F452158

General Info

Members Datasets Scaffolds Average Seq Length
480 256 960 69

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10811497|Ga0070676_108114972
Length 76
Sequence VSSPEGRVREHLERLVAELLDKGVHYEDARREFEKLLIGRALQRTDGSLGEAADMLGLHRNTVARKIAEYRIKRSS

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
166 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
181 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
182 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
186 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
187 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
188 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
189 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
190 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
194 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
252 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 5.83
Rhizosphere 91.67
Stem 0
Stem Tuber 0
Unclassified 5.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10811497 3300005328 Bacteria 691
2 Ga0065704_10822769 3300005289 Unclassified 518
3 Ga0065712_10087078 3300005290 Bacteria 2596
4 Ga0065712_10133127 3300005290 Bacteria 1526
5 Ga0065715_10000923 3300005293 Bacteria 9569
6 Ga0065715_10003859 3300005293 Bacteria 4238
7 Ga0065715_10007351 3300005293 Bacteria 2680
8 Ga0065715_10053661 3300005293 Bacteria 794
9 Ga0065715_10689480 3300005293 Bacteria 658
10 Ga0065707_10002231 3300005295 Bacteria 4831
11 Ga0065707_10109769 3300005295 Bacteria 2450
12 Ga0070658_11378637 3300005327 Bacteria 612
13 Ga0070676_10101963 3300005328 Bacteria 1774
14 Ga0070683_100000214 3300005329 Bacteria 39384
15 Ga0070683_100758444 3300005329 Bacteria 930
16 Ga0070690_100187439 3300005330 Bacteria 1432
17 Ga0070670_100007344 3300005331 Bacteria 9354
18 Ga0070670_100013435 3300005331 Bacteria 7013
19 Ga0070670_100727245 3300005331 Bacteria 893
20 Ga0070670_101192065 3300005331 Bacteria 696
21 Ga0070677_10081918 3300005333 Bacteria 1383
22 Ga0068869_100408675 3300005334 Bacteria 1118
23 Ga0068869_100949685 3300005334 Bacteria 746
24 Ga0070666_10069016 3300005335 Bacteria 2402
25 Ga0070666_10290617 3300005335 Bacteria 1163
26 Ga0070680_101228992 3300005336 Unclassified 648
27 Ga0070682_100434295 3300005337 Bacteria 1002
28 Ga0070682_100931680 3300005337 Bacteria 716
29 Ga0068868_100297221 3300005338 Bacteria 1371
30 Ga0070660_100441658 3300005339 Bacteria 1079
31 Ga0070660_100583724 3300005339 Bacteria 934
32 Ga0070689_100428263 3300005340 Bacteria 1122
33 Ga0070691_10096233 3300005341 Bacteria 1466
34 Ga0070691_10539174 3300005341 Unclassified 680
35 Ga0070687_100218960 3300005343 Bacteria 1165
36 Ga0070661_100142064 3300005344 Bacteria 1810
37 Ga0070661_100993618 3300005344 Bacteria 696
38 Ga0070661_101600072 3300005344 Unclassified 551
39 Ga0070692_10081608 3300005345 Bacteria 1743
40 Ga0070668_100812989 3300005347 Unclassified 831
41 Ga0070668_101430883 3300005347 Bacteria 631
42 Ga0070669_100008030 3300005353 Bacteria 7534
43 Ga0070669_100015022 3300005353 Bacteria 5521
44 Ga0070669_100082774 3300005353 Bacteria 2393
45 Ga0070669_102015385 3300005353 Unclassified 504
46 Ga0070675_100091371 3300005354 Bacteria 2550
47 Ga0070675_100434122 3300005354 Bacteria 1176
48 Ga0070671_100064278 3300005355 Bacteria 3056
49 Ga0070671_100066314 3300005355 Bacteria 3008
50 Ga0070674_100073127 3300005356 Bacteria 2429
51 Ga0070674_100126486 3300005356 Bacteria 1899
52 Ga0070673_100002377 3300005364 Bacteria 11455
53 Ga0070688_100513641 3300005365 Bacteria 906
54 Ga0070688_100780112 3300005365 Bacteria 746
55 Ga0070659_100310464 3300005366 Bacteria 1317
56 Ga0070659_100359056 3300005366 Bacteria 1224
57 Ga0070659_100401838 3300005366 Bacteria 1157
58 Ga0070659_101514386 3300005366 Unclassified 598
59 Ga0070667_100425699 3300005367 Bacteria 1211
60 Ga0070667_100501205 3300005367 Bacteria 1113
61 Ga0070703_10236682 3300005406 Bacteria 734
62 Ga0070709_10432342 3300005434 Bacteria 988
63 Ga0070701_10109463 3300005438 Bacteria 1541
64 Ga0070701_10311613 3300005438 Bacteria 971
65 Ga0070711_101235981 3300005439 Bacteria 647
66 Ga0070700_100130828 3300005441 Bacteria 1693
67 Ga0070700_100588384 3300005441 Bacteria 870
68 Ga0070700_101076934 3300005441 Bacteria 665
69 Ga0070708_102060082 3300005445 Bacteria 528
70 Ga0070663_100014786 3300005455 Bacteria 5018
71 Ga0070663_100504478 3300005455 Bacteria 1005
72 Ga0070663_100504878 3300005455 Bacteria 1005
73 Ga0070663_101819739 3300005455 Unclassified 546
74 Ga0070678_101502375 3300005456 Bacteria 631
75 Ga0070678_101626901 3300005456 Bacteria 607
76 Ga0070678_102396989 3300005456 Bacteria 501
77 Ga0070662_100270562 3300005457 Bacteria 1372
78 Ga0070662_100526819 3300005457 Bacteria 988
79 Ga0070662_101768229 3300005457 Unclassified 534
80 Ga0070681_10277890 3300005458 Bacteria 1586
81 Ga0070681_10663643 3300005458 Bacteria 958
82 Ga0070681_11795397 3300005458 Bacteria 540
83 Ga0070681_12011660 3300005458 Bacteria 506
84 Ga0068867_100167700 3300005459 Bacteria 1737
85 Ga0068867_100629472 3300005459 Bacteria 939
86 Ga0070706_100205478 3300005467 Bacteria 1839
87 Ga0070707_101076063 3300005468 Bacteria 770
88 Ga0070707_102248018 3300005468 Bacteria 513
89 Ga0070698_100217521 3300005471 Bacteria 1845
90 Ga0070698_101088077 3300005471 Bacteria 748
91 Ga0070699_100670320 3300005518 Bacteria 947
92 Ga0070679_100738651 3300005530 Bacteria 927
93 Ga0070679_101117255 3300005530 Bacteria 733
94 Ga0070684_100000085 3300005535 Bacteria 61530
95 Ga0070684_100330977 3300005535 Bacteria 1400
96 Ga0070672_100173632 3300005543 Bacteria 1793
97 Ga0070672_101427085 3300005543 Bacteria 619
98 Ga0070686_100018665 3300005544 Bacteria 4076
99 Ga0070686_100142460 3300005544 Bacteria 1670
100 Ga0070695_100035034 3300005545 Bacteria 3151
101 Ga0070695_100873687 3300005545 Bacteria 725
102 Ga0070695_101141198 3300005545 Unclassified 639
103 Ga0070696_100137100 3300005546 Bacteria 1785
104 Ga0070696_101977376 3300005546 Unclassified 506
105 Ga0070693_100001263 3300005547 Bacteria 11443
106 Ga0070693_100651719 3300005547 Bacteria 766
107 Ga0070665_100395347 3300005548 Bacteria 1390
108 Ga0070704_100226469 3300005549 Bacteria 1523
109 Ga0070704_102109784 3300005549 Bacteria 524
110 Ga0068855_100398879 3300005563 Bacteria 1508
111 Ga0068855_101623922 3300005563 Bacteria 661
112 Ga0070664_100002158 3300005564 Bacteria 15785
113 Ga0068857_100055529 3300005577 Bacteria 3515
114 Ga0068854_100121385 3300005578 Bacteria 1984
115 Ga0068854_100692879 3300005578 Bacteria 879
116 Ga0070702_100631094 3300005615 Bacteria 807
117 Ga0070702_101586613 3300005615 Bacteria 541
118 Ga0068852_100759618 3300005616 Bacteria 982
119 Ga0068852_101217828 3300005616 Bacteria 774
120 Ga0068859_100386827 3300005617 Bacteria 1494
121 Ga0068859_100607562 3300005617 Bacteria 1186
122 Ga0068864_100628624 3300005618 Bacteria 1044
123 Ga0068864_100685585 3300005618 Bacteria 1000
124 Ga0068861_101387918 3300005719 Bacteria 686
125 Ga0068863_100290251 3300005841 Bacteria 1585
126 Ga0068863_100615553 3300005841 Bacteria 1075
127 Ga0068858_100145921 3300005842 Bacteria 2222
128 Ga0068860_101798096 3300005843 Bacteria 635
129 Ga0068862_100022245 3300005844 Bacteria 5303
130 Ga0068862_100465883 3300005844 Bacteria 1193
131 Ga0068862_102038703 3300005844 Bacteria 585
132 Ga0070717_10211780 3300006028 Bacteria 1701
133 Ga0075365_10010114 3300006038 Bacteria 5474
134 Ga0075367_10144474 3300006178 Bacteria 1474
135 Ga0075367_10515423 3300006178 Bacteria 759
136 Ga0075428_100006271 3300006844 Bacteria 13222
137 Ga0075431_100610932 3300006847 Bacteria 1073
138 Ga0075433_10201931 3300006852 Bacteria 1767
139 Ga0075433_10412108 3300006852 Bacteria 1192
140 Ga0075434_100003671 3300006871 Bacteria 13714
141 Ga0075434_100210621 3300006871 Bacteria 1964
142 Ga0075434_100231840 3300006871 Bacteria 1866
143 Ga0075434_101012086 3300006871 Bacteria 845
144 Ga0075429_100043011 3300006880 Bacteria 3930
145 Ga0075429_100059575 3300006880 Bacteria 3326
146 Ga0075429_100228459 3300006880 Bacteria 1630
147 Ga0068865_100865606 3300006881 Bacteria 784
148 Ga0068865_101120455 3300006881 Bacteria 694
149 Ga0068865_101650599 3300006881 Bacteria 577
150 Ga0097620_100386807 3300006931 Bacteria 1494
151 Ga0097620_100607572 3300006931 Bacteria 1186
152 Ga0075435_100005831 3300007076 Bacteria 8661
153 Ga0075435_101210245 3300007076 Bacteria 661
154 Ga0075435_101932961 3300007076 Bacteria 518
155 Ga0105240_10408847 3300009093 Bacteria 1527
156 Ga0105240_10487084 3300009093 Bacteria 1373
157 Ga0105240_10933317 3300009093 Bacteria 932
158 Ga0105240_11436073 3300009093 Bacteria 725
159 Ga0111539_10000701 3300009094 Bacteria 43437
160 Ga0111539_10355188 3300009094 Bacteria 1706
161 Ga0111539_10435400 3300009094 Bacteria 1527
162 Ga0111539_10760873 3300009094 Bacteria 1127
163 Ga0111539_10826417 3300009094 Bacteria 1078
164 Ga0111539_11431427 3300009094 Bacteria 802
165 Ga0111539_11826339 3300009094 Bacteria 705
166 Ga0111539_11948554 3300009094 Bacteria 681
167 Ga0111539_12783350 3300009094 Unclassified 567
168 Ga0111539_12784096 3300009094 Bacteria 567
169 Ga0111539_12938642 3300009094 Bacteria 551
170 Ga0111539_13051078 3300009094 Bacteria 541
171 Ga0105245_10352180 3300009098 Bacteria 1459
172 Ga0114129_10046832 3300009147 Bacteria 6077
173 Ga0114129_10063195 3300009147 Bacteria 5171
174 Ga0114129_10364507 3300009147 Bacteria 1911
175 Ga0105243_10023145 3300009148 Bacteria 4726
176 Ga0105243_11158081 3300009148 Bacteria 784
177 Ga0105243_11327310 3300009148 Bacteria 737
178 Ga0105243_12628415 3300009148 Bacteria 543
179 Ga0105242_10017122 3300009176 Bacteria 5643
180 Ga0105248_10026378 3300009177 Bacteria 6463
181 Ga0105248_10181145 3300009177 Bacteria 2374
182 Ga0105248_10322467 3300009177 Bacteria 1740
183 Ga0105248_12597839 3300009177 Bacteria 577
184 Ga0105249_10000459 3300009553 Bacteria 37955
185 Ga0105249_10233373 3300009553 Bacteria 1815
186 Ga0105249_10389049 3300009553 Bacteria 1422
187 Ga0105249_10860820 3300009553 Bacteria 972
188 Ga0105239_10268332 3300010375 Bacteria 1919
189 Ga0105239_13397098 3300010375 Bacteria 518
190 Ga0105246_10164267 3300011119 Bacteria 1694
191 Ga0105246_10565888 3300011119 Bacteria 976
192 Ga0105246_11906439 3300011119 Bacteria 571
193 Ga0157338_1071250 3300012515 Bacteria 543
194 Ga0157373_10657101 3300013100 Bacteria 766
195 Ga0157369_10329647 3300013105 Bacteria 1586
196 Ga0157374_10286347 3300013296 Bacteria 1627
197 Ga0157378_10789418 3300013297 Bacteria 975
198 Ga0163162_12875233 3300013306 Bacteria 554
199 Ga0157372_12379188 3300013307 Bacteria 608
200 Ga0157375_10327227 3300013308 Bacteria 1697
201 Ga0163163_10155486 3300014325 Bacteria 2331
202 Ga0157380_10053147 3300014326 Bacteria 3211
203 Ga0157380_10080663 3300014326 Bacteria 2660
204 Ga0157380_10084427 3300014326 Bacteria 2604
205 Ga0157380_10306492 3300014326 Bacteria 1465
206 Ga0157380_10339039 3300014326 Bacteria 1401
207 Ga0157380_10655779 3300014326 Bacteria 1048
208 Ga0157380_11875137 3300014326 Bacteria 660
209 Ga0157380_12632685 3300014326 Bacteria 569
210 Ga0157380_13445166 3300014326 Bacteria 506
211 Ga0182008_10230636 3300014497 Bacteria 950
212 Ga0157377_10155916 3300014745 Bacteria 1416
213 Ga0157377_10382219 3300014745 Bacteria 954
214 Ga0157377_10547217 3300014745 Bacteria 817
215 Ga0157379_10369295 3300014968 Bacteria 1315
216 Ga0157379_12501180 3300014968 Unclassified 516
217 Ga0157376_10308928 3300014969 Bacteria 1499
218 Ga0163161_10539607 3300017792 Bacteria 955
219 Ga0163161_11380926 3300017792 Bacteria 615
220 Ga0206353_10708883 3300020082 Unclassified 519
221 Ga0206353_11787877 3300020082 Bacteria 667
222 Ga0207697_10018537 3300025315 Bacteria 2854
223 Ga0207697_10298614 3300025315 Bacteria 714
224 Ga0207682_10069863 3300025893 Bacteria 1486
225 Ga0207682_10219138 3300025893 Bacteria 880
226 Ga0207682_10637380 3300025893 Bacteria 501
227 Ga0207642_10222386 3300025899 Bacteria 1056
228 Ga0207642_10862876 3300025899 Unclassified 578
229 Ga0207688_10117650 3300025901 Bacteria 1548
230 Ga0207680_10045401 3300025903 Bacteria 2590
231 Ga0207680_10877154 3300025903 Bacteria 643
232 Ga0207647_10031897 3300025904 Bacteria 3389
233 Ga0207699_10524955 3300025906 Bacteria 857
234 Ga0207645_10060846 3300025907 Bacteria 2412
235 Ga0207645_10215480 3300025907 Bacteria 1265
236 Ga0207645_10770589 3300025907 Bacteria 654
237 Ga0207643_10186819 3300025908 Bacteria 1256
238 Ga0207705_10825728 3300025909 Unclassified 719
239 Ga0207705_11320239 3300025909 Bacteria 550
240 Ga0207707_10113580 3300025912 Bacteria 2367
241 Ga0207695_10358778 3300025913 Bacteria 1344
242 Ga0207695_10869811 3300025913 Bacteria 781
243 Ga0207695_11133987 3300025913 Bacteria 662
244 Ga0207660_11644021 3300025917 Bacteria 517
245 Ga0207662_10012774 3300025918 Bacteria 4684
246 Ga0207657_10125060 3300025919 Bacteria 2112
247 Ga0207657_10376383 3300025919 Bacteria 1118
248 Ga0207649_11011740 3300025920 Bacteria 654
249 Ga0207649_11041267 3300025920 Bacteria 645
250 Ga0207652_10275695 3300025921 Bacteria 1517
251 Ga0207652_10604896 3300025921 Bacteria 983
252 Ga0207646_11727832 3300025922 Bacteria 537
253 Ga0207681_10014521 3300025923 Bacteria 4896
254 Ga0207681_10099176 3300025923 Bacteria 2097
255 Ga0207681_10154634 3300025923 Bacteria 1722
256 Ga0207681_10661040 3300025923 Bacteria 867
257 Ga0207681_11600961 3300025923 Unclassified 545
258 Ga0207650_10009155 3300025925 Bacteria 6769
259 Ga0207650_10018581 3300025925 Bacteria 4879
260 Ga0207650_10368540 3300025925 Bacteria 1184
261 Ga0207650_10962187 3300025925 Bacteria 726
262 Ga0207659_10239222 3300025926 Bacteria 1468
263 Ga0207659_10421875 3300025926 Bacteria 1119
264 Ga0207659_10722224 3300025926 Bacteria 854
265 Ga0207687_10082580 3300025927 Bacteria 2325
266 Ga0207644_10030923 3300025931 Bacteria 3727
267 Ga0207644_10497656 3300025931 Bacteria 1005
268 Ga0207690_10027177 3300025932 Bacteria 3614
269 Ga0207690_10146903 3300025932 Bacteria 1744
270 Ga0207690_11431739 3300025932 Bacteria 578
271 Ga0207690_11833017 3300025932 Unclassified 506
272 Ga0207706_10106365 3300025933 Bacteria 2469
273 Ga0207686_10056249 3300025934 Bacteria 2472
274 Ga0207669_10083207 3300025937 Bacteria 2057
275 Ga0207669_10148631 3300025937 Bacteria 1638
276 Ga0207669_10302646 3300025937 Bacteria 1216
277 Ga0207669_10623117 3300025937 Bacteria 879
278 Ga0207691_10109567 3300025940 Bacteria 2457
279 Ga0207711_10066039 3300025941 Bacteria 3128
280 Ga0207711_10307040 3300025941 Bacteria 1464
281 Ga0207711_10749508 3300025941 Bacteria 910
282 Ga0207711_11483169 3300025941 Bacteria 621
283 Ga0207689_10244402 3300025942 Bacteria 1484
284 Ga0207689_11206003 3300025942 Unclassified 637
285 Ga0207661_10057569 3300025944 Bacteria 3125
286 Ga0207661_10104828 3300025944 Bacteria 2381
287 Ga0207679_10003405 3300025945 Bacteria 9807
288 Ga0207679_10871818 3300025945 Bacteria 823
289 Ga0207667_11290253 3300025949 Bacteria 707
290 Ga0207651_10004572 3300025960 Bacteria 7003
291 Ga0207712_10004264 3300025961 Bacteria 9018
292 Ga0207712_10283020 3300025961 Bacteria 1354
293 Ga0207640_10282366 3300025981 Bacteria 1305
294 Ga0207658_10091516 3300025986 Bacteria 2360
295 Ga0207658_10134095 3300025986 Bacteria 1994
296 Ga0207677_10126010 3300026023 Bacteria 1935
297 Ga0207703_10200976 3300026035 Bacteria 1771
298 Ga0207678_10016600 3300026067 Bacteria 6468
299 Ga0207678_10505336 3300026067 Bacteria 1054
300 Ga0207708_10005583 3300026075 Bacteria 9282
301 Ga0207708_10070876 3300026075 Bacteria 2669
302 Ga0207708_11424569 3300026075 Bacteria 608
303 Ga0207641_10425038 3300026088 Bacteria 1280
304 Ga0207641_10941638 3300026088 Bacteria 859
305 Ga0207648_10101670 3300026089 Bacteria 2519
306 Ga0207648_10368934 3300026089 Bacteria 1296
307 Ga0207676_10717829 3300026095 Bacteria 970
308 Ga0207676_11413629 3300026095 Bacteria 692
309 Ga0207675_100080529 3300026118 Bacteria 3053
310 Ga0207675_100242140 3300026118 Bacteria 1743
311 Ga0207683_10419605 3300026121 Bacteria 1232
312 Ga0207683_10445676 3300026121 Bacteria 1193
313 Ga0207698_11690020 3300026142 Bacteria 648
314 Ga0207698_11968311 3300026142 Bacteria 599
315 Ga0209971_1096592 3300027682 Bacteria 722
316 Ga0207428_10332026 3300027907 Bacteria 1121
317 Ga0207428_10399630 3300027907 Bacteria 1006
318 Ga0207428_10421576 3300027907 Bacteria 975
319 Ga0207428_10517292 3300027907 Bacteria 865
320 Ga0268266_10439919 3300028379 Bacteria 1238
321 Ga0268265_10015546 3300028380 Bacteria 5211
322 Ga0268265_10231457 3300028380 Bacteria 1624
323 Ga0268265_11746757 3300028380 Bacteria 628
324 Ga0268264_10198158 3300028381 Bacteria 1835
325 Ga0268264_11124685 3300028381 Bacteria 794
326 Ga0307408_100145878 3300031548 Bacteria 1863
327 Ga0307408_100674843 3300031548 Bacteria 926
328 Ga0307408_102096606 3300031548 Bacteria 545
329 Ga0307405_10894758 3300031731 Bacteria 750
330 Ga0307413_10887866 3300031824 Bacteria 756
331 Ga0307407_11581557 3300031903 Bacteria 520
332 Ga0307412_10564575 3300031911 Bacteria 958
333 Ga0307409_100243821 3300031995 Bacteria 1638
334 Ga0307409_102848093 3300031995 Bacteria 511
335 Ga0307416_100082426 3300032002 Bacteria 2725
336 Ga0307416_100555365 3300032002 Bacteria 1222
337 Ga0307416_100744466 3300032002 Bacteria 1072
338 Ga0307415_101520904 3300032126 Bacteria 641
339 Ga0373959_0134182 3300034820 Bacteria 615
340 Ga0373928_0030096 3300035084 Bacteria 1198
341 Ga0373940_0051075 3300035088 Bacteria 1162
342 Ga0373941_0165744 3300035115 Bacteria 820
343 Ga0373946_0063652 3300035171 Bacteria 1576
344 Ga0373924_0241669 3300035410 Bacteria 799
345 Ga0373931_0660878 3300035691 Bacteria 687
346 Ga0373935_0131066 3300035692 Bacteria 1685
347 Ga0373927_0938157 3300035695 Bacteria 571
348 Ga0373947_0039981 3300035725 Bacteria 2793
349 Ga0373937_0104145 3300036401 Bacteria 2636
350 Ga0373937_0532756 3300036401 Bacteria 1116
351 Ga0373925_0050639 3300037068 Bacteria 3098
352 Ga0395900_0244464 3300037418 Bacteria 1799
353 Ga0395905_0830237 3300037471 Bacteria 827
354 Ga0395901_1489901 3300038443 Bacteria 633
355 Ga0439461_0142153 3300041410 Bacteria 614
356 Ga0451800_0467326 3300041459 Bacteria 661
357 Ga0451804_0093419 3300041463 Bacteria 601
358 Ga0451807_1794984 3300041486 Unclassified 612
359 Ga0451853_0169319 3300041512 Bacteria 601
360 Ga0451853_1155304 3300041512 Unclassified 515
361 Ga0451853_2147937 3300041512 Bacteria 1051
362 Ga0451853_3080467 3300041512 Bacteria 559
363 Ga0451853_3395287 3300041512 Bacteria 535
364 Ga0439433_0031621 3300041999 Bacteria 1212
365 Ga0439442_051495 3300042002 Bacteria 869
366 Ga0439443_021283 3300042003 Bacteria 1024
367 Ga0439445_0063210 3300042004 Bacteria 1015
368 Ga0450921_038251 3300042123 Bacteria 507
369 Ga0450898_107451 3300042134 Bacteria 588
370 Ga0439434_0015516 3300042435 Bacteria 2273
371 Ga0439435_0004608 3300042436 Bacteria 2982
372 Ga0439444_0045468 3300042437 Bacteria 876
373 Ga0450916_014828 3300042530 Bacteria 1019
374 Ga0451577_0032427 3300042876 Bacteria 4707
375 Ga0453684_0387841 3300044712 Bacteria 1567
376 Ga0466967_0116354 3300045976 Bacteria 2463
377 Ga0495629_0162373 3300046459 Bacteria 1552
378 Ga0495641_0595302 3300046461 Bacteria 505
379 Ga0495608_0714627 3300046511 Bacteria 595
380 Ga0495598_0161122 3300046537 Bacteria 789
381 Ga0495667_0237361 3300046559 Bacteria 1162
382 Ga0495588_0633571 3300046674 Bacteria 560
383 Ga0495647_0528029 3300046681 Bacteria 551
384 Ga0495658_0300019 3300046683 Bacteria 1016
385 Ga0495674_0216209 3300047319 Bacteria 1586
386 Ga0495680_0503587 3300047322 Bacteria 822
387 Ga0495680_1100216 3300047322 Bacteria 502
388 Ga0496100_1150486 3300048903 Bacteria 612
389 Ga0496101_1199280 3300048904 Bacteria 595
390 Ga0496102_1157848 3300048905 Bacteria 693
391 Ga0496103_0464003 3300048906 Bacteria 812
392 Ga0496103_0961762 3300048906 Bacteria 533
393 Ga0496104_0003418 3300048907 Bacteria 13695
394 Ga0496104_0066493 3300048907 Bacteria 3423
395 Ga0496105_0067756 3300048908 Bacteria 2947
396 Ga0496106_0336603 3300048909 Bacteria 1212
397 Ga0496106_1381275 3300048909 Bacteria 545
398 Ga0496107_0926978 3300048910 Bacteria 634
399 Ga0496108_0000873 3300048911 Bacteria 23508
400 Ga0496108_0688618 3300048911 Bacteria 887
401 Ga0496109_0003131 3300048912 Bacteria 13804
402 Ga0496109_1236822 3300048912 Bacteria 683
403 Ga0496110_0000667 3300048913 Bacteria 23527
404 Ga0496110_0237881 3300048913 Bacteria 1657
405 Ga0496112_0000360 3300048915 Bacteria 29685
406 Ga0496112_0083418 3300048915 Bacteria 3161
407 Ga0496112_0104596 3300048915 Bacteria 2801
408 Ga0496112_0435110 3300048915 Bacteria 1250
409 Ga0496112_1853046 3300048915 Bacteria 515
410 Ga0496113_0064846 3300048916 Bacteria 2763
411 Ga0496113_0989382 3300048916 Bacteria 663
412 Ga0496113_1134583 3300048916 Bacteria 612
413 Ga0501034_0016627 3300049571 Bacteria 7543
414 Ga0501040_1199733 3300049576 Bacteria 551
415 Ga0501041_0135464 3300049577 Bacteria 1535
416 Ga0501041_0685912 3300049577 Bacteria 655
417 Ga0501048_0282619 3300049582 Bacteria 1180
418 Ga0501067_0248753 3300049583 Bacteria 989
419 Ga0501069_0158914 3300049585 Bacteria 1301
420 Ga0501070_1322686 3300049586 Unclassified 550
421 Ga0501071_0247118 3300049587 Bacteria 1346
422 Ga0501072_0481141 3300049588 Unclassified 982
423 Ga0501074_0260199 3300049590 Bacteria 1234
424 Ga0501074_0725638 3300049590 Bacteria 701
425 Ga0501075_0840863 3300049591 Bacteria 698
426 Ga0501076_0132886 3300049592 Bacteria 2019
427 Ga0501076_0731712 3300049592 Bacteria 816
428 Ga0501249_180833 3300049679 Bacteria 545
429 Ga0501079_0262108 3300049741 Bacteria 1351
430 Ga0501079_0551248 3300049741 Bacteria 907
431 Ga0501081_0446071 3300049743 Bacteria 961
432 Ga0501081_0680714 3300049743 Bacteria 772
433 Ga0501083_0566593 3300049744 Bacteria 739
434 Ga0501035_1258121 3300049822 Bacteria 572
435 Ga0501035_1554975 3300049822 Bacteria 503
436 Ga0501045_0166451 3300049824 Bacteria 1642
437 Ga0501045_0563815 3300049824 Bacteria 844
438 Ga0501212_096181 3300049851 Bacteria 552
439 nmdc:mga00v17_582085_c1 3300050491 Bacteria 722
440 nmdc:mga0yw44_75803_c1 3300050492 Bacteria 2098
441 nmdc:mga05p37_116159_c1 3300050507 Bacteria 3289
442 nmdc:mga05p37_286106_c1 3300050507 Bacteria 1964
443 nmdc:mga05p37_46856_c1 3300050507 Bacteria 5315
444 nmdc:mga09592_1019623_c1 3300050508 Bacteria 691
445 nmdc:mga09592_20112_c1 3300050508 Bacteria 5486
446 nmdc:mga09592_26060_c1 3300050508 Bacteria 4842
447 nmdc:mga09592_383109_c1 3300050508 Bacteria 1216
448 nmdc:mga09592_388924_c1 3300050508 Bacteria 1206
449 nmdc:mga06r32_1528677_c1 3300050510 Bacteria 607
450 nmdc:mga06r32_2081262_c1 3300050510 Bacteria 501
451 nmdc:mga06r32_31991_c1 3300050510 Bacteria 4944
452 nmdc:mga08y16_10511_c1 3300050511 Bacteria 9711
453 nmdc:mga08y16_119072_c1 3300050511 Bacteria 2749
454 nmdc:mga08y16_1390747_c1 3300050511 Bacteria 665
455 nmdc:mga08y16_1564575_c1 3300050511 Bacteria 618
456 nmdc:mga08y16_169552_c1 3300050511 Bacteria 2267
457 nmdc:mga08y16_201544_c1 3300050511 Bacteria 2062
458 nmdc:mga08y16_336951_c1 3300050511 Bacteria 1551
459 nmdc:mga08y16_578907_c1 3300050511 Bacteria 1134
460 nmdc:mga08y16_730161_c1 3300050511 Bacteria 988
461 nmdc:mga0n895_1094031_c1 3300050512 Bacteria 775
462 nmdc:mga0n895_220407_c1 3300050512 Bacteria 1926
463 nmdc:mga0n895_272470_c1 3300050512 Bacteria 1717
464 nmdc:mga0n895_3514_c1 3300050512 Bacteria 12664
465 nmdc:mga0n895_519002_c1 3300050512 Bacteria 1199
466 nmdc:mga0rr50_1653665_c1 3300050513 Bacteria 540
467 nmdc:mga0rr50_201498_c1 3300050513 Bacteria 1635
468 nmdc:mga0a205_237825_c1 3300050515 Bacteria 1703
469 nmdc:mga0a205_500212_c1 3300050515 Bacteria 1072
470 nmdc:mga0a205_77706_c1 3300050515 Bacteria 3207
471 Ga0495601_0836426 3300053077 Bacteria 583
472 Ga0495595_0273795 3300053084 Bacteria 847
473 Ga0500555_138505 3300053103 Bacteria 600
474 Ga0500628_257085 3300053129 Bacteria 514
475 Ga0501084_0459109 3300054114 Unclassified 1077
476 Ga0501084_1814685 3300054114 Unclassified 509
477 Ga0590071_031577 3300059421 Bacteria 1263
478 Ga0501082_0484779 3300060353 Bacteria 1081
479 Ga0530510_0417814 3300061734 Bacteria 1012
480 Ga0530510_0458620 3300061734 Bacteria 964
481 Ga0070676_10811497
482 Ga0065704_10822769
483 Ga0065712_10087078
484 Ga0065712_10133127
485 Ga0065715_10000923
486 Ga0065715_10003859
487 Ga0065715_10007351
488 Ga0065715_10053661
489 Ga0065715_10689480
490 Ga0065707_10002231
491 Ga0065707_10109769
492 Ga0070658_11378637
493 Ga0070676_10101963
494 Ga0070683_100000214
495 Ga0070683_100758444
496 Ga0070690_100187439
497 Ga0070670_100007344
498 Ga0070670_100013435
499 Ga0070670_100727245
500 Ga0070670_101192065
501 Ga0070677_10081918
502 Ga0068869_100408675
503 Ga0068869_100949685
504 Ga0070666_10069016
505 Ga0070666_10290617
506 Ga0070680_101228992
507 Ga0070682_100434295
508 Ga0070682_100931680
509 Ga0068868_100297221
510 Ga0070660_100441658
511 Ga0070660_100583724
512 Ga0070689_100428263
513 Ga0070691_10096233
514 Ga0070691_10539174
515 Ga0070687_100218960
516 Ga0070661_100142064
517 Ga0070661_100993618
518 Ga0070661_101600072
519 Ga0070692_10081608
520 Ga0070668_100812989
521 Ga0070668_101430883
522 Ga0070669_100008030
523 Ga0070669_100015022
524 Ga0070669_100082774
525 Ga0070669_102015385
526 Ga0070675_100091371
527 Ga0070675_100434122
528 Ga0070671_100064278
529 Ga0070671_100066314
530 Ga0070674_100073127
531 Ga0070674_100126486
532 Ga0070673_100002377
533 Ga0070688_100513641
534 Ga0070688_100780112
535 Ga0070659_100310464
536 Ga0070659_100359056
537 Ga0070659_100401838
538 Ga0070659_101514386
539 Ga0070667_100425699
540 Ga0070667_100501205
541 Ga0070703_10236682
542 Ga0070709_10432342
543 Ga0070701_10109463
544 Ga0070701_10311613
545 Ga0070711_101235981
546 Ga0070700_100130828
547 Ga0070700_100588384
548 Ga0070700_101076934
549 Ga0070708_102060082
550 Ga0070663_100014786
551 Ga0070663_100504478
552 Ga0070663_100504878
553 Ga0070663_101819739
554 Ga0070678_101502375
555 Ga0070678_101626901
556 Ga0070678_102396989
557 Ga0070662_100270562
558 Ga0070662_100526819
559 Ga0070662_101768229
560 Ga0070681_10277890
561 Ga0070681_10663643
562 Ga0070681_11795397
563 Ga0070681_12011660
564 Ga0068867_100167700
565 Ga0068867_100629472
566 Ga0070706_100205478
567 Ga0070707_101076063
568 Ga0070707_102248018
569 Ga0070698_100217521
570 Ga0070698_101088077
571 Ga0070699_100670320
572 Ga0070679_100738651
573 Ga0070679_101117255
574 Ga0070684_100000085
575 Ga0070684_100330977
576 Ga0070672_100173632
577 Ga0070672_101427085
578 Ga0070686_100018665
579 Ga0070686_100142460
580 Ga0070695_100035034
581 Ga0070695_100873687
582 Ga0070695_101141198
583 Ga0070696_100137100
584 Ga0070696_101977376
585 Ga0070693_100001263
586 Ga0070693_100651719
587 Ga0070665_100395347
588 Ga0070704_100226469
589 Ga0070704_102109784
590 Ga0068855_100398879
591 Ga0068855_101623922
592 Ga0070664_100002158
593 Ga0068857_100055529
594 Ga0068854_100121385
595 Ga0068854_100692879
596 Ga0070702_100631094
597 Ga0070702_101586613
598 Ga0068852_100759618
599 Ga0068852_101217828
600 Ga0068859_100386827
601 Ga0068859_100607562
602 Ga0068864_100628624
603 Ga0068864_100685585
604 Ga0068861_101387918
605 Ga0068863_100290251
606 Ga0068863_100615553
607 Ga0068858_100145921
608 Ga0068860_101798096
609 Ga0068862_100022245
610 Ga0068862_100465883
611 Ga0068862_102038703
612 Ga0070717_10211780
613 Ga0075365_10010114
614 Ga0075367_10144474
615 Ga0075367_10515423
616 Ga0075428_100006271
617 Ga0075431_100610932
618 Ga0075433_10201931
619 Ga0075433_10412108
620 Ga0075434_100003671
621 Ga0075434_100210621
622 Ga0075434_100231840
623 Ga0075434_101012086
624 Ga0075429_100043011
625 Ga0075429_100059575
626 Ga0075429_100228459
627 Ga0068865_100865606
628 Ga0068865_101120455
629 Ga0068865_101650599
630 Ga0097620_100386807
631 Ga0097620_100607572
632 Ga0075435_100005831
633 Ga0075435_101210245
634 Ga0075435_101932961
635 Ga0105240_10408847
636 Ga0105240_10487084
637 Ga0105240_10933317
638 Ga0105240_11436073
639 Ga0111539_10000701
640 Ga0111539_10355188
641 Ga0111539_10435400
642 Ga0111539_10760873
643 Ga0111539_10826417
644 Ga0111539_11431427
645 Ga0111539_11826339
646 Ga0111539_11948554
647 Ga0111539_12783350
648 Ga0111539_12784096
649 Ga0111539_12938642
650 Ga0111539_13051078
651 Ga0105245_10352180
652 Ga0114129_10046832
653 Ga0114129_10063195
654 Ga0114129_10364507
655 Ga0105243_10023145
656 Ga0105243_11158081
657 Ga0105243_11327310
658 Ga0105243_12628415
659 Ga0105242_10017122
660 Ga0105248_10026378
661 Ga0105248_10181145
662 Ga0105248_10322467
663 Ga0105248_12597839
664 Ga0105249_10000459
665 Ga0105249_10233373
666 Ga0105249_10389049
667 Ga0105249_10860820
668 Ga0105239_10268332
669 Ga0105239_13397098
670 Ga0105246_10164267
671 Ga0105246_10565888
672 Ga0105246_11906439
673 Ga0157338_1071250
674 Ga0157373_10657101
675 Ga0157369_10329647
676 Ga0157374_10286347
677 Ga0157378_10789418
678 Ga0163162_12875233
679 Ga0157372_12379188
680 Ga0157375_10327227
681 Ga0163163_10155486
682 Ga0157380_10053147
683 Ga0157380_10080663
684 Ga0157380_10084427
685 Ga0157380_10306492
686 Ga0157380_10339039
687 Ga0157380_10655779
688 Ga0157380_11875137
689 Ga0157380_12632685
690 Ga0157380_13445166
691 Ga0182008_10230636
692 Ga0157377_10155916
693 Ga0157377_10382219
694 Ga0157377_10547217
695 Ga0157379_10369295
696 Ga0157379_12501180
697 Ga0157376_10308928
698 Ga0163161_10539607
699 Ga0163161_11380926
700 Ga0206353_10708883
701 Ga0206353_11787877
702 Ga0207697_10018537
703 Ga0207697_10298614
704 Ga0207682_10069863
705 Ga0207682_10219138
706 Ga0207682_10637380
707 Ga0207642_10222386
708 Ga0207642_10862876
709 Ga0207688_10117650
710 Ga0207680_10045401
711 Ga0207680_10877154
712 Ga0207647_10031897
713 Ga0207699_10524955
714 Ga0207645_10060846
715 Ga0207645_10215480
716 Ga0207645_10770589
717 Ga0207643_10186819
718 Ga0207705_10825728
719 Ga0207705_11320239
720 Ga0207707_10113580
721 Ga0207695_10358778
722 Ga0207695_10869811
723 Ga0207695_11133987
724 Ga0207660_11644021
725 Ga0207662_10012774
726 Ga0207657_10125060
727 Ga0207657_10376383
728 Ga0207649_11011740
729 Ga0207649_11041267
730 Ga0207652_10275695
731 Ga0207652_10604896
732 Ga0207646_11727832
733 Ga0207681_10014521
734 Ga0207681_10099176
735 Ga0207681_10154634
736 Ga0207681_10661040
737 Ga0207681_11600961
738 Ga0207650_10009155
739 Ga0207650_10018581
740 Ga0207650_10368540
741 Ga0207650_10962187
742 Ga0207659_10239222
743 Ga0207659_10421875
744 Ga0207659_10722224
745 Ga0207687_10082580
746 Ga0207644_10030923
747 Ga0207644_10497656
748 Ga0207690_10027177
749 Ga0207690_10146903
750 Ga0207690_11431739
751 Ga0207690_11833017
752 Ga0207706_10106365
753 Ga0207686_10056249
754 Ga0207669_10083207
755 Ga0207669_10148631
756 Ga0207669_10302646
757 Ga0207669_10623117
758 Ga0207691_10109567
759 Ga0207711_10066039
760 Ga0207711_10307040
761 Ga0207711_10749508
762 Ga0207711_11483169
763 Ga0207689_10244402
764 Ga0207689_11206003
765 Ga0207661_10057569
766 Ga0207661_10104828
767 Ga0207679_10003405
768 Ga0207679_10871818
769 Ga0207667_11290253
770 Ga0207651_10004572
771 Ga0207712_10004264
772 Ga0207712_10283020
773 Ga0207640_10282366
774 Ga0207658_10091516
775 Ga0207658_10134095
776 Ga0207677_10126010
777 Ga0207703_10200976
778 Ga0207678_10016600
779 Ga0207678_10505336
780 Ga0207708_10005583
781 Ga0207708_10070876
782 Ga0207708_11424569
783 Ga0207641_10425038
784 Ga0207641_10941638
785 Ga0207648_10101670
786 Ga0207648_10368934
787 Ga0207676_10717829
788 Ga0207676_11413629
789 Ga0207675_100080529
790 Ga0207675_100242140
791 Ga0207683_10419605
792 Ga0207683_10445676
793 Ga0207698_11690020
794 Ga0207698_11968311
795 Ga0209971_1096592
796 Ga0207428_10332026
797 Ga0207428_10399630
798 Ga0207428_10421576
799 Ga0207428_10517292
800 Ga0268266_10439919
801 Ga0268265_10015546
802 Ga0268265_10231457
803 Ga0268265_11746757
804 Ga0268264_10198158
805 Ga0268264_11124685
806 Ga0307408_100145878
807 Ga0307408_100674843
808 Ga0307408_102096606
809 Ga0307405_10894758
810 Ga0307413_10887866
811 Ga0307407_11581557
812 Ga0307412_10564575
813 Ga0307409_100243821
814 Ga0307409_102848093
815 Ga0307416_100082426
816 Ga0307416_100555365
817 Ga0307416_100744466
818 Ga0307415_101520904
819 Ga0373959_0134182
820 Ga0373928_0030096
821 Ga0373940_0051075
822 Ga0373941_0165744
823 Ga0373946_0063652
824 Ga0373924_0241669
825 Ga0373931_0660878
826 Ga0373935_0131066
827 Ga0373927_0938157
828 Ga0373947_0039981
829 Ga0373937_0104145
830 Ga0373937_0532756
831 Ga0373925_0050639
832 Ga0395900_0244464
833 Ga0395905_0830237
834 Ga0395901_1489901
835 Ga0439461_0142153
836 Ga0451800_0467326
837 Ga0451804_0093419
838 Ga0451807_1794984
839 Ga0451853_0169319
840 Ga0451853_1155304
841 Ga0451853_2147937
842 Ga0451853_3080467
843 Ga0451853_3395287
844 Ga0439433_0031621
845 Ga0439442_051495
846 Ga0439443_021283
847 Ga0439445_0063210
848 Ga0450921_038251
849 Ga0450898_107451
850 Ga0439434_0015516
851 Ga0439435_0004608
852 Ga0439444_0045468
853 Ga0450916_014828
854 Ga0451577_0032427
855 Ga0453684_0387841
856 Ga0466967_0116354
857 Ga0495629_0162373
858 Ga0495641_0595302
859 Ga0495608_0714627
860 Ga0495598_0161122
861 Ga0495667_0237361
862 Ga0495588_0633571
863 Ga0495647_0528029
864 Ga0495658_0300019
865 Ga0495674_0216209
866 Ga0495680_0503587
867 Ga0495680_1100216
868 Ga0496100_1150486
869 Ga0496101_1199280
870 Ga0496102_1157848
871 Ga0496103_0464003
872 Ga0496103_0961762
873 Ga0496104_0003418
874 Ga0496104_0066493
875 Ga0496105_0067756
876 Ga0496106_0336603
877 Ga0496106_1381275
878 Ga0496107_0926978
879 Ga0496108_0000873
880 Ga0496108_0688618
881 Ga0496109_0003131
882 Ga0496109_1236822
883 Ga0496110_0000667
884 Ga0496110_0237881
885 Ga0496112_0000360
886 Ga0496112_0083418
887 Ga0496112_0104596
888 Ga0496112_0435110
889 Ga0496112_1853046
890 Ga0496113_0064846
891 Ga0496113_0989382
892 Ga0496113_1134583
893 Ga0501034_0016627
894 Ga0501040_1199733
895 Ga0501041_0135464
896 Ga0501041_0685912
897 Ga0501048_0282619
898 Ga0501067_0248753
899 Ga0501069_0158914
900 Ga0501070_1322686
901 Ga0501071_0247118
902 Ga0501072_0481141
903 Ga0501074_0260199
904 Ga0501074_0725638
905 Ga0501075_0840863
906 Ga0501076_0132886
907 Ga0501076_0731712
908 Ga0501249_180833
909 Ga0501079_0262108
910 Ga0501079_0551248
911 Ga0501081_0446071
912 Ga0501081_0680714
913 Ga0501083_0566593
914 Ga0501035_1258121
915 Ga0501035_1554975
916 Ga0501045_0166451
917 Ga0501045_0563815
918 Ga0501212_096181
919 nmdc:mga00v17_582085_c1
920 nmdc:mga0yw44_75803_c1
921 nmdc:mga05p37_116159_c1
922 nmdc:mga05p37_286106_c1
923 nmdc:mga05p37_46856_c1
924 nmdc:mga09592_1019623_c1
925 nmdc:mga09592_20112_c1
926 nmdc:mga09592_26060_c1
927 nmdc:mga09592_383109_c1
928 nmdc:mga09592_388924_c1
929 nmdc:mga06r32_1528677_c1
930 nmdc:mga06r32_2081262_c1
931 nmdc:mga06r32_31991_c1
932 nmdc:mga08y16_10511_c1
933 nmdc:mga08y16_119072_c1
934 nmdc:mga08y16_1390747_c1
935 nmdc:mga08y16_1564575_c1
936 nmdc:mga08y16_169552_c1
937 nmdc:mga08y16_201544_c1
938 nmdc:mga08y16_336951_c1
939 nmdc:mga08y16_578907_c1
940 nmdc:mga08y16_730161_c1
941 nmdc:mga0n895_1094031_c1
942 nmdc:mga0n895_220407_c1
943 nmdc:mga0n895_272470_c1
944 nmdc:mga0n895_3514_c1
945 nmdc:mga0n895_519002_c1
946 nmdc:mga0rr50_1653665_c1
947 nmdc:mga0rr50_201498_c1
948 nmdc:mga0a205_237825_c1
949 nmdc:mga0a205_500212_c1
950 nmdc:mga0a205_77706_c1
951 Ga0495601_0836426
952 Ga0495595_0273795
953 Ga0500555_138505
954 Ga0500628_257085
955 Ga0501084_0459109
956 Ga0501084_1814685
957 Ga0590071_031577
958 Ga0501082_0484779
959 Ga0530510_0417814
960 Ga0530510_0458620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02954

HTH_8

Bacterial regulatory protein, Fis family

29

70

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e7l-assembly2.cif.gz_D crystal structure of sigma54 activator ntrc4's dna binding domain 0.9585 18 66
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9407 41 64
4i98-assembly1.cif.gz_B crystal structure of the complex between scpa(residues 1-160)-scpb(residues 1-183) 0.9374 41 62
4l5e-assembly1.cif.gz_A-2 crystal structure of a. aeolicus ntrc1 dna binding domain 0.9351 24 65
2esn-assembly1.cif.gz_C the crystal structure of probable transcriptional regulator pa0477 from pseudomonas aeruginosa 0.934 26 64
ID Description Score Start End Superfamily
af_Q58520_10_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9985 30 63 1.10.10.10
3e7lD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9585 18 66 1.10.10.60
af_Q2G0C6_1_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9583 27 63 1.10.10.10
2h6bA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9563 41 61 1.10.10.10
3e7lC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9547 18 66 1.10.10.60
ID Description Score Start End GO Terms
AF-G5QM19-F1-model_v4 Putative regulatory protein 1.002 18 66 GO:0043565
AF-A0A2D5ETA0-F1-model_v4 Sigma-54 factor interaction domain-containing protein 1.002 17 63 GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A661P0H8-F1-model_v4 Nitrogen fixation protein NifA 1.002 17 66 GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A2D4SRD0-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9936 18 67 GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A534Q4T7-F1-model_v4 AAA family ATPase 0.9934 17 67 GO:0043565

Map