F452184

General Info

Members Datasets Scaffolds Average Seq Length
480 243 960 105

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_101619579|Ga0070697_1016195791
Length 122
Sequence MCRPLFHSRLFFNKLCGMPFIITDPCITTKDTACVDVCPVDCIHPRKDEPEFEQTTMLYIHPEECIDCGPATQKDLVEANLVYRNGDPETMARAEEIVRTHMETYAELMAVPATERAAAHST

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
166 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
216 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
217 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
218 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
225 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
226 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 2.92
Rhizosphere 94.58
Stem 0
Stem Tuber 0
Unclassified 5.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_101619579 3300005536 Bacteria 579
2 SwRhRL3b_contig_4416910 2162886006 Unclassified 907
3 JGI25406J46586_10000695 3300003203 Bacteria 15683
4 JGI25406J46586_10114238 3300003203 Bacteria 798
5 Ga0058860_11851491 3300004801 Bacteria 545
6 Ga0065704_10077360 3300005289 Bacteria 4752
7 Ga0065704_10128236 3300005289 Bacteria 1665
8 Ga0065712_10000303 3300005290 Bacteria 26548
9 Ga0065712_10167490 3300005290 Bacteria 1264
10 Ga0065712_10272681 3300005290 Bacteria 912
11 Ga0065712_10375388 3300005290 Bacteria 740
12 Ga0065715_10030402 3300005293 Bacteria 2045
13 Ga0065715_10072795 3300005293 Bacteria 636
14 Ga0065715_10128895 3300005293 Bacteria 2056
15 Ga0065715_10279474 3300005293 Bacteria 1090
16 Ga0065715_10290835 3300005293 Bacteria 1049
17 Ga0065715_10368289 3300005293 Bacteria 925
18 Ga0065707_10001592 3300005295 Bacteria 10725
19 Ga0065707_10008537 3300005295 Bacteria 5458
20 Ga0065707_10319442 3300005295 Bacteria 969
21 Ga0065707_10438225 3300005295 Bacteria 813
22 Ga0065707_10560170 3300005295 Bacteria 715
23 Ga0070676_10769456 3300005328 Unclassified 708
24 Ga0070676_10897776 3300005328 Bacteria 660
25 Ga0070670_100352689 3300005331 Unclassified 1293
26 Ga0070670_100419779 3300005331 Bacteria 1182
27 Ga0070677_10025391 3300005333 Bacteria 2212
28 Ga0068869_100083010 3300005334 Bacteria 2396
29 Ga0070666_10093376 3300005335 Bacteria 2069
30 Ga0070666_11218360 3300005335 Bacteria 561
31 Ga0068868_100139394 3300005338 Bacteria 1990
32 Ga0070689_100020864 3300005340 Bacteria 4868
33 Ga0070689_101244766 3300005340 Bacteria 669
34 Ga0070687_100018053 3300005343 Bacteria 3255
35 Ga0070692_10235348 3300005345 Bacteria 1089
36 Ga0070669_100426553 3300005353 Bacteria 1089
37 Ga0070669_100516623 3300005353 Bacteria 992
38 Ga0070669_100541351 3300005353 Bacteria 970
39 Ga0070675_100001034 3300005354 Bacteria 20022
40 Ga0070675_100001083 3300005354 Bacteria 19667
41 Ga0070675_100002698 3300005354 Bacteria 13341
42 Ga0070675_100054811 3300005354 Bacteria 3281
43 Ga0070675_100267232 3300005354 Unclassified 1500
44 Ga0070675_100570478 3300005354 Bacteria 1025
45 Ga0070675_100961308 3300005354 Bacteria 784
46 Ga0070675_101076397 3300005354 Bacteria 739
47 Ga0070671_100661796 3300005355 Bacteria 905
48 Ga0070671_100663666 3300005355 Unclassified 903
49 Ga0070671_100715982 3300005355 Bacteria 869
50 Ga0070674_100008295 3300005356 Bacteria 6181
51 Ga0070674_100546022 3300005356 Bacteria 972
52 Ga0070674_100883399 3300005356 Bacteria 777
53 Ga0070673_100183038 3300005364 Bacteria 1794
54 Ga0070673_100414849 3300005364 Bacteria 1206
55 Ga0070688_101305022 3300005365 Bacteria 586
56 Ga0070659_101609742 3300005366 Bacteria 580
57 Ga0070667_100690780 3300005367 Bacteria 944
58 Ga0070701_10013847 3300005438 Bacteria 3681
59 Ga0070701_10488924 3300005438 Bacteria 797
60 Ga0070701_10667209 3300005438 Bacteria 696
61 Ga0070711_100842264 3300005439 Bacteria 780
62 Ga0070705_100019441 3300005440 Bacteria 3575
63 Ga0070705_100023408 3300005440 Bacteria 3316
64 Ga0070700_100077811 3300005441 Bacteria 2134
65 Ga0070700_100617452 3300005441 Bacteria 852
66 Ga0070700_100667406 3300005441 Bacteria 823
67 Ga0070694_100171399 3300005444 Bacteria 1599
68 Ga0070694_101150057 3300005444 Bacteria 649
69 Ga0070694_101204939 3300005444 Bacteria 635
70 Ga0070708_100026807 3300005445 Bacteria 4937
71 Ga0070708_100377430 3300005445 Bacteria 1337
72 Ga0070663_101179181 3300005455 Bacteria 672
73 Ga0070678_100145860 3300005456 Bacteria 1900
74 Ga0070678_100593245 3300005456 Bacteria 988
75 Ga0070662_100061090 3300005457 Bacteria 2750
76 Ga0070662_101529262 3300005457 Bacteria 576
77 Ga0070685_10050628 3300005466 Bacteria 2400
78 Ga0070706_100214459 3300005467 Bacteria 1797
79 Ga0070707_100031473 3300005468 Bacteria 5054
80 Ga0070707_100509730 3300005468 Bacteria 1165
81 Ga0070707_100752297 3300005468 Bacteria 938
82 Ga0070698_100015642 3300005471 Bacteria 8013
83 Ga0070698_100909462 3300005471 Bacteria 826
84 Ga0070698_101633672 3300005471 Bacteria 597
85 Ga0070699_100022310 3300005518 Bacteria 5455
86 Ga0070699_100052975 3300005518 Bacteria 3512
87 Ga0070699_101959272 3300005518 Bacteria 536
88 Ga0070684_100922242 3300005535 Bacteria 819
89 Ga0070697_100430721 3300005536 Bacteria 1147
90 Ga0070697_100915890 3300005536 Bacteria 778
91 Ga0070672_100357289 3300005543 Bacteria 1246
92 Ga0070686_100671330 3300005544 Bacteria 824
93 Ga0070695_100018884 3300005545 Bacteria 4191
94 Ga0070696_100015114 3300005546 Bacteria 5182
95 Ga0070696_100069959 3300005546 Bacteria 2467
96 Ga0070696_100364272 3300005546 Bacteria 1123
97 Ga0070665_100022116 3300005548 Bacteria 6397
98 Ga0070704_100002091 3300005549 Bacteria 11104
99 Ga0070704_100007889 3300005549 Bacteria 6354
100 Ga0070704_100680321 3300005549 Bacteria 911
101 Ga0070664_100218518 3300005564 Bacteria 1705
102 Ga0070664_100925749 3300005564 Bacteria 818
103 Ga0068857_101326677 3300005577 Bacteria 699
104 Ga0070702_100390218 3300005615 Bacteria 993
105 Ga0068859_100002272 3300005617 Bacteria 19501
106 Ga0068859_100029714 3300005617 Bacteria 5484
107 Ga0068859_101153196 3300005617 Bacteria 853
108 Ga0068859_101953843 3300005617 Bacteria 648
109 Ga0068864_100159187 3300005618 Bacteria 2052
110 Ga0068864_100212318 3300005618 Bacteria 1783
111 Ga0068864_100269270 3300005618 Bacteria 1587
112 Ga0068864_101669426 3300005618 Bacteria 642
113 Ga0068866_10048521 3300005718 Bacteria 2147
114 Ga0068866_10435982 3300005718 Bacteria 853
115 Ga0068861_100166823 3300005719 Bacteria 1821
116 Ga0068861_100311581 3300005719 Bacteria 1367
117 Ga0068861_101265538 3300005719 Bacteria 716
118 Ga0068861_102300197 3300005719 Unclassified 541
119 Ga0068851_10904379 3300005834 Bacteria 553
120 Ga0068851_11043930 3300005834 Bacteria 517
121 Ga0068870_10036889 3300005840 Bacteria 2517
122 Ga0068870_10393814 3300005840 Bacteria 900
123 Ga0068863_100385613 3300005841 Bacteria 1369
124 Ga0068863_100615527 3300005841 Bacteria 1076
125 Ga0068863_100683960 3300005841 Bacteria 1019
126 Ga0068858_100012518 3300005842 Bacteria 8000
127 Ga0068858_100130711 3300005842 Bacteria 2354
128 Ga0068858_100311342 3300005842 Bacteria 1504
129 Ga0068858_101114982 3300005842 Bacteria 775
130 Ga0068862_100025908 3300005844 Bacteria 4926
131 Ga0068862_100176748 3300005844 Bacteria 1914
132 Ga0068862_101123963 3300005844 Bacteria 782
133 Ga0068862_101550588 3300005844 Bacteria 669
134 Ga0081539_10000280 3300005985 Bacteria 115290
135 Ga0081539_10004746 3300005985 Bacteria 14686
136 Ga0075368_10005955 3300006042 Bacteria 4225
137 Ga0070715_10408047 3300006163 Bacteria 757
138 Ga0070716_100381138 3300006173 Bacteria 1008
139 Ga0075367_10607409 3300006178 Bacteria 695
140 Ga0075367_10736159 3300006178 Bacteria 627
141 Ga0075366_10188414 3300006195 Bacteria 1254
142 Ga0097621_100080451 3300006237 Bacteria 2710
143 Ga0068871_100419727 3300006358 Bacteria 1194
144 Ga0068871_100522589 3300006358 Bacteria 1072
145 Ga0068871_100658069 3300006358 Bacteria 957
146 Ga0068871_101131509 3300006358 Bacteria 733
147 Ga0075428_100000004 3300006844 Bacteria 326694
148 Ga0075428_100065546 3300006844 Bacteria 3977
149 Ga0075428_101244071 3300006844 Bacteria 784
150 Ga0075430_100139185 3300006846 Bacteria 2021
151 Ga0075430_100489444 3300006846 Bacteria 1015
152 Ga0075431_100725510 3300006847 Bacteria 970
153 Ga0075433_10001391 3300006852 Bacteria 17834
154 Ga0075433_10042679 3300006852 Bacteria 3936
155 Ga0075433_10115380 3300006852 Bacteria 2383
156 Ga0075433_10425646 3300006852 Unclassified 1171
157 Ga0075433_10726808 3300006852 Bacteria 869
158 Ga0075433_10796490 3300006852 Bacteria 826
159 Ga0075433_10931427 3300006852 Bacteria 757
160 Ga0075434_100000556 3300006871 Bacteria 28600
161 Ga0075434_100002301 3300006871 Bacteria 16704
162 Ga0075434_100088391 3300006871 Bacteria 3099
163 Ga0075434_100141343 3300006871 Bacteria 2427
164 Ga0075434_101080209 3300006871 Bacteria 816
165 Ga0075429_100081152 3300006880 Unclassified 2828
166 Ga0075429_100124243 3300006880 Bacteria 2256
167 Ga0068865_100380055 3300006881 Bacteria 1152
168 Ga0068865_100442737 3300006881 Bacteria 1073
169 Ga0068865_101027762 3300006881 Bacteria 723
170 Ga0075436_100016489 3300006914 Bacteria 5056
171 Ga0075436_100692379 3300006914 Bacteria 755
172 Ga0097620_100002272 3300006931 Bacteria 19501
173 Ga0097620_100029712 3300006931 Bacteria 5484
174 Ga0097620_101153240 3300006931 Bacteria 853
175 Ga0097620_101953793 3300006931 Bacteria 648
176 Ga0075435_100003391 3300007076 Bacteria 10802
177 Ga0075435_100091896 3300007076 Bacteria 2505
178 Ga0075435_100283725 3300007076 Bacteria 1414
179 Ga0075435_100487654 3300007076 Bacteria 1065
180 Ga0111539_10000005 3300009094 Bacteria 467342
181 Ga0111539_10027821 3300009094 Bacteria 6904
182 Ga0111539_10092178 3300009094 Bacteria 3560
183 Ga0111539_10120227 3300009094 Bacteria 3078
184 Ga0111539_11345654 3300009094 Bacteria 829
185 Ga0105245_10107999 3300009098 Bacteria 2584
186 Ga0105245_10805787 3300009098 Unclassified 977
187 Ga0114129_10040808 3300009147 Bacteria 6542
188 Ga0114129_10091941 3300009147 Unclassified 4203
189 Ga0114129_10107312 3300009147 Bacteria 3857
190 Ga0114129_10179776 3300009147 Bacteria 2880
191 Ga0114129_10187411 3300009147 Bacteria 2811
192 Ga0114129_10208699 3300009147 Unclassified 2642
193 Ga0114129_10257051 3300009147 Bacteria 2343
194 Ga0114129_10758580 3300009147 Bacteria 1241
195 Ga0114129_11235763 3300009147 Bacteria 929
196 Ga0114129_11919699 3300009147 Bacteria 718
197 Ga0105243_10149466 3300009148 Bacteria 2002
198 Ga0105243_10159374 3300009148 Bacteria 1944
199 Ga0105241_12499997 3300009174 Bacteria 517
200 Ga0105242_10023786 3300009176 Bacteria 4832
201 Ga0105248_10151440 3300009177 Bacteria 2617
202 Ga0105248_10880435 3300009177 Bacteria 1011
203 Ga0105248_10892735 3300009177 Bacteria 1003
204 Ga0105238_11083182 3300009551 Bacteria 824
205 Ga0105249_10136795 3300009553 Bacteria 2345
206 Ga0105249_10474293 3300009553 Bacteria 1293
207 Ga0105249_11024165 3300009553 Bacteria 895
208 Ga0105249_11205063 3300009553 Unclassified 828
209 Ga0157324_1020109 3300012506 Bacteria 671
210 Ga0157374_10203657 3300013296 Bacteria 1938
211 Ga0157378_10187259 3300013297 Bacteria 1950
212 Ga0157378_10871820 3300013297 Bacteria 929
213 Ga0157378_11012731 3300013297 Bacteria 865
214 Ga0163162_10034826 3300013306 Bacteria 5013
215 Ga0157375_10079187 3300013308 Bacteria 3321
216 Ga0157375_10562167 3300013308 Bacteria 1302
217 Ga0157375_10727666 3300013308 Bacteria 1145
218 Ga0157375_11065364 3300013308 Bacteria 945
219 Ga0163163_10015022 3300014325 Bacteria 7139
220 Ga0163163_10026896 3300014325 Bacteria 5504
221 Ga0163163_10304040 3300014325 Bacteria 1647
222 Ga0157380_10019740 3300014326 Bacteria 5027
223 Ga0157380_10172512 3300014326 Bacteria 1891
224 Ga0157380_10818777 3300014326 Bacteria 950
225 Ga0157380_10926915 3300014326 Bacteria 899
226 Ga0157380_11291517 3300014326 Bacteria 777
227 Ga0157377_10148389 3300014745 Bacteria 1448
228 Ga0157377_10977668 3300014745 Bacteria 639
229 Ga0157379_10493008 3300014968 Bacteria 1135
230 Ga0157379_10572804 3300014968 Bacteria 1052
231 Ga0157376_10024415 3300014969 Bacteria 4746
232 Ga0157376_10210938 3300014969 Bacteria 1793
233 Ga0157376_10380747 3300014969 Bacteria 1359
234 Ga0157376_10449859 3300014969 Bacteria 1256
235 Ga0157376_10512615 3300014969 Bacteria 1181
236 Ga0157376_10724105 3300014969 Unclassified 1002
237 Ga0157376_12531763 3300014969 Bacteria 553
238 Ga0163161_10120294 3300017792 Bacteria 1972
239 Ga0163161_10365714 3300017792 Bacteria 1150
240 Ga0163161_10395108 3300017792 Bacteria 1108
241 Ga0213876_10352075 3300021384 Bacteria 783
242 Ga0207697_10165887 3300025315 Bacteria 965
243 Ga0207656_10170612 3300025321 Bacteria 1040
244 Ga0207653_10152822 3300025885 Bacteria 850
245 Ga0207682_10134691 3300025893 Bacteria 1105
246 Ga0207642_10041467 3300025899 Bacteria 2015
247 Ga0207680_10141798 3300025903 Bacteria 1594
248 Ga0207680_10879267 3300025903 Bacteria 642
249 Ga0207680_10914056 3300025903 Bacteria 629
250 Ga0207699_10531695 3300025906 Bacteria 851
251 Ga0207645_10500722 3300025907 Bacteria 822
252 Ga0207645_10744543 3300025907 Bacteria 666
253 Ga0207643_10028002 3300025908 Bacteria 3127
254 Ga0207684_10182608 3300025910 Bacteria 1809
255 Ga0207684_10698023 3300025910 Bacteria 862
256 Ga0207663_10533374 3300025916 Bacteria 916
257 Ga0207662_10284056 3300025918 Bacteria 1096
258 Ga0207662_10480811 3300025918 Bacteria 853
259 Ga0207646_10229108 3300025922 Bacteria 1679
260 Ga0207681_10044060 3300025923 Bacteria 2989
261 Ga0207681_10671529 3300025923 Bacteria 860
262 Ga0207650_10068303 3300025925 Bacteria 2668
263 Ga0207650_10501113 3300025925 Bacteria 1015
264 Ga0207659_10004234 3300025926 Bacteria 8675
265 Ga0207659_10016038 3300025926 Bacteria 4868
266 Ga0207659_10132361 3300025926 Bacteria 1926
267 Ga0207659_10203414 3300025926 Bacteria 1583
268 Ga0207659_10310035 3300025926 Bacteria 1299
269 Ga0207659_10840656 3300025926 Bacteria 789
270 Ga0207659_11174869 3300025926 Bacteria 660
271 Ga0207687_10025193 3300025927 Bacteria 3980
272 Ga0207644_10581565 3300025931 Bacteria 929
273 Ga0207644_11476739 3300025931 Bacteria 571
274 Ga0207706_10427794 3300025933 Bacteria 1147
275 Ga0207706_11111835 3300025933 Bacteria 660
276 Ga0207686_10060220 3300025934 Bacteria 2402
277 Ga0207709_11038093 3300025935 Bacteria 671
278 Ga0207670_10011827 3300025936 Bacteria 5079
279 Ga0207670_11933919 3300025936 Bacteria 502
280 Ga0207669_10032308 3300025937 Bacteria 2938
281 Ga0207669_10070327 3300025937 Bacteria 2194
282 Ga0207669_10568655 3300025937 Bacteria 917
283 Ga0207669_10795280 3300025937 Bacteria 784
284 Ga0207704_10025313 3300025938 Bacteria 3236
285 Ga0207704_10282723 3300025938 Unclassified 1262
286 Ga0207691_10024419 3300025940 Bacteria 5685
287 Ga0207691_10975957 3300025940 Unclassified 707
288 Ga0207691_11340403 3300025940 Unclassified 590
289 Ga0207711_10052329 3300025941 Bacteria 3499
290 Ga0207711_10700951 3300025941 Unclassified 944
291 Ga0207689_10260794 3300025942 Bacteria 1434
292 Ga0207689_10451189 3300025942 Bacteria 1075
293 Ga0207689_10693330 3300025942 Unclassified 859
294 Ga0207679_10056093 3300025945 Bacteria 2907
295 Ga0207679_10782319 3300025945 Bacteria 869
296 Ga0207651_10098079 3300025960 Bacteria 2166
297 Ga0207651_10214395 3300025960 Bacteria 1552
298 Ga0207658_10417821 3300025986 Bacteria 1182
299 Ga0207658_10899658 3300025986 Bacteria 806
300 Ga0207658_11238286 3300025986 Bacteria 682
301 Ga0207703_10020610 3300026035 Bacteria 5157
302 Ga0207703_10128136 3300026035 Bacteria 2188
303 Ga0207703_10285991 3300026035 Bacteria 1499
304 Ga0207678_10531611 3300026067 Bacteria 1027
305 Ga0207708_10423332 3300026075 Bacteria 1104
306 Ga0207708_10770840 3300026075 Bacteria 826
307 Ga0207708_11365426 3300026075 Bacteria 621
308 Ga0207641_10174664 3300026088 Bacteria 1964
309 Ga0207641_10235411 3300026088 Bacteria 1704
310 Ga0207648_10399154 3300026089 Bacteria 1246
311 Ga0207648_11065888 3300026089 Bacteria 758
312 Ga0207676_10044097 3300026095 Bacteria 3439
313 Ga0207676_10073020 3300026095 Bacteria 2760
314 Ga0207676_10179319 3300026095 Bacteria 1853
315 Ga0207676_10569913 3300026095 Bacteria 1084
316 Ga0207676_11324600 3300026095 Bacteria 715
317 Ga0207674_10692608 3300026116 Bacteria 984
318 Ga0207675_100095484 3300026118 Bacteria 2797
319 Ga0207675_100204190 3300026118 Bacteria 1899
320 Ga0207683_10150830 3300026121 Bacteria 2097
321 Ga0207683_10157588 3300026121 Bacteria 2051
322 Ga0207683_10358304 3300026121 Bacteria 1339
323 Ga0207683_10455558 3300026121 Bacteria 1180
324 Ga0207683_11205401 3300026121 Bacteria 702
325 Ga0209813_10214741 3300027866 Bacteria 718
326 Ga0207428_10000024 3300027907 Bacteria 265587
327 Ga0207428_10000546 3300027907 Bacteria 44847
328 Ga0207428_10567994 3300027907 Bacteria 819
329 Ga0268266_10040804 3300028379 Bacteria 3957
330 Ga0268265_10897121 3300028380 Bacteria 870
331 Ga0268265_11756550 3300028380 Bacteria 626
332 Ga0268265_11966727 3300028380 Bacteria 592
333 Ga0268264_10005742 3300028381 Bacteria 10520
334 Ga0307405_11747767 3300031731 Bacteria 552
335 Ga0307413_10243564 3300031824 Bacteria 1329
336 Ga0307413_10395407 3300031824 Bacteria 1081
337 Ga0307413_10592724 3300031824 Bacteria 906
338 Ga0307410_10132132 3300031852 Bacteria 1835
339 Ga0307410_10180598 3300031852 Bacteria 1597
340 Ga0307410_11149316 3300031852 Bacteria 675
341 Ga0307406_10052538 3300031901 Bacteria 2592
342 Ga0307407_10003340 3300031903 Bacteria 6560
343 Ga0307407_10104049 3300031903 Bacteria 1768
344 Ga0307407_10724118 3300031903 Bacteria 751
345 Ga0307409_100003829 3300031995 Bacteria 8304
346 Ga0307409_102093473 3300031995 Bacteria 595
347 Ga0307416_100075943 3300032002 Bacteria 2814
348 Ga0307416_100563547 3300032002 Bacteria 1214
349 Ga0307416_100635972 3300032002 Bacteria 1150
350 Ga0307414_10037957 3300032004 Bacteria 3230
351 Ga0307414_10522107 3300032004 Bacteria 1054
352 Ga0307411_10107813 3300032005 Bacteria 1986
353 Ga0307411_10383227 3300032005 Bacteria 1157
354 Ga0307411_11548888 3300032005 Bacteria 610
355 Ga0307415_100645347 3300032126 Bacteria 948
356 Ga0373934_0102015 3300035086 Bacteria 1160
357 Ga0373944_0204964 3300035089 Bacteria 715
358 Ga0373924_0255388 3300035410 Bacteria 776
359 Ga0373931_0952171 3300035691 Bacteria 579
360 Ga0373935_1519016 3300035692 Bacteria 501
361 Ga0373933_0505135 3300035724 Bacteria 792
362 Ga0373947_0798773 3300035725 Bacteria 644
363 Ga0373937_0004724 3300036401 Bacteria 11586
364 Ga0373925_0352416 3300037068 Bacteria 1195
365 Ga0373925_0545044 3300037068 Bacteria 954
366 Ga0395901_1294212 3300038443 Bacteria 691
367 Ga0436365_1545454 3300039437 Bacteria 851
368 Ga0436363_0728476 3300039450 Bacteria 657
369 Ga0439455_0075940 3300042012 Bacteria 908
370 Ga0450920_114358 3300042122 Unclassified 565
371 Ga0439435_0094506 3300042436 Unclassified 912
372 Ga0439460_0032036 3300042461 Unclassified 1503
373 Ga0466963_0158343 3300044694 Bacteria 1575
374 Ga0466957_0204972 3300044842 Bacteria 1297
375 Ga0451576_0287832 3300045051 Bacteria 1718
376 Ga0466967_2449068 3300045976 Bacteria 517
377 Ga0495603_0021985 3300046455 Bacteria 3862
378 Ga0495603_0236373 3300046455 Bacteria 1053
379 Ga0495629_0273895 3300046459 Bacteria 1159
380 Ga0495585_0268058 3300046492 Bacteria 847
381 Ga0495594_0481188 3300046499 Bacteria 705
382 Ga0495644_0448037 3300046523 Bacteria 514
383 Ga0495642_0355446 3300046528 Bacteria 644
384 Ga0495621_0016662 3300046539 Bacteria 2362
385 Ga0495621_0461392 3300046539 Bacteria 545
386 Ga0495656_0111153 3300046615 Bacteria 1282
387 Ga0495656_0432134 3300046615 Bacteria 692
388 Ga0495659_0032996 3300046664 Bacteria 1815
389 Ga0495659_0037433 3300046664 Bacteria 1719
390 Ga0495659_0056079 3300046664 Bacteria 1445
391 Ga0495659_0406466 3300046664 Unclassified 588
392 Ga0495669_0020573 3300046684 Bacteria 2857
393 Ga0495636_0076497 3300047318 Bacteria 1435
394 Ga0495685_237739 3300047447 Bacteria 579
395 Ga0496100_0507115 3300048903 Bacteria 930
396 Ga0496100_0871926 3300048903 Bacteria 706
397 Ga0496101_1237925 3300048904 Bacteria 584
398 Ga0496102_0050255 3300048905 Bacteria 3796
399 Ga0496102_1583276 3300048905 Bacteria 574
400 Ga0496104_0089530 3300048907 Bacteria 2940
401 Ga0496105_0157163 3300048908 Bacteria 1867
402 Ga0496106_0257020 3300048909 Bacteria 1397
403 Ga0496106_0676391 3300048909 Bacteria 824
404 Ga0496108_0309336 3300048911 Bacteria 1377
405 Ga0496109_1043172 3300048912 Bacteria 755
406 Ga0496112_0074513 3300048915 Bacteria 3356
407 Ga0496114_0673764 3300048917 Bacteria 908
408 Ga0496115_0278366 3300048918 Bacteria 1374
409 Ga0501299_153362 3300049522 Bacteria 583
410 Ga0501033_0010163 3300049570 Bacteria 7227
411 Ga0501036_0035917 3300049572 Bacteria 4193
412 Ga0501037_0342056 3300049573 Bacteria 1033
413 Ga0501038_0029317 3300049574 Bacteria 4878
414 Ga0501039_0019586 3300049575 Bacteria 5189
415 Ga0501040_0004827 3300049576 Bacteria 8736
416 Ga0501040_1399230 3300049576 Bacteria 508
417 Ga0501041_0018385 3300049577 Bacteria 4165
418 Ga0501042_0187134 3300049578 Bacteria 1493
419 Ga0501043_0213426 3300049579 Bacteria 1495
420 Ga0501046_0012776 3300049580 Bacteria 7143
421 Ga0501048_0009652 3300049582 Bacteria 7242
422 Ga0501068_0013580 3300049584 Bacteria 4637
423 Ga0501071_0006819 3300049587 Bacteria 7439
424 Ga0501072_0199690 3300049588 Unclassified 1594
425 Ga0501072_1328352 3300049588 Bacteria 557
426 Ga0501073_0569442 3300049589 Bacteria 782
427 Ga0501074_0431738 3300049590 Bacteria 934
428 Ga0501075_0000931 3300049591 Bacteria 18592
429 Ga0501076_0003961 3300049592 Bacteria 10455
430 Ga0501076_0283192 3300049592 Bacteria 1358
431 Ga0501077_0377546 3300049593 Bacteria 905
432 Ga0501077_0656748 3300049593 Bacteria 674
433 Ga0501201_036949 3300049651 Bacteria 575
434 Ga0501233_286413 3300049668 Bacteria 505
435 Ga0501235_068487 3300049669 Bacteria 838
436 Ga0501261_124650 3300049690 Bacteria 514
437 Ga0501225_0121316 3300049705 Bacteria 777
438 Ga0501079_0005502 3300049741 Bacteria 9440
439 Ga0501080_0160968 3300049742 Bacteria 2073
440 Ga0501081_0003141 3300049743 Bacteria 10498
441 Ga0501083_0019614 3300049744 Bacteria 4710
442 Ga0501268_141311 3300049765 Bacteria 549
443 Ga0501278_025956 3300049774 Bacteria 569
444 Ga0501283_094732 3300049779 Bacteria 575
445 nmdc:mga0k408_44733_c1 3300050493 Bacteria 2553
446 nmdc:mga06z11_560926_c1 3300050494 Bacteria 694
447 nmdc:mga04h51_16899_c1 3300050495 Bacteria 2124
448 nmdc:mga05p37_142261_c1 3300050507 Unclassified 2938
449 nmdc:mga05p37_238239_c1 3300050507 Bacteria 2189
450 nmdc:mga05p37_321407_c1 3300050507 Bacteria 1832
451 nmdc:mga05p37_936351_c1 3300050507 Bacteria 929
452 nmdc:mga09592_141309_c1 3300050508 Bacteria 2075
453 nmdc:mga0qj67_180179_c1 3300050509 Bacteria 1716
454 nmdc:mga06r32_778321_c1 3300050510 Bacteria 919
455 nmdc:mga08y16_1054395_c1 3300050511 Bacteria 790
456 nmdc:mga08y16_137778_c1 3300050511 Bacteria 2537
457 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
458 nmdc:mga08y16_9299_c1 3300050511 Bacteria 10309
459 nmdc:mga0n895_1823271_c1 3300050512 Bacteria 569
460 nmdc:mga0n895_239370_c1 3300050512 Bacteria 1842
461 nmdc:mga0n895_27522_c1 3300050512 Bacteria 5402
462 nmdc:mga0n895_3239_c1 3300050512 Bacteria 13051
463 nmdc:mga0rr50_223202_c1 3300050513 Bacteria 1557
464 nmdc:mga0rr50_293343_c1 3300050513 Bacteria 1359
465 nmdc:mga0rr50_468542_c1 3300050513 Bacteria 1069
466 nmdc:mga0rr50_713856_c1 3300050513 Bacteria 856
467 nmdc:mga08x19_105063_c1 3300050514 Bacteria 1877
468 nmdc:mga08x19_38271_c1 3300050514 Bacteria 3047
469 nmdc:mga0a205_1204834_c1 3300050515 Unclassified 605
470 nmdc:mga0a205_1352_c1 3300050515 Bacteria 20678
471 nmdc:mga0a205_47189_c1 3300050515 Bacteria 4155
472 nmdc:mga0a205_668954_c1 3300050515 Bacteria 889
473 nmdc:mga0a205_719216_c1 3300050515 Bacteria 848
474 nmdc:mga0a205_78115_c1 3300050515 Bacteria 3198
475 nmdc:mga0a205_97450_c1 3300050515 Bacteria 2840
476 Ga0501084_0010102 3300054114 Bacteria 7801
477 Ga0587085_069434 3300059506 Bacteria 685
478 Ga0587076_190299 3300059645 Bacteria 522
479 Ga0501082_0011507 3300060353 Bacteria 7616
480 Ga0530510_0001953 3300061734 Bacteria 14125
481 Ga0070697_101619579
482 SwRhRL3b_contig_4416910
483 JGI25406J46586_10000695
484 JGI25406J46586_10114238
485 Ga0058860_11851491
486 Ga0065704_10077360
487 Ga0065704_10128236
488 Ga0065712_10000303
489 Ga0065712_10167490
490 Ga0065712_10272681
491 Ga0065712_10375388
492 Ga0065715_10030402
493 Ga0065715_10072795
494 Ga0065715_10128895
495 Ga0065715_10279474
496 Ga0065715_10290835
497 Ga0065715_10368289
498 Ga0065707_10001592
499 Ga0065707_10008537
500 Ga0065707_10319442
501 Ga0065707_10438225
502 Ga0065707_10560170
503 Ga0070676_10769456
504 Ga0070676_10897776
505 Ga0070670_100352689
506 Ga0070670_100419779
507 Ga0070677_10025391
508 Ga0068869_100083010
509 Ga0070666_10093376
510 Ga0070666_11218360
511 Ga0068868_100139394
512 Ga0070689_100020864
513 Ga0070689_101244766
514 Ga0070687_100018053
515 Ga0070692_10235348
516 Ga0070669_100426553
517 Ga0070669_100516623
518 Ga0070669_100541351
519 Ga0070675_100001034
520 Ga0070675_100001083
521 Ga0070675_100002698
522 Ga0070675_100054811
523 Ga0070675_100267232
524 Ga0070675_100570478
525 Ga0070675_100961308
526 Ga0070675_101076397
527 Ga0070671_100661796
528 Ga0070671_100663666
529 Ga0070671_100715982
530 Ga0070674_100008295
531 Ga0070674_100546022
532 Ga0070674_100883399
533 Ga0070673_100183038
534 Ga0070673_100414849
535 Ga0070688_101305022
536 Ga0070659_101609742
537 Ga0070667_100690780
538 Ga0070701_10013847
539 Ga0070701_10488924
540 Ga0070701_10667209
541 Ga0070711_100842264
542 Ga0070705_100019441
543 Ga0070705_100023408
544 Ga0070700_100077811
545 Ga0070700_100617452
546 Ga0070700_100667406
547 Ga0070694_100171399
548 Ga0070694_101150057
549 Ga0070694_101204939
550 Ga0070708_100026807
551 Ga0070708_100377430
552 Ga0070663_101179181
553 Ga0070678_100145860
554 Ga0070678_100593245
555 Ga0070662_100061090
556 Ga0070662_101529262
557 Ga0070685_10050628
558 Ga0070706_100214459
559 Ga0070707_100031473
560 Ga0070707_100509730
561 Ga0070707_100752297
562 Ga0070698_100015642
563 Ga0070698_100909462
564 Ga0070698_101633672
565 Ga0070699_100022310
566 Ga0070699_100052975
567 Ga0070699_101959272
568 Ga0070684_100922242
569 Ga0070697_100430721
570 Ga0070697_100915890
571 Ga0070672_100357289
572 Ga0070686_100671330
573 Ga0070695_100018884
574 Ga0070696_100015114
575 Ga0070696_100069959
576 Ga0070696_100364272
577 Ga0070665_100022116
578 Ga0070704_100002091
579 Ga0070704_100007889
580 Ga0070704_100680321
581 Ga0070664_100218518
582 Ga0070664_100925749
583 Ga0068857_101326677
584 Ga0070702_100390218
585 Ga0068859_100002272
586 Ga0068859_100029714
587 Ga0068859_101153196
588 Ga0068859_101953843
589 Ga0068864_100159187
590 Ga0068864_100212318
591 Ga0068864_100269270
592 Ga0068864_101669426
593 Ga0068866_10048521
594 Ga0068866_10435982
595 Ga0068861_100166823
596 Ga0068861_100311581
597 Ga0068861_101265538
598 Ga0068861_102300197
599 Ga0068851_10904379
600 Ga0068851_11043930
601 Ga0068870_10036889
602 Ga0068870_10393814
603 Ga0068863_100385613
604 Ga0068863_100615527
605 Ga0068863_100683960
606 Ga0068858_100012518
607 Ga0068858_100130711
608 Ga0068858_100311342
609 Ga0068858_101114982
610 Ga0068862_100025908
611 Ga0068862_100176748
612 Ga0068862_101123963
613 Ga0068862_101550588
614 Ga0081539_10000280
615 Ga0081539_10004746
616 Ga0075368_10005955
617 Ga0070715_10408047
618 Ga0070716_100381138
619 Ga0075367_10607409
620 Ga0075367_10736159
621 Ga0075366_10188414
622 Ga0097621_100080451
623 Ga0068871_100419727
624 Ga0068871_100522589
625 Ga0068871_100658069
626 Ga0068871_101131509
627 Ga0075428_100000004
628 Ga0075428_100065546
629 Ga0075428_101244071
630 Ga0075430_100139185
631 Ga0075430_100489444
632 Ga0075431_100725510
633 Ga0075433_10001391
634 Ga0075433_10042679
635 Ga0075433_10115380
636 Ga0075433_10425646
637 Ga0075433_10726808
638 Ga0075433_10796490
639 Ga0075433_10931427
640 Ga0075434_100000556
641 Ga0075434_100002301
642 Ga0075434_100088391
643 Ga0075434_100141343
644 Ga0075434_101080209
645 Ga0075429_100081152
646 Ga0075429_100124243
647 Ga0068865_100380055
648 Ga0068865_100442737
649 Ga0068865_101027762
650 Ga0075436_100016489
651 Ga0075436_100692379
652 Ga0097620_100002272
653 Ga0097620_100029712
654 Ga0097620_101153240
655 Ga0097620_101953793
656 Ga0075435_100003391
657 Ga0075435_100091896
658 Ga0075435_100283725
659 Ga0075435_100487654
660 Ga0111539_10000005
661 Ga0111539_10027821
662 Ga0111539_10092178
663 Ga0111539_10120227
664 Ga0111539_11345654
665 Ga0105245_10107999
666 Ga0105245_10805787
667 Ga0114129_10040808
668 Ga0114129_10091941
669 Ga0114129_10107312
670 Ga0114129_10179776
671 Ga0114129_10187411
672 Ga0114129_10208699
673 Ga0114129_10257051
674 Ga0114129_10758580
675 Ga0114129_11235763
676 Ga0114129_11919699
677 Ga0105243_10149466
678 Ga0105243_10159374
679 Ga0105241_12499997
680 Ga0105242_10023786
681 Ga0105248_10151440
682 Ga0105248_10880435
683 Ga0105248_10892735
684 Ga0105238_11083182
685 Ga0105249_10136795
686 Ga0105249_10474293
687 Ga0105249_11024165
688 Ga0105249_11205063
689 Ga0157324_1020109
690 Ga0157374_10203657
691 Ga0157378_10187259
692 Ga0157378_10871820
693 Ga0157378_11012731
694 Ga0163162_10034826
695 Ga0157375_10079187
696 Ga0157375_10562167
697 Ga0157375_10727666
698 Ga0157375_11065364
699 Ga0163163_10015022
700 Ga0163163_10026896
701 Ga0163163_10304040
702 Ga0157380_10019740
703 Ga0157380_10172512
704 Ga0157380_10818777
705 Ga0157380_10926915
706 Ga0157380_11291517
707 Ga0157377_10148389
708 Ga0157377_10977668
709 Ga0157379_10493008
710 Ga0157379_10572804
711 Ga0157376_10024415
712 Ga0157376_10210938
713 Ga0157376_10380747
714 Ga0157376_10449859
715 Ga0157376_10512615
716 Ga0157376_10724105
717 Ga0157376_12531763
718 Ga0163161_10120294
719 Ga0163161_10365714
720 Ga0163161_10395108
721 Ga0213876_10352075
722 Ga0207697_10165887
723 Ga0207656_10170612
724 Ga0207653_10152822
725 Ga0207682_10134691
726 Ga0207642_10041467
727 Ga0207680_10141798
728 Ga0207680_10879267
729 Ga0207680_10914056
730 Ga0207699_10531695
731 Ga0207645_10500722
732 Ga0207645_10744543
733 Ga0207643_10028002
734 Ga0207684_10182608
735 Ga0207684_10698023
736 Ga0207663_10533374
737 Ga0207662_10284056
738 Ga0207662_10480811
739 Ga0207646_10229108
740 Ga0207681_10044060
741 Ga0207681_10671529
742 Ga0207650_10068303
743 Ga0207650_10501113
744 Ga0207659_10004234
745 Ga0207659_10016038
746 Ga0207659_10132361
747 Ga0207659_10203414
748 Ga0207659_10310035
749 Ga0207659_10840656
750 Ga0207659_11174869
751 Ga0207687_10025193
752 Ga0207644_10581565
753 Ga0207644_11476739
754 Ga0207706_10427794
755 Ga0207706_11111835
756 Ga0207686_10060220
757 Ga0207709_11038093
758 Ga0207670_10011827
759 Ga0207670_11933919
760 Ga0207669_10032308
761 Ga0207669_10070327
762 Ga0207669_10568655
763 Ga0207669_10795280
764 Ga0207704_10025313
765 Ga0207704_10282723
766 Ga0207691_10024419
767 Ga0207691_10975957
768 Ga0207691_11340403
769 Ga0207711_10052329
770 Ga0207711_10700951
771 Ga0207689_10260794
772 Ga0207689_10451189
773 Ga0207689_10693330
774 Ga0207679_10056093
775 Ga0207679_10782319
776 Ga0207651_10098079
777 Ga0207651_10214395
778 Ga0207658_10417821
779 Ga0207658_10899658
780 Ga0207658_11238286
781 Ga0207703_10020610
782 Ga0207703_10128136
783 Ga0207703_10285991
784 Ga0207678_10531611
785 Ga0207708_10423332
786 Ga0207708_10770840
787 Ga0207708_11365426
788 Ga0207641_10174664
789 Ga0207641_10235411
790 Ga0207648_10399154
791 Ga0207648_11065888
792 Ga0207676_10044097
793 Ga0207676_10073020
794 Ga0207676_10179319
795 Ga0207676_10569913
796 Ga0207676_11324600
797 Ga0207674_10692608
798 Ga0207675_100095484
799 Ga0207675_100204190
800 Ga0207683_10150830
801 Ga0207683_10157588
802 Ga0207683_10358304
803 Ga0207683_10455558
804 Ga0207683_11205401
805 Ga0209813_10214741
806 Ga0207428_10000024
807 Ga0207428_10000546
808 Ga0207428_10567994
809 Ga0268266_10040804
810 Ga0268265_10897121
811 Ga0268265_11756550
812 Ga0268265_11966727
813 Ga0268264_10005742
814 Ga0307405_11747767
815 Ga0307413_10243564
816 Ga0307413_10395407
817 Ga0307413_10592724
818 Ga0307410_10132132
819 Ga0307410_10180598
820 Ga0307410_11149316
821 Ga0307406_10052538
822 Ga0307407_10003340
823 Ga0307407_10104049
824 Ga0307407_10724118
825 Ga0307409_100003829
826 Ga0307409_102093473
827 Ga0307416_100075943
828 Ga0307416_100563547
829 Ga0307416_100635972
830 Ga0307414_10037957
831 Ga0307414_10522107
832 Ga0307411_10107813
833 Ga0307411_10383227
834 Ga0307411_11548888
835 Ga0307415_100645347
836 Ga0373934_0102015
837 Ga0373944_0204964
838 Ga0373924_0255388
839 Ga0373931_0952171
840 Ga0373935_1519016
841 Ga0373933_0505135
842 Ga0373947_0798773
843 Ga0373937_0004724
844 Ga0373925_0352416
845 Ga0373925_0545044
846 Ga0395901_1294212
847 Ga0436365_1545454
848 Ga0436363_0728476
849 Ga0439455_0075940
850 Ga0450920_114358
851 Ga0439435_0094506
852 Ga0439460_0032036
853 Ga0466963_0158343
854 Ga0466957_0204972
855 Ga0451576_0287832
856 Ga0466967_2449068
857 Ga0495603_0021985
858 Ga0495603_0236373
859 Ga0495629_0273895
860 Ga0495585_0268058
861 Ga0495594_0481188
862 Ga0495644_0448037
863 Ga0495642_0355446
864 Ga0495621_0016662
865 Ga0495621_0461392
866 Ga0495656_0111153
867 Ga0495656_0432134
868 Ga0495659_0032996
869 Ga0495659_0037433
870 Ga0495659_0056079
871 Ga0495659_0406466
872 Ga0495669_0020573
873 Ga0495636_0076497
874 Ga0495685_237739
875 Ga0496100_0507115
876 Ga0496100_0871926
877 Ga0496101_1237925
878 Ga0496102_0050255
879 Ga0496102_1583276
880 Ga0496104_0089530
881 Ga0496105_0157163
882 Ga0496106_0257020
883 Ga0496106_0676391
884 Ga0496108_0309336
885 Ga0496109_1043172
886 Ga0496112_0074513
887 Ga0496114_0673764
888 Ga0496115_0278366
889 Ga0501299_153362
890 Ga0501033_0010163
891 Ga0501036_0035917
892 Ga0501037_0342056
893 Ga0501038_0029317
894 Ga0501039_0019586
895 Ga0501040_0004827
896 Ga0501040_1399230
897 Ga0501041_0018385
898 Ga0501042_0187134
899 Ga0501043_0213426
900 Ga0501046_0012776
901 Ga0501048_0009652
902 Ga0501068_0013580
903 Ga0501071_0006819
904 Ga0501072_0199690
905 Ga0501072_1328352
906 Ga0501073_0569442
907 Ga0501074_0431738
908 Ga0501075_0000931
909 Ga0501076_0003961
910 Ga0501076_0283192
911 Ga0501077_0377546
912 Ga0501077_0656748
913 Ga0501201_036949
914 Ga0501233_286413
915 Ga0501235_068487
916 Ga0501261_124650
917 Ga0501225_0121316
918 Ga0501079_0005502
919 Ga0501080_0160968
920 Ga0501081_0003141
921 Ga0501083_0019614
922 Ga0501268_141311
923 Ga0501278_025956
924 Ga0501283_094732
925 nmdc:mga0k408_44733_c1
926 nmdc:mga06z11_560926_c1
927 nmdc:mga04h51_16899_c1
928 nmdc:mga05p37_142261_c1
929 nmdc:mga05p37_238239_c1
930 nmdc:mga05p37_321407_c1
931 nmdc:mga05p37_936351_c1
932 nmdc:mga09592_141309_c1
933 nmdc:mga0qj67_180179_c1
934 nmdc:mga06r32_778321_c1
935 nmdc:mga08y16_1054395_c1
936 nmdc:mga08y16_137778_c1
937 nmdc:mga08y16_6_c1
938 nmdc:mga08y16_9299_c1
939 nmdc:mga0n895_1823271_c1
940 nmdc:mga0n895_239370_c1
941 nmdc:mga0n895_27522_c1
942 nmdc:mga0n895_3239_c1
943 nmdc:mga0rr50_223202_c1
944 nmdc:mga0rr50_293343_c1
945 nmdc:mga0rr50_468542_c1
946 nmdc:mga0rr50_713856_c1
947 nmdc:mga08x19_105063_c1
948 nmdc:mga08x19_38271_c1
949 nmdc:mga0a205_1204834_c1
950 nmdc:mga0a205_1352_c1
951 nmdc:mga0a205_47189_c1
952 nmdc:mga0a205_668954_c1
953 nmdc:mga0a205_719216_c1
954 nmdc:mga0a205_78115_c1
955 nmdc:mga0a205_97450_c1
956 Ga0501084_0010102
957 Ga0587085_069434
958 Ga0587076_190299
959 Ga0501082_0011507
960 Ga0530510_0001953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k3h-assembly1.cif.gz_B crystal structure of deep network hallucinated protein 0217 0.6108 55 93
1xja-assembly1.cif.gz_B apo form of the y31v mutant dimerization domain fragment of escherichia coli regulatory protein arac 0.5625 39 93
3rpm-assembly1.cif.gz_A crystal structure of the first gh20 domain of a novel beta-n-acetyl-hexosaminidase strh from streptococcus pneumoniae r6 0.5377 53 93
4d8o-assembly1.cif.gz_A crystal structure of the ankyrin-b zu5-zu5-upa-dd tandem 0.5001 56 88
4fes-assembly1.cif.gz_A structure of osh4 in complex with cholesterol analogs 0.3465 36 99
ID Description Score Start End Superfamily
af_Q7JZW7_1_97_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.7307 54 94 1.20.5.110
af_Q9ZT78_472_582_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.676 54 94 1.20.58.390
af_Q9M109_490_601_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6402 54 94 1.20.58.390
3vrcA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.6289 55 91 1.20.120.10
af_I1KCI3_424_622_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6175 52 94 1.10.510.10

Map