F452182

General Info

Members Datasets Scaffolds Average Seq Length
480 230 960 402

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100037486|Ga0070706_1000374863
Length 433
Sequence MADKVILAYSGGLDTSVAIRWLKDTYGLDAVTLTVDVGNERDIPAVAERALRIGAVKALTVDARRDFLEYFVWPALQAGALYEGAYPLATAIARPLIAKLLVDTARQEGAVAVAHGCTGKGNDQVRFDVSIMALAPDLKIIAPVREWSMTRDAEIEYAQQHGIPVAATAASPYSVDANLWGRSVECGILEDPWAEPPADVWEWTADPATAPAEAAEITITFEQGVPVALDGEPRDPVTLVQQLNALAGAHGVGRIDHVENRLVGIKSREVYEAPAAMTLLTAHKALESLALSREQLRVKDAIAGEYARLIYNGLWYSALHADLMAFVRSSQRFVSGEVRLKLSRGVCSVVGRRSPHSLYQHALATYERGDAFNHQSAVGFIELWGLPVKTQAQVQLLTGHSEVGALPGIAAHAEPRAISPAAAAEDTLAAPVG

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
155 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
182 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
183 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
184 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
185 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
186 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
187 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
188 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
189 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
190 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
191 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
192 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
193 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
194 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
195 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
196 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
197 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
198 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
199 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
200 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
201 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
207 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
208 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
209 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
224 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
229 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
230 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.62
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 9.17
Rhizosphere 89.17
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100037486 3300005467 Bacteria 4477
2 JGI25406J46586_10001239 3300003203 Bacteria 11995
3 Ga0070683_100003596 3300005329 Bacteria 12625
4 Ga0070683_100038823 3300005329 Bacteria 4366
5 Ga0070683_100135013 3300005329 Bacteria 2336
6 Ga0070670_100002408 3300005331 Bacteria 15427
7 Ga0070670_100008658 3300005331 Bacteria 8685
8 Ga0070680_100029481 3300005336 Bacteria 4408
9 Ga0070691_10007905 3300005341 Bacteria 4864
10 Ga0070669_100101093 3300005353 Bacteria 2175
11 Ga0070671_100011005 3300005355 Bacteria 7259
12 Ga0070671_100033217 3300005355 Bacteria 4265
13 Ga0070674_100002960 3300005356 Bacteria 9424
14 Ga0070674_100003462 3300005356 Bacteria 8861
15 Ga0070673_100099476 3300005364 Bacteria 2392
16 Ga0070688_100000600 3300005365 Bacteria 18074
17 Ga0070714_100000004 3300005435 Bacteria 310983
18 Ga0070714_100000130 3300005435 Bacteria 59277
19 Ga0070714_100017884 3300005435 Bacteria 5748
20 Ga0070701_10022864 3300005438 Bacteria 3002
21 Ga0070708_100000904 3300005445 Bacteria 22488
22 Ga0070708_100230511 3300005445 Bacteria 1738
23 Ga0070678_100059761 3300005456 Bacteria 2803
24 Ga0070681_10028607 3300005458 Bacteria 5604
25 Ga0068867_100044718 3300005459 Bacteria 3245
26 Ga0070685_10050706 3300005466 Bacteria 2398
27 Ga0070706_100000675 3300005467 Bacteria 38685
28 Ga0070706_100010187 3300005467 Bacteria 8742
29 Ga0070706_100017050 3300005467 Bacteria 6709
30 Ga0070706_100146143 3300005467 Bacteria 2208
31 Ga0070707_100001465 3300005468 Bacteria 23118
32 Ga0070707_100001665 3300005468 Bacteria 21503
33 Ga0070707_100006647 3300005468 Bacteria 10717
34 Ga0070707_100011378 3300005468 Bacteria 8297
35 Ga0070707_100046523 3300005468 Bacteria 4152
36 Ga0070707_100065147 3300005468 Bacteria 3500
37 Ga0070707_100284230 3300005468 Bacteria 1607
38 Ga0070698_100034018 3300005471 Bacteria 5280
39 Ga0070698_100036531 3300005471 Bacteria 5074
40 Ga0070698_100051580 3300005471 Bacteria 4190
41 Ga0070699_100023675 3300005518 Bacteria 5291
42 Ga0070699_100030155 3300005518 Bacteria 4680
43 Ga0070699_100050482 3300005518 Bacteria 3601
44 Ga0070679_100004098 3300005530 Bacteria 13439
45 Ga0070679_100006462 3300005530 Bacteria 10922
46 Ga0070684_100000397 3300005535 Bacteria 29767
47 Ga0070684_100026149 3300005535 Bacteria 4914
48 Ga0070697_100021440 3300005536 Bacteria 5118
49 Ga0070672_100129051 3300005543 Bacteria 2076
50 Ga0070686_100002402 3300005544 Bacteria 10321
51 Ga0070693_100001277 3300005547 Bacteria 11387
52 Ga0070665_100084640 3300005548 Bacteria 3176
53 Ga0068857_100009562 3300005577 Bacteria 8420
54 Ga0068857_100029452 3300005577 Bacteria 4845
55 Ga0068856_100195472 3300005614 Bacteria 2037
56 Ga0070702_100016457 3300005615 Bacteria 3794
57 Ga0068864_100002246 3300005618 Bacteria 15972
58 Ga0068870_10007215 3300005840 Bacteria 4949
59 Ga0068858_100063012 3300005842 Bacteria 3430
60 Ga0081455_10012984 3300005937 Bacteria 8260
61 Ga0081455_10014102 3300005937 Bacteria 7854
62 Ga0081455_10035424 3300005937 Bacteria 4460
63 Ga0081455_10037042 3300005937 Bacteria 4335
64 Ga0081455_10044002 3300005937 Bacteria 3900
65 Ga0081455_10085586 3300005937 Bacteria 2570
66 Ga0081538_10000714 3300005981 Archaea 36260
67 Ga0081538_10002907 3300005981 Archaea 16330
68 Ga0081539_10002043 3300005985 Bacteria 30343
69 Ga0081539_10003715 3300005985 Bacteria 18186
70 Ga0070717_10000517 3300006028 Bacteria 24509
71 Ga0070717_10009521 3300006028 Bacteria 7307
72 Ga0070717_10073186 3300006028 Unclassified 2863
73 Ga0070712_100092015 3300006175 Bacteria 2223
74 Ga0097621_100324591 3300006237 Bacteria 1364
75 Ga0097621_100337832 3300006237 Bacteria 1337
76 Ga0075428_100041170 3300006844 Archaea 5082
77 Ga0075430_100081054 3300006846 Bacteria 2719
78 Ga0075430_100136113 3300006846 Bacteria 2047
79 Ga0075431_100019260 3300006847 Bacteria 6956
80 Ga0075431_100061478 3300006847 Bacteria 3876
81 Ga0075431_100211326 3300006847 Bacteria 1982
82 Ga0075433_10018571 3300006852 Bacteria 5783
83 Ga0075434_100203479 3300006871 Bacteria 2000
84 Ga0075434_100350868 3300006871 Bacteria 1496
85 Ga0075429_100088087 3300006880 Bacteria 2706
86 Ga0075436_100228018 3300006914 Unclassified 1323
87 Ga0105244_10009648 3300009036 Bacteria 5913
88 Ga0111539_10018539 3300009094 Archaea 8620
89 Ga0111539_10107386 3300009094 Bacteria 3275
90 Ga0114129_10000130 3300009147 Bacteria 77049
91 Ga0114129_10008101 3300009147 Bacteria 14976
92 Ga0114129_10018857 3300009147 Bacteria 9827
93 Ga0114129_10043745 3300009147 Bacteria 6301
94 Ga0114129_10044326 3300009147 Bacteria 6258
95 Ga0114129_10066403 3300009147 Bacteria 5032
96 Ga0114129_10079109 3300009147 Bacteria 4571
97 Ga0105243_10067739 3300009148 Bacteria 2875
98 Ga0105243_10121028 3300009148 Bacteria 2206
99 Ga0105242_10021988 3300009176 Bacteria 5013
100 Ga0105242_10051096 3300009176 Bacteria 3368
101 Ga0105248_10114308 3300009177 Bacteria 3044
102 Ga0105248_10136355 3300009177 Bacteria 2768
103 Ga0105248_10213264 3300009177 Bacteria 2175
104 Ga0105248_10228116 3300009177 Bacteria 2096
105 Ga0105246_10006792 3300011119 Bacteria 6994
106 Ga0105246_10059086 3300011119 Bacteria 2659
107 Ga0157378_10157532 3300013297 Bacteria 2121
108 Ga0157372_10521745 3300013307 Bacteria 1385
109 Ga0163163_10007851 3300014325 Bacteria 9436
110 Ga0163163_10081144 3300014325 Bacteria 3245
111 Ga0163163_10094209 3300014325 Bacteria 3012
112 Ga0157380_10088059 3300014326 Bacteria 2554
113 Ga0157377_10015307 3300014745 Bacteria 3920
114 Ga0206349_1142350 3300020075 Bacteria 1888
115 Ga0206352_11340933 3300020078 Bacteria 4637
116 Ga0206350_10334438 3300020080 Bacteria 3118
117 Ga0213874_10000032 3300021377 Bacteria 18369
118 Ga0213874_10003218 3300021377 Bacteria 3601
119 Ga0207697_10000602 3300025315 Bacteria 20487
120 Ga0207688_10005091 3300025901 Bacteria 7144
121 Ga0207688_10008699 3300025901 Bacteria 5525
122 Ga0207645_10022179 3300025907 Bacteria 4133
123 Ga0207643_10011635 3300025908 Bacteria 4751
124 Ga0207643_10053751 3300025908 Bacteria 2288
125 Ga0207643_10072095 3300025908 Bacteria 1989
126 Ga0207684_10000934 3300025910 Bacteria 33017
127 Ga0207684_10001986 3300025910 Bacteria 21086
128 Ga0207684_10010310 3300025910 Bacteria 8228
129 Ga0207684_10010711 3300025910 Bacteria 8054
130 Ga0207684_10146873 3300025910 Archaea 2029
131 Ga0207707_10039053 3300025912 Bacteria 4149
132 Ga0207693_10006344 3300025915 Bacteria 9802
133 Ga0207652_10007252 3300025921 Bacteria 8932
134 Ga0207652_10016507 3300025921 Bacteria 6030
135 Ga0207646_10012253 3300025922 Bacteria 8248
136 Ga0207646_10017230 3300025922 Bacteria 6767
137 Ga0207646_10027438 3300025922 Bacteria 5193
138 Ga0207646_10039425 3300025922 Bacteria 4252
139 Ga0207646_10043623 3300025922 Bacteria 4027
140 Ga0207646_10128032 3300025922 Bacteria 2284
141 Ga0207646_10315834 3300025922 Bacteria 1412
142 Ga0207681_10081507 3300025923 Bacteria 2285
143 Ga0207650_10079839 3300025925 Bacteria 2479
144 Ga0207659_10108119 3300025926 Bacteria 2109
145 Ga0207687_10006013 3300025927 Bacteria 8030
146 Ga0207687_10264169 3300025927 Bacteria 1373
147 Ga0207664_10000053 3300025929 Bacteria 128647
148 Ga0207664_10000073 3300025929 Bacteria 103261
149 Ga0207664_10011495 3300025929 Bacteria 6297
150 Ga0207686_10017636 3300025934 Bacteria 4026
151 Ga0207686_10048441 3300025934 Bacteria 2632
152 Ga0207709_10058213 3300025935 Bacteria 2400
153 Ga0207670_10032673 3300025936 Bacteria 3348
154 Ga0207669_10005662 3300025937 Bacteria 5634
155 Ga0207669_10010165 3300025937 Bacteria 4519
156 Ga0207669_10025775 3300025937 Bacteria 3185
157 Ga0207691_10095929 3300025940 Bacteria 2652
158 Ga0207661_10002797 3300025944 Bacteria 12036
159 Ga0207703_10251362 3300026035 Bacteria 1593
160 Ga0207708_10007504 3300026075 Bacteria 8061
161 Ga0207708_10278742 3300026075 Bacteria 1354
162 Ga0207702_10022732 3300026078 Bacteria 5201
163 Ga0207702_10026687 3300026078 Bacteria 4795
164 Ga0207648_10093736 3300026089 Bacteria 2626
165 Ga0207648_10127152 3300026089 Bacteria 2242
166 Ga0207674_10013317 3300026116 Bacteria 9135
167 Ga0207683_10034833 3300026121 Bacteria 4378
168 Ga0207428_10081384 3300027907 Bacteria 2528
169 Ga0268266_10042900 3300028379 Bacteria 3865
170 Ga0265326_10013117 3300028558 Bacteria 2427
171 Ga0265319_1000216 3300028563 Bacteria 43216
172 Ga0265318_10012966 3300028577 Bacteria 3533
173 Ga0265338_10005869 3300028800 Bacteria 15835
174 Ga0265320_10021534 3300031240 Bacteria 3464
175 Ga0265327_10063397 3300031251 Bacteria 1877
176 Ga0307408_100159316 3300031548 Archaea 1791
177 Ga0316576_10053274 3300031727 Bacteria 2948
178 Ga0307405_10144348 3300031731 Bacteria 1665
179 Ga0307413_10010162 3300031824 Archaea 4548
180 Ga0307413_10135979 3300031824 Bacteria 1690
181 Ga0307416_100117757 3300032002 Bacteria 2359
182 Ga0307416_100178793 3300032002 Bacteria 1986
183 Ga0307415_100085696 3300032126 Bacteria 2264
184 Ga0373927_0000006 3300035695 Bacteria 208965
185 Ga0373933_0211036 3300035724 Archaea 1244
186 Ga0316582_0098027 3300036647 Bacteria 1938
187 Ga0373925_0092161 3300037068 Bacteria 2318
188 Ga0395899_0057813 3300037312 Bacteria 2862
189 Ga0395900_0003378 3300037418 Bacteria 17240
190 Ga0395900_0024023 3300037418 Bacteria 6237
191 Ga0395900_0056091 3300037418 Bacteria 4056
192 Ga0395900_0061715 3300037418 Bacteria 3853
193 Ga0395900_0128218 3300037418 Bacteria 2601
194 Ga0395900_0180562 3300037418 Bacteria 2145
195 Ga0395898_0001557 3300037466 Bacteria 31453
196 Ga0395898_0057282 3300037466 Bacteria 3798
197 Ga0395898_0127157 3300037466 Bacteria 2441
198 Ga0395898_0197520 3300037466 Bacteria 1921
199 Ga0395905_0007091 3300037471 Bacteria 11203
200 Ga0395905_0033775 3300037471 Bacteria 4805
201 Ga0395905_0116984 3300037471 Bacteria 2505
202 Ga0395905_0200224 3300037471 Bacteria 1872
203 Ga0395901_0018271 3300038443 Bacteria 7159
204 Ga0395901_0023991 3300038443 Bacteria 6257
205 Ga0395901_0041713 3300038443 Bacteria 4757
206 Ga0395901_0115895 3300038443 Bacteria 2814
207 Ga0395901_0179775 3300038443 Bacteria 2219
208 Ga0395901_0301763 3300038443 Bacteria 1660
209 Ga0395901_0335241 3300038443 Bacteria 1563
210 Ga0436365_1101358 3300039437 Bacteria 1873
211 Ga0436363_0022126 3300039450 Bacteria 5767
212 Ga0436363_1502260 3300039450 Bacteria 5142
213 Ga0436363_1710173 3300039450 Bacteria 13098
214 Ga0436362_1305943 3300039453 Bacteria 2021
215 Ga0439438_019009 3300041405 Bacteria 1948
216 Ga0451577_0000124 3300042876 Bacteria 169120
217 Ga0451577_0001018 3300042876 Bacteria 40726
218 Ga0451577_0015746 3300042876 Bacteria 7020
219 Ga0466969_0000329 3300044656 Bacteria 26167
220 Ga0466972_0001744 3300044658 Bacteria 10672
221 Ga0466965_0037609 3300044683 Bacteria 2377
222 Ga0466966_0000507 3300044684 Bacteria 24873
223 Ga0466964_0000853 3300044706 Bacteria 9993
224 Ga0453684_0000239 3300044712 Bacteria 235992
225 Ga0453684_0000493 3300044712 Bacteria 155450
226 Ga0453684_0000498 3300044712 Bacteria 153608
227 Ga0453684_0001241 3300044712 Bacteria 77645
228 Ga0466970_0036350 3300044765 Bacteria 2609
229 Ga0466970_0105120 3300044765 Bacteria 1539
230 Ga0466957_0037852 3300044842 Bacteria 2905
231 Ga0466959_0022683 3300045049 Bacteria 4642
232 Ga0466959_0068470 3300045049 Bacteria 2572
233 Ga0466958_0004792 3300045836 Bacteria 7198
234 Ga0466967_0001086 3300045976 Bacteria 15050
235 Ga0466967_0148321 3300045976 Bacteria 2190
236 Ga0495603_0008457 3300046455 Bacteria 6215
237 Ga0495603_0095063 3300046455 Bacteria 1741
238 Ga0495629_0029560 3300046459 Bacteria 3884
239 Ga0495594_0049766 3300046499 Archaea 2304
240 Ga0495640_0067577 3300046533 Unclassified 2407
241 Ga0495634_0146267 3300046642 Unclassified 1497
242 Ga0495647_0057647 3300046681 Archaea 1525
243 Ga0495613_0037369 3300046689 Bacteria 3600
244 Ga0495674_0146617 3300047319 Bacteria 1981
245 Ga0495680_0091470 3300047322 Bacteria 2281
246 Ga0495602_0080871 3300048088 Bacteria 2735
247 Ga0496100_0034925 3300048903 Bacteria 3159
248 Ga0496100_0069853 3300048903 Bacteria 2340
249 Ga0496101_0000746 3300048904 Bacteria 19310
250 Ga0496102_0006950 3300048905 Bacteria 9656
251 Ga0496102_0010688 3300048905 Bacteria 7908
252 Ga0496104_0000642 3300048907 Bacteria 29919
253 Ga0496104_0001484 3300048907 Bacteria 20243
254 Ga0496105_0000090 3300048908 Bacteria 63276
255 Ga0496105_0037085 3300048908 Bacteria 4016
256 Ga0496105_0184121 3300048908 Bacteria 1709
257 Ga0496106_0012110 3300048909 Bacteria 6366
258 Ga0496106_0018276 3300048909 Bacteria 5182
259 Ga0496106_0237437 3300048909 Unclassified 1456
260 Ga0496107_0033277 3300048910 Bacteria 3688
261 Ga0496107_0088616 3300048910 Unclassified 2259
262 Ga0496107_0104215 3300048910 Bacteria 2081
263 Ga0496108_0002107 3300048911 Bacteria 15931
264 Ga0496108_0003192 3300048911 Bacteria 13193
265 Ga0496109_0001000 3300048912 Bacteria 23351
266 Ga0496109_0050144 3300048912 Bacteria 3802
267 Ga0496109_0226334 3300048912 Bacteria 1759
268 Ga0496110_0000203 3300048913 Bacteria 37868
269 Ga0496110_0000524 3300048913 Bacteria 26088
270 Ga0496110_0011517 3300048913 Bacteria 7243
271 Ga0496110_0012750 3300048913 Bacteria 6922
272 Ga0496110_0022235 3300048913 Bacteria 5382
273 Ga0496110_0047783 3300048913 Bacteria 3749
274 Ga0496110_0057713 3300048913 Bacteria 3418
275 Ga0496110_0067691 3300048913 Bacteria 3160
276 Ga0496111_0000689 3300048914 Bacteria 17819
277 Ga0496111_0002105 3300048914 Bacteria 11875
278 Ga0496111_0026306 3300048914 Bacteria 4108
279 Ga0496111_0053008 3300048914 Bacteria 2930
280 Ga0496112_0011989 3300048915 Bacteria 7948
281 Ga0496112_0044375 3300048915 Bacteria 4355
282 Ga0496112_0209320 3300048915 Bacteria 1908
283 Ga0496113_0003437 3300048916 Bacteria 9480
284 Ga0496113_0154440 3300048916 Bacteria 1812
285 Ga0496114_0000963 3300048917 Bacteria 21544
286 Ga0496114_0002360 3300048917 Bacteria 14381
287 Ga0496114_0008117 3300048917 Bacteria 8318
288 Ga0496114_0038664 3300048917 Bacteria 3948
289 Ga0496114_0075348 3300048917 Bacteria 2842
290 Ga0496115_0014677 3300048918 Bacteria 5932
291 Ga0501292_000542 3300049515 Unclassified 4686
292 Ga0501299_003439 3300049522 Unclassified 2292
293 Ga0501031_0001594 3300049568 Bacteria 14158
294 Ga0501031_0001876 3300049568 Bacteria 13227
295 Ga0501031_0021444 3300049568 Bacteria 4211
296 Ga0501031_0060749 3300049568 Bacteria 2463
297 Ga0501032_0021005 3300049569 Bacteria 4542
298 Ga0501033_0011066 3300049570 Bacteria 6908
299 Ga0501033_0012700 3300049570 Bacteria 6422
300 Ga0501033_0013314 3300049570 Bacteria 6268
301 Ga0501033_0142438 3300049570 Bacteria 1733
302 Ga0501034_0049798 3300049571 Bacteria 4227
303 Ga0501036_0001385 3300049572 Bacteria 18625
304 Ga0501036_0003809 3300049572 Bacteria 12097
305 Ga0501036_0012577 3300049572 Bacteria 7018
306 Ga0501036_0054149 3300049572 Bacteria 3398
307 Ga0501036_0079998 3300049572 Bacteria 2763
308 Ga0501036_0122599 3300049572 Bacteria 2195
309 Ga0501036_0249475 3300049572 Bacteria 1488
310 Ga0501036_0271433 3300049572 Bacteria 1420
311 Ga0501037_0135421 3300049573 Bacteria 1764
312 Ga0501038_0012895 3300049574 Bacteria 7625
313 Ga0501038_0018441 3300049574 Bacteria 6300
314 Ga0501038_0019671 3300049574 Bacteria 6079
315 Ga0501038_0020565 3300049574 Bacteria 5930
316 Ga0501038_0094924 3300049574 Bacteria 2492
317 Ga0501039_0005993 3300049575 Bacteria 9215
318 Ga0501039_0010749 3300049575 Bacteria 6968
319 Ga0501039_0017649 3300049575 Bacteria 5474
320 Ga0501039_0057396 3300049575 Bacteria 3014
321 Ga0501039_0084658 3300049575 Bacteria 2470
322 Ga0501039_0166861 3300049575 Bacteria 1731
323 Ga0501040_0009885 3300049576 Bacteria 6228
324 Ga0501040_0017114 3300049576 Bacteria 4810
325 Ga0501040_0054087 3300049576 Bacteria 2751
326 Ga0501040_0054594 3300049576 Bacteria 2739
327 Ga0501040_0064001 3300049576 Bacteria 2531
328 Ga0501041_0000554 3300049577 Bacteria 19343
329 Ga0501041_0024075 3300049577 Bacteria 3653
330 Ga0501041_0068489 3300049577 Bacteria 2175
331 Ga0501042_0000412 3300049578 Bacteria 21669
332 Ga0501042_0002213 3300049578 Bacteria 11858
333 Ga0501042_0032478 3300049578 Bacteria 3696
334 Ga0501042_0054320 3300049578 Bacteria 2857
335 Ga0501043_0008530 3300049579 Bacteria 8074
336 Ga0501043_0037106 3300049579 Bacteria 3834
337 Ga0501046_0001878 3300049580 Bacteria 19998
338 Ga0501046_0023499 3300049580 Bacteria 5071
339 Ga0501046_0056113 3300049580 Bacteria 3093
340 Ga0501046_0095676 3300049580 Bacteria 2281
341 Ga0501047_0008368 3300049581 Bacteria 9764
342 Ga0501048_0001666 3300049582 Bacteria 16920
343 Ga0501048_0012559 3300049582 Bacteria 6300
344 Ga0501048_0023220 3300049582 Bacteria 4535
345 Ga0501048_0029000 3300049582 Bacteria 4016
346 Ga0501048_0080916 3300049582 Bacteria 2292
347 Ga0501067_0010934 3300049583 Bacteria 5024
348 Ga0501067_0011245 3300049583 Bacteria 4953
349 Ga0501068_0007380 3300049584 Bacteria 6088
350 Ga0501068_0016378 3300049584 Bacteria 4274
351 Ga0501068_0039819 3300049584 Bacteria 2819
352 Ga0501070_0001429 3300049586 Bacteria 21375
353 Ga0501070_0011292 3300049586 Bacteria 7546
354 Ga0501070_0016342 3300049586 Bacteria 6233
355 Ga0501070_0046485 3300049586 Bacteria 3610
356 Ga0501070_0095690 3300049586 Bacteria 2457
357 Ga0501071_0046248 3300049587 Bacteria 3126
358 Ga0501071_0071359 3300049587 Bacteria 2531
359 Ga0501071_0115577 3300049587 Bacteria 1985
360 Ga0501072_0000766 3300049588 Bacteria 23429
361 Ga0501072_0004190 3300049588 Bacteria 10929
362 Ga0501072_0008956 3300049588 Bacteria 7608
363 Ga0501072_0010996 3300049588 Bacteria 6903
364 Ga0501072_0063129 3300049588 Bacteria 2922
365 Ga0501072_0108536 3300049588 Bacteria 2208
366 Ga0501073_0024047 3300049589 Bacteria 4375
367 Ga0501074_0004161 3300049590 Bacteria 10331
368 Ga0501074_0016589 3300049590 Bacteria 5346
369 Ga0501074_0028601 3300049590 Bacteria 4039
370 Ga0501074_0034124 3300049590 Bacteria 3689
371 Ga0501074_0053521 3300049590 Bacteria 2911
372 Ga0501074_0232302 3300049590 Bacteria 1313
373 Ga0501075_0001809 3300049591 Bacteria 14081
374 Ga0501075_0002499 3300049591 Bacteria 12248
375 Ga0501075_0121518 3300049591 Bacteria 1987
376 Ga0501076_0000345 3300049592 Bacteria 28556
377 Ga0501076_0003792 3300049592 Bacteria 10646
378 Ga0501076_0004208 3300049592 Bacteria 10190
379 Ga0501076_0030359 3300049592 Bacteria 4209
380 Ga0501076_0032136 3300049592 Bacteria 4095
381 Ga0501076_0033289 3300049592 Bacteria 4025
382 Ga0501076_0052586 3300049592 Bacteria 3227
383 Ga0501076_0077819 3300049592 Bacteria 2661
384 Ga0501076_0112667 3300049592 Bacteria 2200
385 Ga0501076_0165368 3300049592 Bacteria 1803
386 Ga0501077_0012920 3300049593 Bacteria 5230
387 Ga0501077_0016290 3300049593 Bacteria 4683
388 Ga0501077_0027317 3300049593 Bacteria 3624
389 Ga0501077_0030768 3300049593 Bacteria 3416
390 Ga0501077_0056230 3300049593 Bacteria 2497
391 Ga0501077_0063790 3300049593 Bacteria 2337
392 Ga0501201_001627 3300049651 Unclassified 2084
393 Ga0501202_000384 3300049652 Archaea 6136
394 Ga0501208_000156 3300049655 Archaea 4537
395 Ga0501214_000023 3300049659 Archaea 9297
396 Ga0501216_001088 3300049660 Unclassified 3540
397 Ga0501217_000608 3300049661 Archaea 6035
398 Ga0501224_000570 3300049664 Unclassified 4522
399 Ga0501227_005625 3300049665 Unclassified 2682
400 Ga0501233_000648 3300049668 Archaea 5677
401 Ga0501235_002009 3300049669 Archaea 4364
402 Ga0501236_002944 3300049670 Unclassified 1976
403 Ga0501240_001779 3300049673 Unclassified 2172
404 Ga0501250_001964 3300049680 Unclassified 1796
405 Ga0501251_000218 3300049681 Archaea 5097
406 Ga0501256_000337 3300049685 Unclassified 2884
407 Ga0501257_003936 3300049686 Unclassified 3221
408 Ga0501258_003099 3300049687 Unclassified 1504
409 Ga0501259_000555 3300049688 Archaea 5999
410 Ga0501261_000659 3300049690 Unclassified 4336
411 Ga0501221_000582 3300049704 Archaea 5831
412 Ga0501229_002213 3300049706 Unclassified 2284
413 Ga0501079_0004554 3300049741 Bacteria 10277
414 Ga0501079_0006991 3300049741 Bacteria 8505
415 Ga0501079_0012784 3300049741 Bacteria 6410
416 Ga0501079_0081206 3300049741 Bacteria 2507
417 Ga0501080_0019504 3300049742 Bacteria 6280
418 Ga0501080_0024917 3300049742 Bacteria 5549
419 Ga0501080_0034676 3300049742 Bacteria 4712
420 Ga0501080_0082512 3300049742 Bacteria 2986
421 Ga0501080_0172135 3300049742 Bacteria 1996
422 Ga0501080_0176779 3300049742 Bacteria 1966
423 Ga0501081_0014289 3300049743 Bacteria 5233
424 Ga0501081_0016538 3300049743 Bacteria 4876
425 Ga0501081_0026502 3300049743 Bacteria 3909
426 Ga0501081_0093357 3300049743 Bacteria 2119
427 Ga0501083_0001233 3300049744 Bacteria 17343
428 Ga0501083_0011096 3300049744 Bacteria 6327
429 Ga0501083_0066399 3300049744 Bacteria 2402
430 Ga0501232_000054 3300049757 Archaea 5612
431 Ga0501266_000605 3300049763 Archaea 4663
432 Ga0501271_000201 3300049768 Archaea 5079
433 Ga0501274_000428 3300049771 Unclassified 2963
434 Ga0501035_0007420 3300049822 Bacteria 10239
435 Ga0501035_0050115 3300049822 Bacteria 3743
436 Ga0501035_0162173 3300049822 Bacteria 1934
437 Ga0501044_0001908 3300049823 Bacteria 24126
438 Ga0501044_0169813 3300049823 Bacteria 2153
439 Ga0501044_0386501 3300049823 Bacteria 1314
440 Ga0501045_0013413 3300049824 Bacteria 5789
441 Ga0501045_0017695 3300049824 Bacteria 5061
442 Ga0501045_0019138 3300049824 Bacteria 4876
443 Ga0501204_005794 3300049850 Unclassified 1361
444 nmdc:mga05p37_168230_c1 3300050507 Bacteria 2674
445 nmdc:mga05p37_258211_c1 3300050507 Bacteria 2087
446 nmdc:mga05p37_84379_c1 3300050507 Bacteria 3914
447 nmdc:mga05p37_87675_c1 3300050507 Bacteria 3836
448 nmdc:mga05p37_9311_c1 3300050507 Bacteria 11618
449 nmdc:mga09592_101925_c1 3300050508 Bacteria 2459
450 nmdc:mga09592_10254_c1 3300050508 Bacteria 7626
451 nmdc:mga06r32_200579_c1 3300050510 Bacteria 1983
452 nmdc:mga08y16_207245_c1 3300050511 Bacteria 2031
453 nmdc:mga08y16_96625_c1 3300050511 Bacteria 3076
454 nmdc:mga0n895_168320_c1 3300050512 Bacteria 2223
455 nmdc:mga08x19_114966_c1 3300050514 Bacteria 1798
456 nmdc:mga0a205_186366_c1 3300050515 Bacteria 1968
457 nmdc:mga0a205_235266_c1 3300050515 Bacteria 1714
458 Ga0495595_0028558 3300053084 Bacteria 2492
459 Ga0495619_0097804 3300053085 Bacteria 1995
460 Ga0500559_0018544 3300053136 Bacteria 2940
461 Ga0500637_0092031 3300053178 Unclassified 1757
462 Ga0501084_0000701 3300054114 Bacteria 25651
463 Ga0501084_0011351 3300054114 Bacteria 7377
464 Ga0501084_0019487 3300054114 Bacteria 5653
465 Ga0501084_0029872 3300054114 Bacteria 4559
466 Ga0501084_0079004 3300054114 Bacteria 2757
467 Ga0501084_0173420 3300054114 Bacteria 1820
468 Ga0501082_0000579 3300060353 Bacteria 32433
469 Ga0501082_0024778 3300060353 Bacteria 5172
470 Ga0501082_0097738 3300060353 Bacteria 2538
471 Ga0501082_0142754 3300060353 Bacteria 2078
472 Ga0501082_0285507 3300060353 Bacteria 1437
473 Ga0466962_0068937 3300061719 Bacteria 1689
474 Ga0530510_0005996 3300061734 Bacteria 8432
475 Ga0530510_0008640 3300061734 Bacteria 7116
476 Ga0530510_0011186 3300061734 Bacteria 6295
477 Ga0530510_0029902 3300061734 Bacteria 3911
478 Ga0530510_0092811 3300061734 Bacteria 2203
479 2791916402 2791354901 Bacteria 8322202
480 2795787384 2795385470 Bacteria 8317180
481 Ga0070706_100037486
482 JGI25406J46586_10001239
483 Ga0070683_100003596
484 Ga0070683_100038823
485 Ga0070683_100135013
486 Ga0070670_100002408
487 Ga0070670_100008658
488 Ga0070680_100029481
489 Ga0070691_10007905
490 Ga0070669_100101093
491 Ga0070671_100011005
492 Ga0070671_100033217
493 Ga0070674_100002960
494 Ga0070674_100003462
495 Ga0070673_100099476
496 Ga0070688_100000600
497 Ga0070714_100000004
498 Ga0070714_100000130
499 Ga0070714_100017884
500 Ga0070701_10022864
501 Ga0070708_100000904
502 Ga0070708_100230511
503 Ga0070678_100059761
504 Ga0070681_10028607
505 Ga0068867_100044718
506 Ga0070685_10050706
507 Ga0070706_100000675
508 Ga0070706_100010187
509 Ga0070706_100017050
510 Ga0070706_100146143
511 Ga0070707_100001465
512 Ga0070707_100001665
513 Ga0070707_100006647
514 Ga0070707_100011378
515 Ga0070707_100046523
516 Ga0070707_100065147
517 Ga0070707_100284230
518 Ga0070698_100034018
519 Ga0070698_100036531
520 Ga0070698_100051580
521 Ga0070699_100023675
522 Ga0070699_100030155
523 Ga0070699_100050482
524 Ga0070679_100004098
525 Ga0070679_100006462
526 Ga0070684_100000397
527 Ga0070684_100026149
528 Ga0070697_100021440
529 Ga0070672_100129051
530 Ga0070686_100002402
531 Ga0070693_100001277
532 Ga0070665_100084640
533 Ga0068857_100009562
534 Ga0068857_100029452
535 Ga0068856_100195472
536 Ga0070702_100016457
537 Ga0068864_100002246
538 Ga0068870_10007215
539 Ga0068858_100063012
540 Ga0081455_10012984
541 Ga0081455_10014102
542 Ga0081455_10035424
543 Ga0081455_10037042
544 Ga0081455_10044002
545 Ga0081455_10085586
546 Ga0081538_10000714
547 Ga0081538_10002907
548 Ga0081539_10002043
549 Ga0081539_10003715
550 Ga0070717_10000517
551 Ga0070717_10009521
552 Ga0070717_10073186
553 Ga0070712_100092015
554 Ga0097621_100324591
555 Ga0097621_100337832
556 Ga0075428_100041170
557 Ga0075430_100081054
558 Ga0075430_100136113
559 Ga0075431_100019260
560 Ga0075431_100061478
561 Ga0075431_100211326
562 Ga0075433_10018571
563 Ga0075434_100203479
564 Ga0075434_100350868
565 Ga0075429_100088087
566 Ga0075436_100228018
567 Ga0105244_10009648
568 Ga0111539_10018539
569 Ga0111539_10107386
570 Ga0114129_10000130
571 Ga0114129_10008101
572 Ga0114129_10018857
573 Ga0114129_10043745
574 Ga0114129_10044326
575 Ga0114129_10066403
576 Ga0114129_10079109
577 Ga0105243_10067739
578 Ga0105243_10121028
579 Ga0105242_10021988
580 Ga0105242_10051096
581 Ga0105248_10114308
582 Ga0105248_10136355
583 Ga0105248_10213264
584 Ga0105248_10228116
585 Ga0105246_10006792
586 Ga0105246_10059086
587 Ga0157378_10157532
588 Ga0157372_10521745
589 Ga0163163_10007851
590 Ga0163163_10081144
591 Ga0163163_10094209
592 Ga0157380_10088059
593 Ga0157377_10015307
594 Ga0206349_1142350
595 Ga0206352_11340933
596 Ga0206350_10334438
597 Ga0213874_10000032
598 Ga0213874_10003218
599 Ga0207697_10000602
600 Ga0207688_10005091
601 Ga0207688_10008699
602 Ga0207645_10022179
603 Ga0207643_10011635
604 Ga0207643_10053751
605 Ga0207643_10072095
606 Ga0207684_10000934
607 Ga0207684_10001986
608 Ga0207684_10010310
609 Ga0207684_10010711
610 Ga0207684_10146873
611 Ga0207707_10039053
612 Ga0207693_10006344
613 Ga0207652_10007252
614 Ga0207652_10016507
615 Ga0207646_10012253
616 Ga0207646_10017230
617 Ga0207646_10027438
618 Ga0207646_10039425
619 Ga0207646_10043623
620 Ga0207646_10128032
621 Ga0207646_10315834
622 Ga0207681_10081507
623 Ga0207650_10079839
624 Ga0207659_10108119
625 Ga0207687_10006013
626 Ga0207687_10264169
627 Ga0207664_10000053
628 Ga0207664_10000073
629 Ga0207664_10011495
630 Ga0207686_10017636
631 Ga0207686_10048441
632 Ga0207709_10058213
633 Ga0207670_10032673
634 Ga0207669_10005662
635 Ga0207669_10010165
636 Ga0207669_10025775
637 Ga0207691_10095929
638 Ga0207661_10002797
639 Ga0207703_10251362
640 Ga0207708_10007504
641 Ga0207708_10278742
642 Ga0207702_10022732
643 Ga0207702_10026687
644 Ga0207648_10093736
645 Ga0207648_10127152
646 Ga0207674_10013317
647 Ga0207683_10034833
648 Ga0207428_10081384
649 Ga0268266_10042900
650 Ga0265326_10013117
651 Ga0265319_1000216
652 Ga0265318_10012966
653 Ga0265338_10005869
654 Ga0265320_10021534
655 Ga0265327_10063397
656 Ga0307408_100159316
657 Ga0316576_10053274
658 Ga0307405_10144348
659 Ga0307413_10010162
660 Ga0307413_10135979
661 Ga0307416_100117757
662 Ga0307416_100178793
663 Ga0307415_100085696
664 Ga0373927_0000006
665 Ga0373933_0211036
666 Ga0316582_0098027
667 Ga0373925_0092161
668 Ga0395899_0057813
669 Ga0395900_0003378
670 Ga0395900_0024023
671 Ga0395900_0056091
672 Ga0395900_0061715
673 Ga0395900_0128218
674 Ga0395900_0180562
675 Ga0395898_0001557
676 Ga0395898_0057282
677 Ga0395898_0127157
678 Ga0395898_0197520
679 Ga0395905_0007091
680 Ga0395905_0033775
681 Ga0395905_0116984
682 Ga0395905_0200224
683 Ga0395901_0018271
684 Ga0395901_0023991
685 Ga0395901_0041713
686 Ga0395901_0115895
687 Ga0395901_0179775
688 Ga0395901_0301763
689 Ga0395901_0335241
690 Ga0436365_1101358
691 Ga0436363_0022126
692 Ga0436363_1502260
693 Ga0436363_1710173
694 Ga0436362_1305943
695 Ga0439438_019009
696 Ga0451577_0000124
697 Ga0451577_0001018
698 Ga0451577_0015746
699 Ga0466969_0000329
700 Ga0466972_0001744
701 Ga0466965_0037609
702 Ga0466966_0000507
703 Ga0466964_0000853
704 Ga0453684_0000239
705 Ga0453684_0000493
706 Ga0453684_0000498
707 Ga0453684_0001241
708 Ga0466970_0036350
709 Ga0466970_0105120
710 Ga0466957_0037852
711 Ga0466959_0022683
712 Ga0466959_0068470
713 Ga0466958_0004792
714 Ga0466967_0001086
715 Ga0466967_0148321
716 Ga0495603_0008457
717 Ga0495603_0095063
718 Ga0495629_0029560
719 Ga0495594_0049766
720 Ga0495640_0067577
721 Ga0495634_0146267
722 Ga0495647_0057647
723 Ga0495613_0037369
724 Ga0495674_0146617
725 Ga0495680_0091470
726 Ga0495602_0080871
727 Ga0496100_0034925
728 Ga0496100_0069853
729 Ga0496101_0000746
730 Ga0496102_0006950
731 Ga0496102_0010688
732 Ga0496104_0000642
733 Ga0496104_0001484
734 Ga0496105_0000090
735 Ga0496105_0037085
736 Ga0496105_0184121
737 Ga0496106_0012110
738 Ga0496106_0018276
739 Ga0496106_0237437
740 Ga0496107_0033277
741 Ga0496107_0088616
742 Ga0496107_0104215
743 Ga0496108_0002107
744 Ga0496108_0003192
745 Ga0496109_0001000
746 Ga0496109_0050144
747 Ga0496109_0226334
748 Ga0496110_0000203
749 Ga0496110_0000524
750 Ga0496110_0011517
751 Ga0496110_0012750
752 Ga0496110_0022235
753 Ga0496110_0047783
754 Ga0496110_0057713
755 Ga0496110_0067691
756 Ga0496111_0000689
757 Ga0496111_0002105
758 Ga0496111_0026306
759 Ga0496111_0053008
760 Ga0496112_0011989
761 Ga0496112_0044375
762 Ga0496112_0209320
763 Ga0496113_0003437
764 Ga0496113_0154440
765 Ga0496114_0000963
766 Ga0496114_0002360
767 Ga0496114_0008117
768 Ga0496114_0038664
769 Ga0496114_0075348
770 Ga0496115_0014677
771 Ga0501292_000542
772 Ga0501299_003439
773 Ga0501031_0001594
774 Ga0501031_0001876
775 Ga0501031_0021444
776 Ga0501031_0060749
777 Ga0501032_0021005
778 Ga0501033_0011066
779 Ga0501033_0012700
780 Ga0501033_0013314
781 Ga0501033_0142438
782 Ga0501034_0049798
783 Ga0501036_0001385
784 Ga0501036_0003809
785 Ga0501036_0012577
786 Ga0501036_0054149
787 Ga0501036_0079998
788 Ga0501036_0122599
789 Ga0501036_0249475
790 Ga0501036_0271433
791 Ga0501037_0135421
792 Ga0501038_0012895
793 Ga0501038_0018441
794 Ga0501038_0019671
795 Ga0501038_0020565
796 Ga0501038_0094924
797 Ga0501039_0005993
798 Ga0501039_0010749
799 Ga0501039_0017649
800 Ga0501039_0057396
801 Ga0501039_0084658
802 Ga0501039_0166861
803 Ga0501040_0009885
804 Ga0501040_0017114
805 Ga0501040_0054087
806 Ga0501040_0054594
807 Ga0501040_0064001
808 Ga0501041_0000554
809 Ga0501041_0024075
810 Ga0501041_0068489
811 Ga0501042_0000412
812 Ga0501042_0002213
813 Ga0501042_0032478
814 Ga0501042_0054320
815 Ga0501043_0008530
816 Ga0501043_0037106
817 Ga0501046_0001878
818 Ga0501046_0023499
819 Ga0501046_0056113
820 Ga0501046_0095676
821 Ga0501047_0008368
822 Ga0501048_0001666
823 Ga0501048_0012559
824 Ga0501048_0023220
825 Ga0501048_0029000
826 Ga0501048_0080916
827 Ga0501067_0010934
828 Ga0501067_0011245
829 Ga0501068_0007380
830 Ga0501068_0016378
831 Ga0501068_0039819
832 Ga0501070_0001429
833 Ga0501070_0011292
834 Ga0501070_0016342
835 Ga0501070_0046485
836 Ga0501070_0095690
837 Ga0501071_0046248
838 Ga0501071_0071359
839 Ga0501071_0115577
840 Ga0501072_0000766
841 Ga0501072_0004190
842 Ga0501072_0008956
843 Ga0501072_0010996
844 Ga0501072_0063129
845 Ga0501072_0108536
846 Ga0501073_0024047
847 Ga0501074_0004161
848 Ga0501074_0016589
849 Ga0501074_0028601
850 Ga0501074_0034124
851 Ga0501074_0053521
852 Ga0501074_0232302
853 Ga0501075_0001809
854 Ga0501075_0002499
855 Ga0501075_0121518
856 Ga0501076_0000345
857 Ga0501076_0003792
858 Ga0501076_0004208
859 Ga0501076_0030359
860 Ga0501076_0032136
861 Ga0501076_0033289
862 Ga0501076_0052586
863 Ga0501076_0077819
864 Ga0501076_0112667
865 Ga0501076_0165368
866 Ga0501077_0012920
867 Ga0501077_0016290
868 Ga0501077_0027317
869 Ga0501077_0030768
870 Ga0501077_0056230
871 Ga0501077_0063790
872 Ga0501201_001627
873 Ga0501202_000384
874 Ga0501208_000156
875 Ga0501214_000023
876 Ga0501216_001088
877 Ga0501217_000608
878 Ga0501224_000570
879 Ga0501227_005625
880 Ga0501233_000648
881 Ga0501235_002009
882 Ga0501236_002944
883 Ga0501240_001779
884 Ga0501250_001964
885 Ga0501251_000218
886 Ga0501256_000337
887 Ga0501257_003936
888 Ga0501258_003099
889 Ga0501259_000555
890 Ga0501261_000659
891 Ga0501221_000582
892 Ga0501229_002213
893 Ga0501079_0004554
894 Ga0501079_0006991
895 Ga0501079_0012784
896 Ga0501079_0081206
897 Ga0501080_0019504
898 Ga0501080_0024917
899 Ga0501080_0034676
900 Ga0501080_0082512
901 Ga0501080_0172135
902 Ga0501080_0176779
903 Ga0501081_0014289
904 Ga0501081_0016538
905 Ga0501081_0026502
906 Ga0501081_0093357
907 Ga0501083_0001233
908 Ga0501083_0011096
909 Ga0501083_0066399
910 Ga0501232_000054
911 Ga0501266_000605
912 Ga0501271_000201
913 Ga0501274_000428
914 Ga0501035_0007420
915 Ga0501035_0050115
916 Ga0501035_0162173
917 Ga0501044_0001908
918 Ga0501044_0169813
919 Ga0501044_0386501
920 Ga0501045_0013413
921 Ga0501045_0017695
922 Ga0501045_0019138
923 Ga0501204_005794
924 nmdc:mga05p37_168230_c1
925 nmdc:mga05p37_258211_c1
926 nmdc:mga05p37_84379_c1
927 nmdc:mga05p37_87675_c1
928 nmdc:mga05p37_9311_c1
929 nmdc:mga09592_101925_c1
930 nmdc:mga09592_10254_c1
931 nmdc:mga06r32_200579_c1
932 nmdc:mga08y16_207245_c1
933 nmdc:mga08y16_96625_c1
934 nmdc:mga0n895_168320_c1
935 nmdc:mga08x19_114966_c1
936 nmdc:mga0a205_186366_c1
937 nmdc:mga0a205_235266_c1
938 Ga0495595_0028558
939 Ga0495619_0097804
940 Ga0500559_0018544
941 Ga0500637_0092031
942 Ga0501084_0000701
943 Ga0501084_0011351
944 Ga0501084_0019487
945 Ga0501084_0029872
946 Ga0501084_0079004
947 Ga0501084_0173420
948 Ga0501082_0000579
949 Ga0501082_0024778
950 Ga0501082_0097738
951 Ga0501082_0142754
952 Ga0501082_0285507
953 Ga0466962_0068937
954 Ga0530510_0005996
955 Ga0530510_0008640
956 Ga0530510_0011186
957 Ga0530510_0029902
958 Ga0530510_0092811
959 2791916402
960 2795787384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00764

Arginosuc_synth

Arginosuccinate synthase N-terminal HUP domain

4

164

0.99

PF20979

Arginosuc_syn_C

Arginosuccinate synthase C-terminal domain

173

391

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xfj-assembly1.cif.gz_B crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine 0.9802 2 396
4xfj-assembly1.cif.gz_A-2 crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine 0.9793 2 396
4u7j-assembly1.cif.gz_B-2 crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile 0.9792 3 396
4xfj-assembly1.cif.gz_A-2 crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine 0.9744 2 396
4u7j-assembly1.cif.gz_B-2 crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile 0.9743 3 396
ID Description Score Start End Superfamily
4xfjA02 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9884 175 360 3.90.1260.10
4xfjA02 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.978 175 360 3.90.1260.10
1kh1C02 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9734 66 354 3.90.1260.10
af_A0A0R0IGZ2_74_244_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9722 174 343 3.90.1260.10
af_A0A0P0Y1E8_15_149_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9709 250 377 3.90.1260.10
ID Description Score Start End GO Terms
AF-X1SX87-F1-model_v4 argininosuccinate synthase (EC 6.3.4.5) 0.9918 239 380 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-X1N1A5-F1-model_v4 argininosuccinate synthase (EC 6.3.4.5) 0.9917 230 393 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-G7J521-F1-model_v4 argininosuccinate synthase (EC 6.3.4.5) 0.9911 216 357 GO:0004055
GO:0005524
GO:0006526
AF-A0A365UVF0-F1-model_v4 deleted 0.9907 1 397
AF-A0A349M1R1-F1-model_v4 argininosuccinate synthase (EC 6.3.4.5) 0.9903 253 394 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526

Map