F452200

General Info

Members Datasets Scaffolds Average Seq Length
480 244 960 198

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10635764|Ga0075433_106357641
Length 226
Sequence MFELSGCGERAPSIFHLGNVGNLGTSMIARLSGAVAEKHPNRIVVDVGGVGYDVFVPLSTFYVLGEPGSPVILRIHTHVREDVIALYGFLTALEQDLFERLIAISGIGPKLALAVLSGIEPVELIRAVRTQDVARLTRIPGVGKKTAERIGLELKDRLPASLKTLEPAPAASTPADQLRDDLLSALINLGYQRPVAEKAVEKVLQAQPDARFEAALKDVLRSLMKS

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
155 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
158 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
165 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
199 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
216 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.42
Nodule 0
Rhizoplane 3.75
Rhizosphere 90.83
Stem 0
Stem Tuber 0
Unclassified 5.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10635764 3300006852 Bacteria 936
2 JGI24751J29686_10007734 3300002459 Bacteria 2197
3 Ga0065715_10090135 3300005293 Bacteria 7597
4 Ga0065715_10093168 3300005293 Bacteria 4784
5 Ga0065715_10094425 3300005293 Bacteria 4344
6 Ga0065715_10177648 3300005293 Bacteria 1499
7 Ga0065707_10114653 3300005295 Bacteria 2291
8 Ga0070658_10321722 3300005327 Bacteria 1321
9 Ga0070683_100200920 3300005329 Bacteria 1893
10 Ga0070690_100858678 3300005330 Bacteria 707
11 Ga0070670_100014101 3300005331 Bacteria 6857
12 Ga0070670_100160517 3300005331 Unclassified 1948
13 Ga0070670_100276023 3300005331 Unclassified 1467
14 Ga0070677_10068824 3300005333 Bacteria 1483
15 Ga0070666_10671930 3300005335 Unclassified 758
16 Ga0070680_100142347 3300005336 Bacteria 2011
17 Ga0070680_100750584 3300005336 Bacteria 840
18 Ga0070689_100059391 3300005340 Bacteria 2972
19 Ga0070689_100242375 3300005340 Bacteria 1485
20 Ga0070669_100000166 3300005353 Bacteria 58014
21 Ga0070669_100103009 3300005353 Bacteria 2156
22 Ga0070675_100031700 3300005354 Bacteria 4275
23 Ga0070675_100120694 3300005354 Bacteria 2227
24 Ga0070675_100645010 3300005354 Bacteria 962
25 Ga0070674_100004110 3300005356 Bacteria 8268
26 Ga0070674_100016261 3300005356 Bacteria 4662
27 Ga0070674_100190169 3300005356 Bacteria 1579
28 Ga0070673_100415968 3300005364 Bacteria 1204
29 Ga0070673_101273132 3300005364 Bacteria 690
30 Ga0070688_100130584 3300005365 Bacteria 1694
31 Ga0070659_100133285 3300005366 Bacteria 2019
32 Ga0070659_100605516 3300005366 Bacteria 942
33 Ga0070659_100731417 3300005366 Bacteria 857
34 Ga0070709_10000650 3300005434 Bacteria 19753
35 Ga0070709_10005969 3300005434 Bacteria 6615
36 Ga0070714_100048160 3300005435 Bacteria 3624
37 Ga0070714_100342508 3300005435 Bacteria 1402
38 Ga0070713_100124710 3300005436 Bacteria 2263
39 Ga0070713_100167769 3300005436 Bacteria 1964
40 Ga0070701_10025882 3300005438 Bacteria 2854
41 Ga0070701_10314135 3300005438 Bacteria 967
42 Ga0070711_100007075 3300005439 Bacteria 6804
43 Ga0070711_100029622 3300005439 Bacteria 3614
44 Ga0070711_100401939 3300005439 Unclassified 1112
45 Ga0070705_100424268 3300005440 Bacteria 991
46 Ga0070700_100128348 3300005441 Bacteria 1708
47 Ga0070663_100258665 3300005455 Bacteria 1380
48 Ga0070663_100267877 3300005455 Bacteria 1357
49 Ga0070678_100107675 3300005456 Bacteria 2174
50 Ga0070678_100190939 3300005456 Bacteria 1684
51 Ga0070662_100194332 3300005457 Bacteria 1607
52 Ga0070662_100251427 3300005457 Bacteria 1421
53 Ga0070681_10145070 3300005458 Bacteria 2303
54 Ga0070681_10475613 3300005458 Bacteria 1162
55 Ga0070685_10083796 3300005466 Bacteria 1916
56 Ga0070706_100557945 3300005467 Bacteria 1065
57 Ga0070707_100045214 3300005468 Bacteria 4215
58 Ga0070698_100365037 3300005471 Unclassified 1376
59 Ga0070699_100112472 3300005518 Bacteria 2392
60 Ga0070699_100490043 3300005518 Bacteria 1116
61 Ga0070679_100005089 3300005530 Bacteria 12147
62 Ga0070679_100421783 3300005530 Bacteria 1280
63 Ga0070684_101163880 3300005535 Bacteria 725
64 Ga0070672_100104734 3300005543 Bacteria 2299
65 Ga0070672_100545675 3300005543 Bacteria 1006
66 Ga0070672_100765988 3300005543 Bacteria 848
67 Ga0070686_100326171 3300005544 Bacteria 1146
68 Ga0070686_100404358 3300005544 Bacteria 1039
69 Ga0070695_100128272 3300005545 Bacteria 1745
70 Ga0070696_100266146 3300005546 Bacteria 1302
71 Ga0070693_100015889 3300005547 Bacteria 3885
72 Ga0070693_100021976 3300005547 Bacteria 3386
73 Ga0070704_100012627 3300005549 Bacteria 5223
74 Ga0070704_100192191 3300005549 Bacteria 1642
75 Ga0068855_100240830 3300005563 Bacteria 2022
76 Ga0068855_100249501 3300005563 Bacteria 1980
77 Ga0068855_100256204 3300005563 Unclassified 1951
78 Ga0070664_100115117 3300005564 Bacteria 2350
79 Ga0070664_100279188 3300005564 Unclassified 1506
80 Ga0068857_100035159 3300005577 Unclassified 4435
81 Ga0068859_100007450 3300005617 Bacteria 11108
82 Ga0068859_100930080 3300005617 Bacteria 953
83 Ga0068864_100091986 3300005618 Bacteria 2677
84 Ga0068864_100142875 3300005618 Bacteria 2161
85 Ga0068861_100172652 3300005719 Bacteria 1793
86 Ga0068861_100389179 3300005719 Unclassified 1234
87 Ga0068870_10112393 3300005840 Bacteria 1557
88 Ga0068870_10278179 3300005840 Bacteria 1048
89 Ga0068863_100230366 3300005841 Bacteria 1787
90 Ga0068863_100334782 3300005841 Unclassified 1472
91 Ga0068860_100284061 3300005843 Bacteria 1618
92 Ga0068862_100006398 3300005844 Bacteria 9794
93 Ga0068862_100041431 3300005844 Bacteria 3918
94 Ga0068862_101094659 3300005844 Bacteria 792
95 Ga0081455_10015599 3300005937 Bacteria 7373
96 Ga0081455_10149085 3300005937 Bacteria 1805
97 Ga0070717_10060980 3300006028 Bacteria 3124
98 Ga0070717_10092525 3300006028 Unclassified 2555
99 Ga0070717_10760332 3300006028 Bacteria 881
100 Ga0075365_10115914 3300006038 Bacteria 1844
101 Ga0075368_10006201 3300006042 Bacteria 4165
102 Ga0075368_10015026 3300006042 Bacteria 2866
103 Ga0075368_10054038 3300006042 Bacteria 1600
104 Ga0075364_10096258 3300006051 Bacteria 1968
105 Ga0070716_100098596 3300006173 Bacteria 1786
106 Ga0070716_100152555 3300006173 Bacteria 1488
107 Ga0070712_100032743 3300006175 Bacteria 3512
108 Ga0075362_10001628 3300006177 Bacteria 7284
109 Ga0075367_10003716 3300006178 Bacteria 7337
110 Ga0075369_10315601 3300006186 Bacteria 731
111 Ga0075366_10016996 3300006195 Bacteria 4183
112 Ga0075366_10076671 3300006195 Bacteria 1995
113 Ga0097621_100000391 3300006237 Bacteria 30518
114 Ga0097621_100342041 3300006237 Bacteria 1329
115 Ga0075370_10076812 3300006353 Bacteria 1916
116 Ga0068871_100000311 3300006358 Bacteria 33811
117 Ga0068871_100357605 3300006358 Bacteria 1293
118 Ga0075428_100000005 3300006844 Bacteria 326130
119 Ga0075428_100000058 3300006844 Bacteria 89652
120 Ga0075428_100001126 3300006844 Bacteria 28567
121 Ga0075428_100003840 3300006844 Bacteria 16498
122 Ga0075430_100000961 3300006846 Bacteria 22714
123 Ga0075430_100299724 3300006846 Bacteria 1330
124 Ga0075431_100011056 3300006847 Bacteria 9084
125 Ga0075431_100051771 3300006847 Bacteria 4233
126 Ga0075431_100337020 3300006847 Bacteria 1518
127 Ga0075431_101006614 3300006847 Bacteria 800
128 Ga0075433_10048176 3300006852 Bacteria 3706
129 Ga0075433_10151418 3300006852 Bacteria 2063
130 Ga0075433_10170193 3300006852 Bacteria 1939
131 Ga0075433_10308728 3300006852 Bacteria 1400
132 Ga0075433_10385947 3300006852 Bacteria 1236
133 Ga0075434_100245831 3300006871 Bacteria 1809
134 Ga0075434_100318570 3300006871 Bacteria 1575
135 Ga0075434_100379201 3300006871 Bacteria 1435
136 Ga0075429_100014206 3300006880 Bacteria 6902
137 Ga0075429_100025416 3300006880 Bacteria 5140
138 Ga0075429_100101004 3300006880 Bacteria 2518
139 Ga0075429_100605213 3300006880 Bacteria 960
140 Ga0097620_100007450 3300006931 Bacteria 11108
141 Ga0097620_100930172 3300006931 Bacteria 953
142 Ga0075435_100027267 3300007076 Bacteria 4466
143 Ga0075435_100228755 3300007076 Bacteria 1580
144 Ga0075435_100434742 3300007076 Bacteria 1131
145 Ga0105240_10074139 3300009093 Bacteria 4201
146 Ga0105240_10153558 3300009093 Bacteria 2740
147 Ga0105240_10654905 3300009093 Bacteria 1151
148 Ga0111539_10000008 3300009094 Bacteria 382609
149 Ga0111539_10000870 3300009094 Bacteria 39436
150 Ga0111539_10001659 3300009094 Bacteria 29730
151 Ga0111539_10106363 3300009094 Bacteria 3291
152 Ga0111539_10439494 3300009094 Bacteria 1519
153 Ga0111539_10458076 3300009094 Bacteria 1485
154 Ga0114129_10000574 3300009147 Bacteria 45251
155 Ga0114129_10000857 3300009147 Bacteria 39461
156 Ga0114129_10003568 3300009147 Bacteria 21908
157 Ga0114129_10016198 3300009147 Bacteria 10607
158 Ga0114129_10024472 3300009147 Bacteria 8555
159 Ga0114129_10949459 3300009147 Bacteria 1086
160 Ga0114129_11346526 3300009147 Unclassified 883
161 Ga0105241_10056421 3300009174 Bacteria 3011
162 Ga0105241_10708433 3300009174 Bacteria 920
163 Ga0105248_10651610 3300009177 Bacteria 1188
164 Ga0105248_10734364 3300009177 Bacteria 1114
165 Ga0105238_10397561 3300009551 Bacteria 1371
166 Ga0105249_10000230 3300009553 Bacteria 63452
167 Ga0105249_10121381 3300009553 Bacteria 2483
168 Ga0105249_10594671 3300009553 Bacteria 1160
169 Ga0105239_10112581 3300010375 Bacteria 3017
170 Ga0105246_10107078 3300011119 Bacteria 2046
171 Ga0157370_10726392 3300013104 Bacteria 906
172 Ga0157369_10342610 3300013105 Bacteria 1553
173 Ga0157369_10828864 3300013105 Bacteria 950
174 Ga0157372_10343337 3300013307 Bacteria 1739
175 Ga0157372_10343388 3300013307 Bacteria 1739
176 Ga0157375_10046618 3300013308 Bacteria 4228
177 Ga0157375_10319647 3300013308 Bacteria 1717
178 Ga0163163_10069127 3300014325 Bacteria 3516
179 Ga0163163_10293151 3300014325 Bacteria 1679
180 Ga0157380_10308768 3300014326 Bacteria 1461
181 Ga0157380_10859047 3300014326 Bacteria 930
182 Ga0182008_10165559 3300014497 Bacteria 1114
183 Ga0157379_10260415 3300014968 Bacteria 1576
184 Ga0206353_10005654 3300020082 Bacteria 1393
185 Ga0207666_1002498 3300025271 Bacteria 2220
186 Ga0207697_10001789 3300025315 Bacteria 11503
187 Ga0207688_10012956 3300025901 Bacteria 4533
188 Ga0207680_10645484 3300025903 Unclassified 758
189 Ga0207699_10218021 3300025906 Bacteria 1301
190 Ga0207643_10081944 3300025908 Bacteria 1870
191 Ga0207693_10014599 3300025915 Bacteria 6312
192 Ga0207663_10021464 3300025916 Bacteria 3677
193 Ga0207663_10374910 3300025916 Bacteria 1083
194 Ga0207663_10380035 3300025916 Unclassified 1076
195 Ga0207663_10667768 3300025916 Bacteria 821
196 Ga0207660_10023854 3300025917 Bacteria 4136
197 Ga0207660_10152649 3300025917 Bacteria 1776
198 Ga0207652_10021912 3300025921 Bacteria 5279
199 Ga0207652_10267014 3300025921 Bacteria 1543
200 Ga0207646_10044362 3300025922 Bacteria 3991
201 Ga0207681_10005166 3300025923 Bacteria 8015
202 Ga0207681_10460384 3300025923 Bacteria 1036
203 Ga0207650_10030655 3300025925 Bacteria 3876
204 Ga0207650_10110179 3300025925 Bacteria 2130
205 Ga0207650_10196495 3300025925 Unclassified 1614
206 Ga0207700_10011523 3300025928 Bacteria 5644
207 Ga0207700_10118088 3300025928 Bacteria 2146
208 Ga0207664_10017429 3300025929 Bacteria 5265
209 Ga0207690_10301455 3300025932 Bacteria 1254
210 Ga0207706_10104640 3300025933 Bacteria 2490
211 Ga0207706_10223426 3300025933 Bacteria 1649
212 Ga0207706_10672539 3300025933 Bacteria 886
213 Ga0207670_10366847 3300025936 Bacteria 1144
214 Ga0207669_10010135 3300025937 Bacteria 4526
215 Ga0207669_10022027 3300025937 Bacteria 3377
216 Ga0207669_10120121 3300025937 Bacteria 1782
217 Ga0207669_10122458 3300025937 Bacteria 1769
218 Ga0207669_10154395 3300025937 Bacteria 1612
219 Ga0207669_10414863 3300025937 Bacteria 1058
220 Ga0207704_10275254 3300025938 Bacteria 1277
221 Ga0207665_10008459 3300025939 Bacteria 6781
222 Ga0207691_10115755 3300025940 Bacteria 2380
223 Ga0207691_10266191 3300025940 Bacteria 1477
224 Ga0207691_10507885 3300025940 Bacteria 1023
225 Ga0207691_10609152 3300025940 Bacteria 924
226 Ga0207689_10137105 3300025942 Bacteria 2015
227 Ga0207661_10515004 3300025944 Bacteria 1094
228 Ga0207679_10322073 3300025945 Bacteria 1339
229 Ga0207667_10120205 3300025949 Bacteria 2707
230 Ga0207667_10182861 3300025949 Bacteria 2152
231 Ga0207712_10038601 3300025961 Bacteria 3266
232 Ga0207712_10387685 3300025961 Bacteria 1171
233 Ga0207668_10277545 3300025972 Bacteria 1373
234 Ga0207678_10130143 3300026067 Bacteria 2147
235 Ga0207678_10968461 3300026067 Bacteria 753
236 Ga0207708_10052944 3300026075 Bacteria 3091
237 Ga0207708_10157227 3300026075 Bacteria 1793
238 Ga0207641_10037309 3300026088 Bacteria 4058
239 Ga0207641_10204173 3300026088 Bacteria 1824
240 Ga0207676_10859314 3300026095 Unclassified 888
241 Ga0207674_10103058 3300026116 Bacteria 2833
242 Ga0207674_10106686 3300026116 Bacteria 2778
243 Ga0207675_100034443 3300026118 Bacteria 4722
244 Ga0207675_101060139 3300026118 Bacteria 830
245 Ga0207675_101233204 3300026118 Unclassified 768
246 Ga0207683_10126635 3300026121 Bacteria 2296
247 Ga0207683_10162089 3300026121 Bacteria 2022
248 Ga0209971_1006519 3300027682 Bacteria 2761
249 Ga0209813_10032989 3300027866 Bacteria 1537
250 Ga0207428_10000285 3300027907 Bacteria 68342
251 Ga0207428_10001407 3300027907 Bacteria 25352
252 Ga0207428_10049020 3300027907 Bacteria 3386
253 Ga0268266_10919260 3300028379 Bacteria 846
254 Ga0268265_10075102 3300028380 Bacteria 2646
255 Ga0307408_100007220 3300031548 Bacteria 7348
256 Ga0307408_100079772 3300031548 Bacteria 2443
257 Ga0316576_10209897 3300031727 Bacteria 1466
258 Ga0307413_10546745 3300031824 Bacteria 939
259 Ga0307410_10005377 3300031852 Bacteria 6771
260 Ga0307410_10114466 3300031852 Bacteria 1957
261 Ga0307410_10233348 3300031852 Bacteria 1422
262 Ga0307410_10385080 3300031852 Bacteria 1129
263 Ga0307406_10062657 3300031901 Bacteria 2406
264 Ga0307412_10412009 3300031911 Bacteria 1103
265 Ga0307412_10488171 3300031911 Bacteria 1023
266 Ga0307409_100187056 3300031995 Bacteria 1839
267 Ga0307409_100326589 3300031995 Bacteria 1438
268 Ga0307409_100658766 3300031995 Unclassified 1042
269 Ga0307416_100005385 3300032002 Bacteria 7857
270 Ga0307416_100024794 3300032002 Bacteria 4385
271 Ga0307416_100142713 3300032002 Bacteria 2180
272 Ga0307416_100147717 3300032002 Bacteria 2150
273 Ga0307416_100152269 3300032002 Bacteria 2123
274 Ga0307416_100202148 3300032002 Bacteria 1886
275 Ga0307414_10022618 3300032004 Bacteria 3970
276 Ga0307414_10030123 3300032004 Bacteria 3542
277 Ga0307414_10663574 3300032004 Bacteria 941
278 Ga0307411_10015778 3300032005 Bacteria 4255
279 Ga0307411_10049207 3300032005 Bacteria 2738
280 Ga0307411_10055183 3300032005 Bacteria 2613
281 Ga0307411_10255829 3300032005 Bacteria 1380
282 Ga0307411_10732867 3300032005 Bacteria 864
283 Ga0307415_100045149 3300032126 Bacteria 2952
284 Ga0373923_0017767 3300035111 Bacteria 2726
285 Ga0373956_0017203 3300035119 Bacteria 3046
286 Ga0373956_0040330 3300035119 Bacteria 2071
287 Ga0373943_0004706 3300035170 Bacteria 6170
288 Ga0373943_0083471 3300035170 Bacteria 1642
289 Ga0373955_0064667 3300035172 Bacteria 2028
290 Ga0373955_0443692 3300035172 Bacteria 791
291 Ga0373924_0090147 3300035410 Unclassified 1311
292 Ga0373924_0105739 3300035410 Bacteria 1213
293 Ga0373935_0053014 3300035692 Bacteria 2580
294 Ga0373927_0415410 3300035695 Bacteria 888
295 Ga0373933_0033407 3300035724 Bacteria 2993
296 Ga0373933_0194065 3300035724 Bacteria 1298
297 Ga0373937_0076775 3300036401 Bacteria 3086
298 Ga0373937_0494092 3300036401 Bacteria 1162
299 Ga0373937_0906118 3300036401 Unclassified 830
300 Ga0373925_0002527 3300037068 Bacteria 14578
301 Ga0373925_0004724 3300037068 Bacteria 10271
302 Ga0373925_0102236 3300037068 Bacteria 2205
303 Ga0395901_0599524 3300038443 Bacteria 1111
304 Ga0439439_0067739 3300041406 Bacteria 953
305 Ga0439439_0086146 3300041406 Bacteria 854
306 Ga0439453_0019151 3300041408 Unclassified 1216
307 Ga0439453_0043465 3300041408 Unclassified 888
308 Ga0439431_0009100 3300041997 Bacteria 2239
309 Ga0439431_0026832 3300041997 Bacteria 1413
310 Ga0439442_039386 3300042002 Bacteria 991
311 Ga0439442_054415 3300042002 Bacteria 846
312 Ga0439450_067508 3300042008 Bacteria 873
313 Ga0439455_0104111 3300042012 Bacteria 786
314 Ga0439457_044818 3300042014 Bacteria 988
315 Ga0439462_0020949 3300042015 Bacteria 1707
316 Ga0439462_0057343 3300042015 Bacteria 1051
317 Ga0439446_0000727 3300042156 Bacteria 6880
318 Ga0439446_0007852 3300042156 Bacteria 2815
319 Ga0439446_0068896 3300042156 Bacteria 1079
320 Ga0439435_0017097 3300042436 Bacteria 1829
321 Ga0439435_0140325 3300042436 Bacteria 769
322 Ga0439444_0004188 3300042437 Bacteria 2082
323 Ga0439464_0003067 3300042439 Bacteria 4178
324 Ga0451577_0029633 3300042876 Bacteria 4947
325 Ga0451577_0049163 3300042876 Bacteria 3766
326 Ga0451577_1154170 3300042876 Bacteria 692
327 Ga0439440_0084622 3300042993 Bacteria 843
328 Ga0466963_0066280 3300044694 Bacteria 2422
329 Ga0453684_0339326 3300044712 Bacteria 1697
330 Ga0466957_0000190 3300044842 Bacteria 28163
331 Ga0451576_0191856 3300045051 Bacteria 2134
332 Ga0466958_0059956 3300045836 Bacteria 2316
333 Ga0466967_0367994 3300045976 Bacteria 1394
334 Ga0495603_0021187 3300046455 Bacteria 3936
335 Ga0495603_0374380 3300046455 Bacteria 817
336 Ga0495651_0100322 3300046462 Bacteria 2157
337 Ga0495651_0291220 3300046462 Bacteria 1099
338 Ga0495582_0327506 3300046473 Bacteria 882
339 Ga0495594_0063581 3300046499 Bacteria 2045
340 Ga0495628_0191822 3300046516 Bacteria 1542
341 Ga0495634_0066276 3300046642 Bacteria 2391
342 Ga0495659_0076391 3300046664 Bacteria 1264
343 Ga0495599_0057312 3300046678 Bacteria 2438
344 Ga0495658_0388480 3300046683 Bacteria 889
345 Ga0495669_0063493 3300046684 Bacteria 1675
346 Ga0495581_0069069 3300047315 Bacteria 2043
347 Ga0495680_0364077 3300047322 Bacteria 1004
348 Ga0495602_0111814 3300048088 Bacteria 2217
349 Ga0496100_0083769 3300048903 Bacteria 2160
350 Ga0496102_0010134 3300048905 Bacteria 8105
351 Ga0496104_0323491 3300048907 Bacteria 1455
352 Ga0496106_0028722 3300048909 Bacteria 4143
353 Ga0496106_0111798 3300048909 Bacteria 2128
354 Ga0496106_0522500 3300048909 Bacteria 953
355 Ga0496107_0038246 3300048910 Bacteria 3444
356 Ga0496107_0146256 3300048910 Bacteria 1748
357 Ga0496109_0021698 3300048912 Bacteria 5683
358 Ga0496109_0139124 3300048912 Bacteria 2270
359 Ga0496110_0240180 3300048913 Bacteria 1648
360 Ga0496111_0370819 3300048914 Bacteria 1059
361 Ga0496112_0045209 3300048915 Bacteria 4316
362 Ga0496112_0099918 3300048915 Unclassified 2871
363 Ga0496112_0131460 3300048915 Bacteria 2474
364 Ga0496113_0144816 3300048916 Bacteria 1871
365 Ga0496113_0507094 3300048916 Unclassified 969
366 Ga0496115_0688259 3300048918 Bacteria 805
367 Ga0501298_009755 3300049521 Bacteria 1639
368 Ga0501299_008310 3300049522 Bacteria 1685
369 Ga0501299_037209 3300049522 Bacteria 963
370 Ga0501034_0265002 3300049571 Bacteria 1660
371 Ga0501036_0470923 3300049572 Bacteria 1046
372 Ga0501038_0308599 3300049574 Bacteria 1240
373 Ga0501039_0730951 3300049575 Bacteria 773
374 Ga0501040_0093119 3300049576 Bacteria 2096
375 Ga0501040_0187926 3300049576 Bacteria 1466
376 Ga0501040_0340428 3300049576 Bacteria 1074
377 Ga0501041_0099601 3300049577 Bacteria 1798
378 Ga0501041_0111487 3300049577 Bacteria 1697
379 Ga0501042_0063708 3300049578 Bacteria 2635
380 Ga0501048_0033095 3300049582 Bacteria 3736
381 Ga0501048_0140527 3300049582 Bacteria 1707
382 Ga0501071_0024253 3300049587 Bacteria 4241
383 Ga0501071_0103984 3300049587 Bacteria 2096
384 Ga0501071_0136639 3300049587 Bacteria 1824
385 Ga0501072_0183444 3300049588 Bacteria 1669
386 Ga0501072_0421610 3300049588 Bacteria 1058
387 Ga0501073_0039425 3300049589 Bacteria 3347
388 Ga0501073_0281741 3300049589 Bacteria 1147
389 Ga0501074_0308425 3300049590 Bacteria 1124
390 Ga0501075_0014357 3300049591 Bacteria 5675
391 Ga0501075_0091663 3300049591 Bacteria 2306
392 Ga0501076_0050221 3300049592 Bacteria 3299
393 Ga0501076_0143057 3300049592 Bacteria 1944
394 Ga0501076_0145643 3300049592 Bacteria 1926
395 Ga0501076_0254073 3300049592 Bacteria 1438
396 Ga0501076_0360408 3300049592 Bacteria 1194
397 Ga0501076_0381882 3300049592 Bacteria 1158
398 Ga0501077_0158415 3300049593 Bacteria 1437
399 Ga0501207_015462 3300049654 Unclassified 1175
400 Ga0501208_053941 3300049655 Unclassified 773
401 Ga0501079_0125906 3300049741 Bacteria 1993
402 Ga0501079_0129700 3300049741 Bacteria 1962
403 Ga0501079_0136919 3300049741 Bacteria 1907
404 Ga0501080_0393305 3300049742 Bacteria 1248
405 Ga0501080_0460526 3300049742 Bacteria 1139
406 Ga0501081_0073426 3300049743 Bacteria 2386
407 Ga0501081_0083342 3300049743 Bacteria 2241
408 Ga0501081_0085253 3300049743 Bacteria 2217
409 Ga0501081_0209016 3300049743 Bacteria 1417
410 Ga0501081_0381998 3300049743 Bacteria 1041
411 Ga0501035_0596944 3300049822 Unclassified 900
412 Ga0501045_0196675 3300049824 Bacteria 1502
413 Ga0501045_0675913 3300049824 Bacteria 762
414 nmdc:mga00v17_25075_c1 3300050491 Bacteria 3463
415 nmdc:mga00v17_3644_c1 3300050491 Bacteria 7962
416 nmdc:mga00v17_9961_c1 3300050491 Bacteria 4181
417 nmdc:mga0yw44_34063_c1 3300050492 Bacteria 2981
418 nmdc:mga0yw44_6678_c1 3300050492 Bacteria 5600
419 nmdc:mga0k408_149343_c1 3300050493 Bacteria 1391
420 nmdc:mga0k408_31765_c1 3300050493 Bacteria 3017
421 nmdc:mga0k408_5159_c1 3300050493 Bacteria 6924
422 nmdc:mga06z11_106868_c1 3300050494 Bacteria 1544
423 nmdc:mga06z11_214284_c1 3300050494 Bacteria 1123
424 nmdc:mga06z11_33718_c1 3300050494 Bacteria 2507
425 nmdc:mga04h51_39319_c1 3300050495 Bacteria 1536
426 nmdc:mga07m45_49951_c1 3300050496 Bacteria 2356
427 nmdc:mga05p37_12193_c1 3300050507 Bacteria 10263
428 nmdc:mga05p37_31095_c1 3300050507 Bacteria 6519
429 nmdc:mga05p37_39668_c1 3300050507 Bacteria 5782
430 nmdc:mga05p37_569_c2 3300050507 Bacteria 24307
431 nmdc:mga05p37_621164_c1 3300050507 Bacteria 1216
432 nmdc:mga05p37_815197_c1 3300050507 Bacteria 1019
433 nmdc:mga05p37_983549_c1 3300050507 Bacteria 899
434 nmdc:mga09592_155598_c1 3300050508 Bacteria 1973
435 nmdc:mga09592_3601_c1 3300050508 Bacteria 12502
436 nmdc:mga09592_3762_c1 3300050508 Bacteria 12226
437 nmdc:mga09592_57423_c1 3300050508 Bacteria 3289
438 nmdc:mga0qj67_255166_c1 3300050509 Bacteria 1423
439 nmdc:mga0qj67_7314_c1 3300050509 Bacteria 8161
440 nmdc:mga06r32_120382_c1 3300050510 Bacteria 2589
441 nmdc:mga06r32_22778_c1 3300050510 Bacteria 5793
442 nmdc:mga06r32_3980_c1 3300050510 Bacteria 13238
443 nmdc:mga06r32_927774_c1 3300050510 Bacteria 826
444 nmdc:mga08y16_16284_c1 3300050511 Bacteria 7817
445 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
446 nmdc:mga08y16_361004_c1 3300050511 Bacteria 1491
447 nmdc:mga08y16_40211_c1 3300050511 Bacteria 4902
448 nmdc:mga08y16_422330_c1 3300050511 Bacteria 1362
449 nmdc:mga08y16_422726_c1 3300050511 Bacteria 1362
450 nmdc:mga08y16_555998_c1 3300050511 Bacteria 1161
451 nmdc:mga08y16_735_c1 3300050511 Bacteria 31112
452 nmdc:mga0n895_123625_c1 3300050512 Bacteria 2610
453 nmdc:mga0n895_191386_c1 3300050512 Bacteria 2077
454 nmdc:mga0n895_51007_c1 3300050512 Bacteria 4059
455 nmdc:mga0n895_544114_c1 3300050512 Bacteria 1167
456 nmdc:mga0n895_80259_c1 3300050512 Bacteria 3250
457 nmdc:mga0rr50_333743_c1 3300050513 Bacteria 1273
458 nmdc:mga0rr50_34471_c1 3300050513 Bacteria 3625
459 nmdc:mga0rr50_48364_c1 3300050513 Bacteria 3143
460 nmdc:mga08x19_69540_c1 3300050514 Bacteria 2293
461 nmdc:mga0a205_219952_c1 3300050515 Bacteria 1785
462 nmdc:mga0a205_315518_c1 3300050515 Bacteria 1435
463 nmdc:mga0a205_4572_c1 3300050515 Bacteria 12409
464 nmdc:mga0a205_63329_c1 3300050515 Bacteria 3573
465 nmdc:mga0sz30_61284_c1 3300050516 Bacteria 1607
466 Ga0495601_0003497 3300053077 Bacteria 9020
467 Ga0495612_0039779 3300053078 Bacteria 1914
468 Ga0495595_0074233 3300053084 Unclassified 1612
469 Ga0495619_0060487 3300053085 Bacteria 2518
470 Ga0495619_0380172 3300053085 Bacteria 976
471 Ga0501084_0044927 3300054114 Bacteria 3699
472 Ga0501084_0054785 3300054114 Bacteria 3336
473 Ga0501084_0138477 3300054114 Bacteria 2049
474 Ga0501082_0019848 3300060353 Bacteria 5796
475 Ga0501082_0085997 3300060353 Bacteria 2712
476 Ga0501082_0335630 3300060353 Bacteria 1317
477 Ga0501082_0445150 3300060353 Bacteria 1132
478 Ga0530510_0092276 3300061734 Bacteria 2210
479 Ga0530510_0109139 3300061734 Bacteria 2026
480 Ga0530510_0128750 3300061734 Bacteria 1862
481 Ga0075433_10635764
482 JGI24751J29686_10007734
483 Ga0065715_10090135
484 Ga0065715_10093168
485 Ga0065715_10094425
486 Ga0065715_10177648
487 Ga0065707_10114653
488 Ga0070658_10321722
489 Ga0070683_100200920
490 Ga0070690_100858678
491 Ga0070670_100014101
492 Ga0070670_100160517
493 Ga0070670_100276023
494 Ga0070677_10068824
495 Ga0070666_10671930
496 Ga0070680_100142347
497 Ga0070680_100750584
498 Ga0070689_100059391
499 Ga0070689_100242375
500 Ga0070669_100000166
501 Ga0070669_100103009
502 Ga0070675_100031700
503 Ga0070675_100120694
504 Ga0070675_100645010
505 Ga0070674_100004110
506 Ga0070674_100016261
507 Ga0070674_100190169
508 Ga0070673_100415968
509 Ga0070673_101273132
510 Ga0070688_100130584
511 Ga0070659_100133285
512 Ga0070659_100605516
513 Ga0070659_100731417
514 Ga0070709_10000650
515 Ga0070709_10005969
516 Ga0070714_100048160
517 Ga0070714_100342508
518 Ga0070713_100124710
519 Ga0070713_100167769
520 Ga0070701_10025882
521 Ga0070701_10314135
522 Ga0070711_100007075
523 Ga0070711_100029622
524 Ga0070711_100401939
525 Ga0070705_100424268
526 Ga0070700_100128348
527 Ga0070663_100258665
528 Ga0070663_100267877
529 Ga0070678_100107675
530 Ga0070678_100190939
531 Ga0070662_100194332
532 Ga0070662_100251427
533 Ga0070681_10145070
534 Ga0070681_10475613
535 Ga0070685_10083796
536 Ga0070706_100557945
537 Ga0070707_100045214
538 Ga0070698_100365037
539 Ga0070699_100112472
540 Ga0070699_100490043
541 Ga0070679_100005089
542 Ga0070679_100421783
543 Ga0070684_101163880
544 Ga0070672_100104734
545 Ga0070672_100545675
546 Ga0070672_100765988
547 Ga0070686_100326171
548 Ga0070686_100404358
549 Ga0070695_100128272
550 Ga0070696_100266146
551 Ga0070693_100015889
552 Ga0070693_100021976
553 Ga0070704_100012627
554 Ga0070704_100192191
555 Ga0068855_100240830
556 Ga0068855_100249501
557 Ga0068855_100256204
558 Ga0070664_100115117
559 Ga0070664_100279188
560 Ga0068857_100035159
561 Ga0068859_100007450
562 Ga0068859_100930080
563 Ga0068864_100091986
564 Ga0068864_100142875
565 Ga0068861_100172652
566 Ga0068861_100389179
567 Ga0068870_10112393
568 Ga0068870_10278179
569 Ga0068863_100230366
570 Ga0068863_100334782
571 Ga0068860_100284061
572 Ga0068862_100006398
573 Ga0068862_100041431
574 Ga0068862_101094659
575 Ga0081455_10015599
576 Ga0081455_10149085
577 Ga0070717_10060980
578 Ga0070717_10092525
579 Ga0070717_10760332
580 Ga0075365_10115914
581 Ga0075368_10006201
582 Ga0075368_10015026
583 Ga0075368_10054038
584 Ga0075364_10096258
585 Ga0070716_100098596
586 Ga0070716_100152555
587 Ga0070712_100032743
588 Ga0075362_10001628
589 Ga0075367_10003716
590 Ga0075369_10315601
591 Ga0075366_10016996
592 Ga0075366_10076671
593 Ga0097621_100000391
594 Ga0097621_100342041
595 Ga0075370_10076812
596 Ga0068871_100000311
597 Ga0068871_100357605
598 Ga0075428_100000005
599 Ga0075428_100000058
600 Ga0075428_100001126
601 Ga0075428_100003840
602 Ga0075430_100000961
603 Ga0075430_100299724
604 Ga0075431_100011056
605 Ga0075431_100051771
606 Ga0075431_100337020
607 Ga0075431_101006614
608 Ga0075433_10048176
609 Ga0075433_10151418
610 Ga0075433_10170193
611 Ga0075433_10308728
612 Ga0075433_10385947
613 Ga0075434_100245831
614 Ga0075434_100318570
615 Ga0075434_100379201
616 Ga0075429_100014206
617 Ga0075429_100025416
618 Ga0075429_100101004
619 Ga0075429_100605213
620 Ga0097620_100007450
621 Ga0097620_100930172
622 Ga0075435_100027267
623 Ga0075435_100228755
624 Ga0075435_100434742
625 Ga0105240_10074139
626 Ga0105240_10153558
627 Ga0105240_10654905
628 Ga0111539_10000008
629 Ga0111539_10000870
630 Ga0111539_10001659
631 Ga0111539_10106363
632 Ga0111539_10439494
633 Ga0111539_10458076
634 Ga0114129_10000574
635 Ga0114129_10000857
636 Ga0114129_10003568
637 Ga0114129_10016198
638 Ga0114129_10024472
639 Ga0114129_10949459
640 Ga0114129_11346526
641 Ga0105241_10056421
642 Ga0105241_10708433
643 Ga0105248_10651610
644 Ga0105248_10734364
645 Ga0105238_10397561
646 Ga0105249_10000230
647 Ga0105249_10121381
648 Ga0105249_10594671
649 Ga0105239_10112581
650 Ga0105246_10107078
651 Ga0157370_10726392
652 Ga0157369_10342610
653 Ga0157369_10828864
654 Ga0157372_10343337
655 Ga0157372_10343388
656 Ga0157375_10046618
657 Ga0157375_10319647
658 Ga0163163_10069127
659 Ga0163163_10293151
660 Ga0157380_10308768
661 Ga0157380_10859047
662 Ga0182008_10165559
663 Ga0157379_10260415
664 Ga0206353_10005654
665 Ga0207666_1002498
666 Ga0207697_10001789
667 Ga0207688_10012956
668 Ga0207680_10645484
669 Ga0207699_10218021
670 Ga0207643_10081944
671 Ga0207693_10014599
672 Ga0207663_10021464
673 Ga0207663_10374910
674 Ga0207663_10380035
675 Ga0207663_10667768
676 Ga0207660_10023854
677 Ga0207660_10152649
678 Ga0207652_10021912
679 Ga0207652_10267014
680 Ga0207646_10044362
681 Ga0207681_10005166
682 Ga0207681_10460384
683 Ga0207650_10030655
684 Ga0207650_10110179
685 Ga0207650_10196495
686 Ga0207700_10011523
687 Ga0207700_10118088
688 Ga0207664_10017429
689 Ga0207690_10301455
690 Ga0207706_10104640
691 Ga0207706_10223426
692 Ga0207706_10672539
693 Ga0207670_10366847
694 Ga0207669_10010135
695 Ga0207669_10022027
696 Ga0207669_10120121
697 Ga0207669_10122458
698 Ga0207669_10154395
699 Ga0207669_10414863
700 Ga0207704_10275254
701 Ga0207665_10008459
702 Ga0207691_10115755
703 Ga0207691_10266191
704 Ga0207691_10507885
705 Ga0207691_10609152
706 Ga0207689_10137105
707 Ga0207661_10515004
708 Ga0207679_10322073
709 Ga0207667_10120205
710 Ga0207667_10182861
711 Ga0207712_10038601
712 Ga0207712_10387685
713 Ga0207668_10277545
714 Ga0207678_10130143
715 Ga0207678_10968461
716 Ga0207708_10052944
717 Ga0207708_10157227
718 Ga0207641_10037309
719 Ga0207641_10204173
720 Ga0207676_10859314
721 Ga0207674_10103058
722 Ga0207674_10106686
723 Ga0207675_100034443
724 Ga0207675_101060139
725 Ga0207675_101233204
726 Ga0207683_10126635
727 Ga0207683_10162089
728 Ga0209971_1006519
729 Ga0209813_10032989
730 Ga0207428_10000285
731 Ga0207428_10001407
732 Ga0207428_10049020
733 Ga0268266_10919260
734 Ga0268265_10075102
735 Ga0307408_100007220
736 Ga0307408_100079772
737 Ga0316576_10209897
738 Ga0307413_10546745
739 Ga0307410_10005377
740 Ga0307410_10114466
741 Ga0307410_10233348
742 Ga0307410_10385080
743 Ga0307406_10062657
744 Ga0307412_10412009
745 Ga0307412_10488171
746 Ga0307409_100187056
747 Ga0307409_100326589
748 Ga0307409_100658766
749 Ga0307416_100005385
750 Ga0307416_100024794
751 Ga0307416_100142713
752 Ga0307416_100147717
753 Ga0307416_100152269
754 Ga0307416_100202148
755 Ga0307414_10022618
756 Ga0307414_10030123
757 Ga0307414_10663574
758 Ga0307411_10015778
759 Ga0307411_10049207
760 Ga0307411_10055183
761 Ga0307411_10255829
762 Ga0307411_10732867
763 Ga0307415_100045149
764 Ga0373923_0017767
765 Ga0373956_0017203
766 Ga0373956_0040330
767 Ga0373943_0004706
768 Ga0373943_0083471
769 Ga0373955_0064667
770 Ga0373955_0443692
771 Ga0373924_0090147
772 Ga0373924_0105739
773 Ga0373935_0053014
774 Ga0373927_0415410
775 Ga0373933_0033407
776 Ga0373933_0194065
777 Ga0373937_0076775
778 Ga0373937_0494092
779 Ga0373937_0906118
780 Ga0373925_0002527
781 Ga0373925_0004724
782 Ga0373925_0102236
783 Ga0395901_0599524
784 Ga0439439_0067739
785 Ga0439439_0086146
786 Ga0439453_0019151
787 Ga0439453_0043465
788 Ga0439431_0009100
789 Ga0439431_0026832
790 Ga0439442_039386
791 Ga0439442_054415
792 Ga0439450_067508
793 Ga0439455_0104111
794 Ga0439457_044818
795 Ga0439462_0020949
796 Ga0439462_0057343
797 Ga0439446_0000727
798 Ga0439446_0007852
799 Ga0439446_0068896
800 Ga0439435_0017097
801 Ga0439435_0140325
802 Ga0439444_0004188
803 Ga0439464_0003067
804 Ga0451577_0029633
805 Ga0451577_0049163
806 Ga0451577_1154170
807 Ga0439440_0084622
808 Ga0466963_0066280
809 Ga0453684_0339326
810 Ga0466957_0000190
811 Ga0451576_0191856
812 Ga0466958_0059956
813 Ga0466967_0367994
814 Ga0495603_0021187
815 Ga0495603_0374380
816 Ga0495651_0100322
817 Ga0495651_0291220
818 Ga0495582_0327506
819 Ga0495594_0063581
820 Ga0495628_0191822
821 Ga0495634_0066276
822 Ga0495659_0076391
823 Ga0495599_0057312
824 Ga0495658_0388480
825 Ga0495669_0063493
826 Ga0495581_0069069
827 Ga0495680_0364077
828 Ga0495602_0111814
829 Ga0496100_0083769
830 Ga0496102_0010134
831 Ga0496104_0323491
832 Ga0496106_0028722
833 Ga0496106_0111798
834 Ga0496106_0522500
835 Ga0496107_0038246
836 Ga0496107_0146256
837 Ga0496109_0021698
838 Ga0496109_0139124
839 Ga0496110_0240180
840 Ga0496111_0370819
841 Ga0496112_0045209
842 Ga0496112_0099918
843 Ga0496112_0131460
844 Ga0496113_0144816
845 Ga0496113_0507094
846 Ga0496115_0688259
847 Ga0501298_009755
848 Ga0501299_008310
849 Ga0501299_037209
850 Ga0501034_0265002
851 Ga0501036_0470923
852 Ga0501038_0308599
853 Ga0501039_0730951
854 Ga0501040_0093119
855 Ga0501040_0187926
856 Ga0501040_0340428
857 Ga0501041_0099601
858 Ga0501041_0111487
859 Ga0501042_0063708
860 Ga0501048_0033095
861 Ga0501048_0140527
862 Ga0501071_0024253
863 Ga0501071_0103984
864 Ga0501071_0136639
865 Ga0501072_0183444
866 Ga0501072_0421610
867 Ga0501073_0039425
868 Ga0501073_0281741
869 Ga0501074_0308425
870 Ga0501075_0014357
871 Ga0501075_0091663
872 Ga0501076_0050221
873 Ga0501076_0143057
874 Ga0501076_0145643
875 Ga0501076_0254073
876 Ga0501076_0360408
877 Ga0501076_0381882
878 Ga0501077_0158415
879 Ga0501207_015462
880 Ga0501208_053941
881 Ga0501079_0125906
882 Ga0501079_0129700
883 Ga0501079_0136919
884 Ga0501080_0393305
885 Ga0501080_0460526
886 Ga0501081_0073426
887 Ga0501081_0083342
888 Ga0501081_0085253
889 Ga0501081_0209016
890 Ga0501081_0381998
891 Ga0501035_0596944
892 Ga0501045_0196675
893 Ga0501045_0675913
894 nmdc:mga00v17_25075_c1
895 nmdc:mga00v17_3644_c1
896 nmdc:mga00v17_9961_c1
897 nmdc:mga0yw44_34063_c1
898 nmdc:mga0yw44_6678_c1
899 nmdc:mga0k408_149343_c1
900 nmdc:mga0k408_31765_c1
901 nmdc:mga0k408_5159_c1
902 nmdc:mga06z11_106868_c1
903 nmdc:mga06z11_214284_c1
904 nmdc:mga06z11_33718_c1
905 nmdc:mga04h51_39319_c1
906 nmdc:mga07m45_49951_c1
907 nmdc:mga05p37_12193_c1
908 nmdc:mga05p37_31095_c1
909 nmdc:mga05p37_39668_c1
910 nmdc:mga05p37_569_c2
911 nmdc:mga05p37_621164_c1
912 nmdc:mga05p37_815197_c1
913 nmdc:mga05p37_983549_c1
914 nmdc:mga09592_155598_c1
915 nmdc:mga09592_3601_c1
916 nmdc:mga09592_3762_c1
917 nmdc:mga09592_57423_c1
918 nmdc:mga0qj67_255166_c1
919 nmdc:mga0qj67_7314_c1
920 nmdc:mga06r32_120382_c1
921 nmdc:mga06r32_22778_c1
922 nmdc:mga06r32_3980_c1
923 nmdc:mga06r32_927774_c1
924 nmdc:mga08y16_16284_c1
925 nmdc:mga08y16_17_c1
926 nmdc:mga08y16_361004_c1
927 nmdc:mga08y16_40211_c1
928 nmdc:mga08y16_422330_c1
929 nmdc:mga08y16_422726_c1
930 nmdc:mga08y16_555998_c1
931 nmdc:mga08y16_735_c1
932 nmdc:mga0n895_123625_c1
933 nmdc:mga0n895_191386_c1
934 nmdc:mga0n895_51007_c1
935 nmdc:mga0n895_544114_c1
936 nmdc:mga0n895_80259_c1
937 nmdc:mga0rr50_333743_c1
938 nmdc:mga0rr50_34471_c1
939 nmdc:mga0rr50_48364_c1
940 nmdc:mga08x19_69540_c1
941 nmdc:mga0a205_219952_c1
942 nmdc:mga0a205_315518_c1
943 nmdc:mga0a205_4572_c1
944 nmdc:mga0a205_63329_c1
945 nmdc:mga0sz30_61284_c1
946 Ga0495601_0003497
947 Ga0495612_0039779
948 Ga0495595_0074233
949 Ga0495619_0060487
950 Ga0495619_0380172
951 Ga0501084_0044927
952 Ga0501084_0054785
953 Ga0501084_0138477
954 Ga0501082_0019848
955 Ga0501082_0085997
956 Ga0501082_0335630
957 Ga0501082_0445150
958 Ga0530510_0092276
959 Ga0530510_0109139
960 Ga0530510_0128750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

27

88

0.99

PF07499

RuvA_C

RuvA, C-terminal domain

177

224

0.96

PF14520

HHH_5

Helix-hairpin-helix domain

98

156

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x7q-assembly1.cif.gz_G cryoem structure of ruva-ruvb-holliday junction complex 0.9677 1 132
2zte-assembly1.cif.gz_A mtruva form iv 0.9577 1 132
7pbu-assembly1.cif.gz_F ruvab branch migration motor complexed to the holliday junction - ruva-hj core [t2 dataset] 0.9572 1 131
1ixr-assembly1.cif.gz_A ruva-ruvb complex 0.9435 1 136
7x7q-assembly1.cif.gz_G cryoem structure of ruva-ruvb-holliday junction complex 0.94 1 132
ID Description Score Start End Superfamily
2h5xD03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9786 150 197 1.10.8.10
2ztcB03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.976 150 197 1.10.8.10
1d8lB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9759 1 65 2.40.50.140
2h5xA03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9756 150 197 1.10.8.10
2ztdB03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9741 151 197 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A2V9B6I0-F1-model_v4 Holliday junction branch migration protein RuvA 0.9975 1 86 GO:0003677
GO:0005524
GO:0006281
GO:0006310
GO:0009378
AF-A0A7W1I2A7-F1-model_v4 Holliday junction branch migration protein RuvA (EC 3.6.4.12) 0.9968 1 120 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A3D1XZW5-F1-model_v4 deleted 0.9925 1 80
AF-A0A7C2L542-F1-model_v4 Holliday junction branch migration protein RuvA 0.9894 1 132 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
AF-A0A523QLT6-F1-model_v4 Holliday junction branch migration protein RuvA (EC 3.6.4.12) 0.9892 1 131 GO:0003677
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518

Map