_103481622	161
374	3300025923	Ga0207681_10429476	Ga0207681_104294762	161
375	3300025925	Ga0207650_10521845	Ga0207650_105218452	161
376	3300025926	Ga0207659_10679802	Ga0207659_106798022	161
377	3300025928	Ga0207700_10456737	Ga0207700_104567372	161
378	3300025929	Ga0207664_10151230	Ga0207664_101512301	161
379	3300025931	Ga0207644_10009064	Ga0207644_100090644	161
380	3300025933	Ga0207706_10249257	Ga0207706_102492572	161
381	3300025936	Ga0207670_10199427	Ga0207670_101994272	161
382	3300025937	Ga0207669_10217284	Ga0207669_102172842	161
383	3300025940	Ga0207691_10013618	Ga0207691_100136186	161
384	3300025941	Ga0207711_10071145	Ga0207711_100711452	161
385	3300025942	Ga0207689_10140182	Ga0207689_101401823	161
386	3300025942	Ga0207689_10354065	Ga0207689_103540652	161
387	3300025945	Ga0207679_10118788	Ga0207679_101187883	161
388	3300025949	Ga0207667_11074867	Ga0207667_110748671	161
389	3300025960	Ga0207651_10072964	Ga0207651_100729642	161
390	3300025986	Ga0207658_10058202	Ga0207658_100582022	161
391	3300026088	Ga0207641_10006659	Ga0207641_100066599	161
392	3300026088	Ga0207641_10610812	Ga0207641_106108122	161
393	3300026088	Ga0207641_11663369	Ga0207641_116633692	161
394	3300026089	Ga0207648_11573262	Ga0207648_115732621	161
395	3300026095	Ga0207676_11285255	Ga0207676_112852551	161
396	3300026116	Ga0207674_10754577	Ga0207674_107545771	161
397	3300026118	Ga0207675_101499876	Ga0207675_1014998761	161
398	3300026121	Ga0207683_10581416	Ga0207683_105814162	161
399	3300027395	Ga0209996_1007643	Ga0209996_10076433	161
400	3300027907	Ga0207428_10001852	Ga0207428_100018526	161
401	3300027907	Ga0207428_10033439	Ga0207428_100334392	161
402	3300028380	Ga0268265_10386195	Ga0268265_103861952	161
403	3300028380	Ga0268265_11163876	Ga0268265_111638762	161
404	3300028381	Ga0268264_10039677	Ga0268264_100396772	161
405	3300031911	Ga0307412_11334963	Ga0307412_113349631	161
406	3300032002	Ga0307416_100722502	Ga0307416_1007225022	161
407	3300035086	Ga0373934_0000427	Ga0373934_0000427_13421_13912	161
408	3300035117	Ga0373953_0089791	Ga0373953_0089791_138_629	161
409	3300035118	Ga0373954_0017659	Ga0373954_0017659_598_1089	161
410	3300035118	Ga0373954_0427171	Ga0373954_0427171_73_564	161
411	3300035119	Ga0373956_0014045	Ga0373956_0014045_1344_1835	161
412	3300035120	Ga0373957_0241028	Ga0373957_0241028_214_705	161
413	3300035172	Ga0373955_0010426	Ga0373955_0010426_316_807	161
414	3300035172	Ga0373955_0235172	Ga0373955_0235172_516_1010	161
415	3300035242	Ga0373962_0019742	Ga0373962_0019742_1156_1650	161
416	3300035724	Ga0373933_0146177	Ga0373933_0146177_490_981	161
417	3300036401	Ga0373937_0000108	Ga0373937_0000108_60040_60531	161
418	3300036401	Ga0373937_0147145	Ga0373937_0147145_1081_1575	161
419	3300037068	Ga0373925_0965649	Ga0373925_0965649_74_559	161
420	3300039453	Ga0436362_0520128	Ga0436362_0520128_78_569	161
421	3300042015	Ga0439462_0053324	Ga0439462_0053324_88_573	161
422	3300042436	Ga0439435_0001518	Ga0439435_0001518_1337_1828	161
423	3300042461	Ga0439460_0013360	Ga0439460_0013360_614_1105	161
424	3300044673	Ga0453683_0129388	Ga0453683_0129388_456_962	161
425	3300044673	Ga0453683_0148224	Ga0453683_0148224_939_1433	161
426	3300044694	Ga0466963_0157425	Ga0466963_0157425_690_1184	161
427	3300044694	Ga0466963_0353165	Ga0466963_0353165_15_512	161
428	3300045051	Ga0451576_0000492	Ga0451576_0000492_56273_56776	161
429	3300045051	Ga0451576_0006870	Ga0451576_0006870_8357_8851	161
430	3300046516	Ga0495628_0079879	Ga0495628_0079879_1189_1674	161
431	3300046516	Ga0495628_0550085	Ga0495628_0550085_277_771	161
432	3300046664	Ga0495659_0018450	Ga0495659_0018450_1359_1847	161
433	3300047319	Ga0495674_0498685	Ga0495674_0498685_327_821	161
434	3300047322	Ga0495680_0261512	Ga0495680_0261512_547_1038	161
435	3300048088	Ga0495602_0552300	Ga0495602_0552300_198_689	161
436	3300048913	Ga0496110_0751968	Ga0496110_0751968_70_564	161
437	3300049575	Ga0501039_0843591	Ga0501039_0843591_120_611	161
438	3300049576	Ga0501040_0028550	Ga0501040_0028550_1007_1519	161
439	3300049582	Ga0501048_0381228	Ga0501048_0381228_137_628	161
440	3300049582	Ga0501048_0485521	Ga0501048_0485521_275_766	161
441	3300049588	Ga0501072_0447513	Ga0501072_0447513_460_951	161
442	3300049591	Ga0501075_0143906	Ga0501075_0143906_1152_1643	161
443	3300049591	Ga0501075_0303085	Ga0501075_0303085_617_1102	161
444	3300049743	Ga0501081_0051415	Ga0501081_0051415_2139_2630	161
445	3300050507	nmdc:mga05p37_1631_c1	nmdc:mga05p37_1631_c1_7406_7891	161
446	3300050507	nmdc:mga05p37_242206_c1	nmdc:mga05p37_242206_c1_1178_1672	161
447	3300050507	nmdc:mga05p37_243791_c1	nmdc:mga05p37_243791_c1_743_1231	161
448	3300050507	nmdc:mga05p37_697940_c1	nmdc:mga05p37_697940_c1_116_607	161
449	3300050507	nmdc:mga05p37_856966_c1	nmdc:mga05p37_856966_c1_13_507	161
450	3300050507	nmdc:mga05p37_918230_c1	nmdc:mga05p37_918230_c1_293_793	161
451	3300050508	nmdc:mga09592_189519_c1	nmdc:mga09592_189519_c1_1019_1504	161
452	3300050509	nmdc:mga0qj67_224684_c1	nmdc:mga0qj67_224684_c1_822_1307	161
453	3300050509	nmdc:mga0qj67_292198_c1	nmdc:mga0qj67_292198_c1_694_1182	161
454	3300050509	nmdc:mga0qj67_562560_c1	nmdc:mga0qj67_562560_c1_389_883	161
455	3300050510	nmdc:mga06r32_1055095_c1	nmdc:mga06r32_1055095_c1_11_496	161
456	3300050511	nmdc:mga08y16_608953_c1	nmdc:mga08y16_608953_c1_50_544	161
457	3300050511	nmdc:mga08y16_61995_c1	nmdc:mga08y16_61995_c1_3195_3704	161
458	3300050511	nmdc:mga08y16_73224_c1	nmdc:mga08y16_73224_c1_1969_2454	161
459	3300050511	nmdc:mga08y16_78812_c1	nmdc:mga08y16_78812_c1_983_1474	161
460	3300050511	nmdc:mga08y16_884_c1	nmdc:mga08y16_884_c1_19137_19637	161
461	3300050512	nmdc:mga0n895_112632_c1	nmdc:mga0n895_112632_c1_1771_2259	161
462	3300050512	nmdc:mga0n895_726401_c1	nmdc:mga0n895_726401_c1_290_823	161
463	3300050512	nmdc:mga0n895_9403_c1	nmdc:mga0n895_9403_c1_1427_1918	161
464	3300050513	nmdc:mga0rr50_246376_c1	nmdc:mga0rr50_246376_c1_307_795	161
465	3300050514	nmdc:mga08x19_185232_c1	nmdc:mga08x19_185232_c1_273_761	161
466	3300050514	nmdc:mga08x19_29814_c1	nmdc:mga08x19_29814_c1_2365_2856	161
467	3300050514	nmdc:mga08x19_347987_c1	nmdc:mga08x19_347987_c1_147_653	161
468	3300050514	nmdc:mga08x19_56186_c1	nmdc:mga08x19_56186_c1_1879_2364	161
469	3300050514	nmdc:mga08x19_95404_c1	nmdc:mga08x19_95404_c1_173_661	161
470	3300050515	nmdc:mga0a205_156035_c1	nmdc:mga0a205_156035_c1_1285_1779	161
471	3300050515	nmdc:mga0a205_97063_c1	nmdc:mga0a205_97063_c1_1474_1965	161
472	3300053077	Ga0495601_0176921	Ga0495601_0176921_380_874	161
473	3300053084	Ga0495595_0307393	Ga0495595_0307393_153_647	161
474	3300059423	Ga0590074_000055	Ga0590074_000055_5536_6042	161
475	3300059424	Ga0590075_000513	Ga0590075_000513_745_1251	161
476	3300059426	Ga0590077_000116	Ga0590077_000116_9418_9924	161
477	3300060353	Ga0501082_0380738	Ga0501082_0380738_122_613	161
478	3300060353	Ga0501082_0482469	Ga0501082_0482469_82_576	161
479	3300061734	Ga0530510_0243571	Ga0530510_0243571_367_858	161
480	3300061734	Ga0530510_0323736	Ga0530510_0323736_203_694	161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

13

134

0.92 PF19315

MC_hydratase

Mesaconyl-CoA hydratase

5

182

0.91 PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

16

144

0.88 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3k67-assembly1.cif.gz_A	crystal structure of protein af1124 from archaeoglobus fulgidus	0.9124	14	151
3exz-assembly1.cif.gz_A	crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a.	0.9051	9	153
8hgn-assembly1.cif.gz_A	crystal structure of meac (mesaconyl-coa hydratase)	0.8954	9	158
4e3e-assembly1.cif.gz_A	crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl	0.8926	7	160
4ffu-assembly2.cif.gz_K	crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021	0.892	8	152

ID	Description	Score	Start	End	Superfamily
af_I6Y9H2_24_180_3.10.129.10	Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase	0.9184	1	153	3.10.129.10
3k67A00	Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase	0.9124	14	151	3.10.129.10
3exzC00	Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase	0.8983	10	153	3.10.129.10
3exzC00	Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase	0.8924	10	153	3.10.129.10
4ffuK00	Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase	0.8909	8	152	3.10.129.10

ID	Description	Score	Start	End	GO Terms
AF-A0A840J725-F1-model_v4	Acyl dehydratase	0.9782	1	153
AF-A0A2S6TKS2-F1-model_v4	Mesaconyl-CoA hydratase (EC 4.2.1.148)	0.9766	9	155	GO:0016829
AF-A0A7X3VV31-F1-model_v4	MaoC family dehydratase	0.9751	9	153
AF-A0A2E0Y720-F1-model_v4	Dehydratase	0.975	9	156	GO:0016829
AF-A0A7W0LK21-F1-model_v4	MaoC family dehydratase	0.9747	17	153

Feature Viewer

pLDDT	pTM	Quality
93.22	0.85	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F452215

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01575

MaoC_dehydratas

MaoC like domain

13

134

0.92

PF19315

MC_hydratase

Mesaconyl-CoA hydratase

5

182

0.91

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

16

144

0.88

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map