F452145

General Info

Members Datasets Scaffolds Average Seq Length
480 252 960 220

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1004416|JGI24736J21556_10044163
Length 221
Sequence MRRIVGATFVSLDGVMQGPGGPTEDPTNGFKFSGWLPPVGDDAIDRKIGELFGRPFDLLLGRRTYEIFAAYWPYASDQMAGIRDPFNSCTKYVVTHRDQPLAWENSKRVGDIEDLREIKQGDGPEIIIQGSSTLYPQLLEAGLLDELTLMISPIVLGKGKRQFGDGTPPKTLKMTEHYVSDGGNIVATFQPAGPVEIGTYVTEPPSEREKVRQAEMAEGHW

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
248 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
249 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
250 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
251 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.79
Nodule 0
Rhizoplane 0.21
Rhizosphere 94.58
Stem 0
Stem Tuber 0.21
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004416 3300001904 Bacteria 2402
2 JGI24740J21852_10019081 3300001979 Bacteria 2421
3 JGI24739J22299_10000785 3300001989 Bacteria 11588
4 JGI24737J22298_10000076 3300001990 Bacteria 29110
5 JGI24735J21928_10008713 3300002067 Bacteria 3275
6 JGI24738J21930_10000015 3300002075 Bacteria 33032
7 JGI24742J22300_10002226 3300002244 Bacteria 3094
8 JGI24751J29686_10052880 3300002459 Bacteria 837
9 rootH1_10122915 3300003323 Bacteria 1137
10 Ga0055530_10000049 3300003791 Bacteria 107051
11 Ga0055530_10000073 3300003791 Bacteria 85352
12 Ga0055531_10000017 3300003794 Bacteria 177036
13 JGI25405J52794_10016060 3300003911 Bacteria 1475
14 Ga0070658_10014808 3300005327 Bacteria 6249
15 Ga0070658_10078315 3300005327 Bacteria 2713
16 Ga0070676_10076294 3300005328 Bacteria 2023
17 Ga0070676_10086203 3300005328 Bacteria 1915
18 Ga0070683_100448535 3300005329 Bacteria 1231
19 Ga0070690_100010898 3300005330 Bacteria 5304
20 Ga0070677_10028862 3300005333 Bacteria 2099
21 Ga0068869_100000193 3300005334 Bacteria 31528
22 Ga0068869_100115171 3300005334 Bacteria 2050
23 Ga0070680_100019069 3300005336 Bacteria 5430
24 Ga0070680_100222874 3300005336 Bacteria 1592
25 Ga0070682_100156491 3300005337 Bacteria 1569
26 Ga0070682_100295078 3300005337 Bacteria 1187
27 Ga0068868_100006091 3300005338 Bacteria 8517
28 Ga0068868_100122406 3300005338 Bacteria 2123
29 Ga0070660_100001378 3300005339 Bacteria 16502
30 Ga0070660_100029364 3300005339 Bacteria 4120
31 Ga0070660_100047061 3300005339 Bacteria 3308
32 Ga0070689_100011417 3300005340 Bacteria 6362
33 Ga0070661_100017253 3300005344 Bacteria 5119
34 Ga0070661_100033999 3300005344 Bacteria 3696
35 Ga0070661_100376269 3300005344 Bacteria 1119
36 Ga0070692_10006718 3300005345 Bacteria 5014
37 Ga0070668_100019614 3300005347 Bacteria 5090
38 Ga0070668_100031616 3300005347 Bacteria 4027
39 Ga0070669_100000586 3300005353 Bacteria 27126
40 Ga0070669_100018539 3300005353 Bacteria 4972
41 Ga0070675_100030843 3300005354 Bacteria 4330
42 Ga0070671_100003627 3300005355 Bacteria 12081
43 Ga0070671_100146306 3300005355 Bacteria 1994
44 Ga0070671_100259992 3300005355 Bacteria 1475
45 Ga0070674_100001176 3300005356 Bacteria 13759
46 Ga0070673_100013079 3300005364 Bacteria 5726
47 Ga0070673_100148025 3300005364 Bacteria 1986
48 Ga0070673_100165000 3300005364 Bacteria 1886
49 Ga0070659_100004304 3300005366 Bacteria 10163
50 Ga0070659_100010984 3300005366 Bacteria 6687
51 Ga0070659_100016304 3300005366 Bacteria 5577
52 Ga0070659_100029813 3300005366 Bacteria 4218
53 Ga0070667_100003196 3300005367 Bacteria 14038
54 Ga0070667_100229262 3300005367 Bacteria 1656
55 Ga0070667_101074383 3300005367 Unclassified 752
56 Ga0070714_100364899 3300005435 Bacteria 1358
57 Ga0070713_100154916 3300005436 Bacteria 2042
58 Ga0070711_100006313 3300005439 Bacteria 7135
59 Ga0070694_100017169 3300005444 Bacteria 4569
60 Ga0070678_100019654 3300005456 Bacteria 4412
61 Ga0070678_100214994 3300005456 Bacteria 1595
62 Ga0070662_100003645 3300005457 Bacteria 9614
63 Ga0070662_100012424 3300005457 Bacteria 5648
64 Ga0070681_10003859 3300005458 Bacteria 14106
65 Ga0070681_10115276 3300005458 Bacteria 2625
66 Ga0070681_10328129 3300005458 Bacteria 1440
67 Ga0068867_100001734 3300005459 Bacteria 15196
68 Ga0068867_100006111 3300005459 Bacteria 8523
69 Ga0068867_100075665 3300005459 Bacteria 2526
70 Ga0070706_100107637 3300005467 Bacteria 2593
71 Ga0070707_100018944 3300005468 Bacteria 6482
72 Ga0070707_100116805 3300005468 Bacteria 2589
73 Ga0070698_100062720 3300005471 Bacteria 3749
74 Ga0070698_100703284 3300005471 Bacteria 953
75 Ga0070699_100045501 3300005518 Bacteria 3798
76 Ga0070679_100055910 3300005530 Bacteria 3931
77 Ga0068853_100005597 3300005539 Bacteria 9867
78 Ga0068853_100014861 3300005539 Bacteria 6392
79 Ga0068853_100072655 3300005539 Bacteria 2998
80 Ga0068853_100072689 3300005539 Bacteria 2997
81 Ga0068853_100091713 3300005539 Bacteria 2672
82 Ga0068853_100150094 3300005539 Bacteria 2097
83 Ga0068853_100550319 3300005539 Bacteria 1093
84 Ga0070672_100001067 3300005543 Bacteria 16705
85 Ga0070672_100268594 3300005543 Bacteria 1440
86 Ga0070695_100297520 3300005545 Bacteria 1192
87 Ga0070696_100007242 3300005546 Bacteria 7408
88 Ga0070696_100070740 3300005546 Bacteria 2455
89 Ga0070665_100009353 3300005548 Bacteria 9917
90 Ga0068855_100002788 3300005563 Bacteria 21511
91 Ga0068855_100030767 3300005563 Bacteria 6418
92 Ga0068855_100034017 3300005563 Bacteria 6079
93 Ga0068855_100372360 3300005563 Bacteria 1570
94 Ga0070664_100027379 3300005564 Bacteria 4737
95 Ga0070664_100039530 3300005564 Bacteria 3975
96 Ga0070664_100708555 3300005564 Bacteria 938
97 Ga0070664_101049799 3300005564 Bacteria 767
98 Ga0068857_100000338 3300005577 Bacteria 32330
99 Ga0068854_100001900 3300005578 Bacteria 12728
100 Ga0068854_100007395 3300005578 Bacteria 7016
101 Ga0068854_100012472 3300005578 Bacteria 5567
102 Ga0068854_100047880 3300005578 Bacteria 3048
103 Ga0068856_100177864 3300005614 Bacteria 2140
104 Ga0068856_100341771 3300005614 Bacteria 1515
105 Ga0070702_100201417 3300005615 Bacteria 1318
106 Ga0068852_100001883 3300005616 Bacteria 14288
107 Ga0068852_100030978 3300005616 Bacteria 4408
108 Ga0068852_100105184 3300005616 Bacteria 2556
109 Ga0068859_100006502 3300005617 Bacteria 11862
110 Ga0068859_100104895 3300005617 Bacteria 2886
111 Ga0068859_100133465 3300005617 Bacteria 2555
112 Ga0068859_100640056 3300005617 Bacteria 1155
113 Ga0068864_100000247 3300005618 Bacteria 48323
114 Ga0068866_10220438 3300005718 Bacteria 1144
115 Ga0068861_100034796 3300005719 Bacteria 3726
116 Ga0068861_100120477 3300005719 Bacteria 2116
117 Ga0068861_100189413 3300005719 Bacteria 1718
118 Ga0068870_10023775 3300005840 Bacteria 3026
119 Ga0068863_100038901 3300005841 Bacteria 4526
120 Ga0068858_100001094 3300005842 Bacteria 28064
121 Ga0068858_100029259 3300005842 Bacteria 5115
122 Ga0068858_100785027 3300005842 Bacteria 929
123 Ga0068860_100003357 3300005843 Bacteria 16477
124 Ga0068860_100030624 3300005843 Bacteria 5174
125 Ga0068860_100033479 3300005843 Bacteria 4930
126 Ga0068860_100111415 3300005843 Bacteria 2616
127 Ga0068860_100132811 3300005843 Bacteria 2390
128 Ga0068862_100001250 3300005844 Bacteria 23893
129 Ga0068862_100044559 3300005844 Bacteria 3785
130 Ga0068862_100077449 3300005844 Bacteria 2879
131 Ga0081455_10005703 3300005937 Bacteria 13583
132 Ga0081538_10077496 3300005981 Bacteria 1790
133 Ga0075365_10044861 3300006038 Bacteria 2898
134 Ga0075364_10029453 3300006051 Bacteria 3521
135 Ga0070712_100000337 3300006175 Bacteria 26630
136 Ga0075362_10069452 3300006177 Bacteria 1606
137 Ga0075367_10000860 3300006178 Bacteria 12124
138 Ga0075367_10067690 3300006178 Bacteria 2141
139 Ga0075366_10000191 3300006195 Bacteria 26957
140 Ga0075366_10103768 3300006195 Bacteria 1708
141 Ga0097621_100006503 3300006237 Bacteria 8302
142 Ga0097621_100206899 3300006237 Bacteria 1705
143 Ga0068871_100026894 3300006358 Bacteria 4494
144 Ga0068871_100060854 3300006358 Bacteria 3081
145 Ga0068871_100209306 3300006358 Bacteria 1686
146 Ga0075428_100003092 3300006844 Bacteria 18157
147 Ga0075428_100176244 3300006844 Bacteria 2315
148 Ga0075428_100186609 3300006844 Bacteria 2243
149 Ga0075430_100007253 3300006846 Bacteria 9361
150 Ga0075431_100004942 3300006847 Bacteria 13125
151 Ga0075431_100022109 3300006847 Bacteria 6504
152 Ga0075433_10038868 3300006852 Bacteria 4112
153 Ga0075433_10172470 3300006852 Bacteria 1925
154 Ga0075433_10372705 3300006852 Bacteria 1261
155 Ga0075434_100398965 3300006871 Bacteria 1396
156 Ga0075429_100026894 3300006880 Bacteria 4994
157 Ga0075429_100108205 3300006880 Bacteria 2429
158 Ga0075429_100111259 3300006880 Bacteria 2394
159 Ga0068865_100004687 3300006881 Bacteria 8258
160 Ga0068865_100110720 3300006881 Bacteria 2025
161 Ga0097620_100006502 3300006931 Bacteria 11862
162 Ga0097620_100058999 3300006931 Bacteria 3866
163 Ga0097620_100104886 3300006931 Bacteria 2886
164 Ga0097620_100133464 3300006931 Bacteria 2555
165 Ga0097620_100640075 3300006931 Bacteria 1155
166 Ga0075435_100526455 3300007076 Bacteria 1023
167 Ga0105240_10032399 3300009093 Bacteria 6766
168 Ga0105240_10064276 3300009093 Bacteria 4560
169 Ga0111539_10000076 3300009094 Bacteria 98052
170 Ga0111539_10329625 3300009094 Bacteria 1777
171 Ga0105245_10000128 3300009098 Bacteria 72249
172 Ga0105245_10087966 3300009098 Bacteria 2852
173 Ga0105245_10943589 3300009098 Bacteria 905
174 Ga0114129_10171659 3300009147 Bacteria 2956
175 Ga0114129_10188547 3300009147 Bacteria 2802
176 Ga0114129_10373589 3300009147 Bacteria 1884
177 Ga0105243_10018896 3300009148 Bacteria 5225
178 Ga0105243_10394911 3300009148 Bacteria 1283
179 Ga0105242_10037857 3300009176 Bacteria 3877
180 Ga0105248_10000787 3300009177 Bacteria 35583
181 Ga0105248_10034069 3300009177 Bacteria 5692
182 Ga0105248_10099206 3300009177 Bacteria 3282
183 Ga0105248_11326494 3300009177 Bacteria 814
184 Ga0105238_10032221 3300009551 Bacteria 5334
185 Ga0105238_10052960 3300009551 Bacteria 4079
186 Ga0105249_11086565 3300009553 Bacteria 870
187 Ga0105246_10080927 3300011119 Bacteria 2314
188 Ga0105246_10237896 3300011119 Bacteria 1438
189 Ga0157341_1010956 3300012494 Bacteria 778
190 Ga0157373_10001744 3300013100 Bacteria 16546
191 Ga0157373_10016222 3300013100 Bacteria 5436
192 Ga0157373_10089590 3300013100 Bacteria 2167
193 Ga0157373_10116778 3300013100 Bacteria 1875
194 Ga0157371_10000850 3300013102 Bacteria 34892
195 Ga0157371_10056815 3300013102 Bacteria 2776
196 Ga0157371_10108891 3300013102 Bacteria 1966
197 Ga0157370_10066542 3300013104 Bacteria 3407
198 Ga0157370_10104259 3300013104 Bacteria 2654
199 Ga0157369_10002034 3300013105 Bacteria 24368
200 Ga0157369_10260191 3300013105 Bacteria 1810
201 Ga0157369_10769911 3300013105 Bacteria 990
202 Ga0157374_10020944 3300013296 Bacteria 5809
203 Ga0157378_10000396 3300013297 Bacteria 42907
204 Ga0157378_10002179 3300013297 Bacteria 17362
205 Ga0163162_10005800 3300013306 Bacteria 11950
206 Ga0163162_10666497 3300013306 Bacteria 1163
207 Ga0157372_10002766 3300013307 Bacteria 18963
208 Ga0157372_10133979 3300013307 Bacteria 2852
209 Ga0157372_10190148 3300013307 Bacteria 2378
210 Ga0157375_10095391 3300013308 Bacteria 3045
211 Ga0157375_10548295 3300013308 Bacteria 1318
212 Ga0163163_10000163 3300014325 Bacteria 69522
213 Ga0163163_10013271 3300014325 Bacteria 7536
214 Ga0163163_10020639 3300014325 Bacteria 6208
215 Ga0157380_10025062 3300014326 Bacteria 4521
216 Ga0157379_10002601 3300014968 Bacteria 15167
217 Ga0157379_10034259 3300014968 Bacteria 4526
218 Ga0157376_10242862 3300014969 Bacteria 1678
219 Ga0207673_1004440 3300025290 Bacteria 1678
220 Ga0207697_10000461 3300025315 Bacteria 22887
221 Ga0207697_10005921 3300025315 Bacteria 5609
222 Ga0207697_10073056 3300025315 Bacteria 1439
223 Ga0207656_10276501 3300025321 Bacteria 827
224 Ga0207642_10051702 3300025899 Bacteria 1860
225 Ga0207642_10095942 3300025899 Bacteria 1477
226 Ga0207688_10000063 3300025901 Bacteria 38711
227 Ga0207680_10076462 3300025903 Bacteria 2091
228 Ga0207680_10134027 3300025903 Bacteria 1635
229 Ga0207647_10000227 3300025904 Bacteria 46631
230 Ga0207647_10003088 3300025904 Bacteria 12521
231 Ga0207699_10171273 3300025906 Bacteria 1453
232 Ga0207699_10185505 3300025906 Bacteria 1401
233 Ga0207645_10016035 3300025907 Bacteria 4964
234 Ga0207645_10018000 3300025907 Bacteria 4659
235 Ga0207645_10087121 3300025907 Bacteria 2006
236 Ga0207643_10069472 3300025908 Bacteria 2025
237 Ga0207705_10010820 3300025909 Bacteria 6625
238 Ga0207705_10014415 3300025909 Bacteria 5690
239 Ga0207705_10019346 3300025909 Bacteria 4870
240 Ga0207684_10749006 3300025910 Bacteria 828
241 Ga0207695_10028155 3300025913 Bacteria 6239
242 Ga0207671_10106463 3300025914 Bacteria 2129
243 Ga0207693_10000270 3300025915 Bacteria 47905
244 Ga0207663_10004818 3300025916 Bacteria 6744
245 Ga0207660_10139370 3300025917 Bacteria 1853
246 Ga0207660_10182400 3300025917 Bacteria 1631
247 Ga0207657_10002137 3300025919 Bacteria 21415
248 Ga0207657_10027012 3300025919 Bacteria 5262
249 Ga0207657_10049375 3300025919 Bacteria 3667
250 Ga0207649_10003288 3300025920 Bacteria 8848
251 Ga0207649_10168137 3300025920 Bacteria 1525
252 Ga0207646_10040122 3300025922 Bacteria 4211
253 Ga0207646_10158661 3300025922 Bacteria 2041
254 Ga0207681_10001851 3300025923 Bacteria 13554
255 Ga0207681_10165435 3300025923 Bacteria 1672
256 Ga0207694_10012198 3300025924 Bacteria 6482
257 Ga0207694_10023343 3300025924 Bacteria 4695
258 Ga0207659_10140841 3300025926 Bacteria 1872
259 Ga0207659_10316293 3300025926 Bacteria 1287
260 Ga0207687_10702540 3300025927 Bacteria 858
261 Ga0207644_10023258 3300025931 Bacteria 4242
262 Ga0207644_10054891 3300025931 Bacteria 2870
263 Ga0207690_10007462 3300025932 Bacteria 6489
264 Ga0207690_10009691 3300025932 Bacteria 5720
265 Ga0207690_10361940 3300025932 Bacteria 1149
266 Ga0207706_10000648 3300025933 Bacteria 36742
267 Ga0207706_10014378 3300025933 Bacteria 7173
268 Ga0207706_10167431 3300025933 Bacteria 1931
269 Ga0207706_10769095 3300025933 Bacteria 820
270 Ga0207686_10016186 3300025934 Bacteria 4181
271 Ga0207709_10143159 3300025935 Bacteria 1646
272 Ga0207709_10258232 3300025935 Bacteria 1276
273 Ga0207670_10051273 3300025936 Bacteria 2770
274 Ga0207691_10000447 3300025940 Bacteria 40805
275 Ga0207711_10001621 3300025941 Bacteria 20768
276 Ga0207711_10008671 3300025941 Bacteria 8506
277 Ga0207711_10224154 3300025941 Bacteria 1720
278 Ga0207711_11043265 3300025941 Bacteria 758
279 Ga0207689_10001047 3300025942 Bacteria 26563
280 Ga0207689_10023218 3300025942 Bacteria 5207
281 Ga0207661_10295846 3300025944 Bacteria 1450
282 Ga0207679_10010663 3300025945 Bacteria 5925
283 Ga0207679_10020821 3300025945 Bacteria 4434
284 Ga0207651_10034860 3300025960 Bacteria 3264
285 Ga0207651_10084039 3300025960 Bacteria 2304
286 Ga0207651_10870828 3300025960 Bacteria 801
287 Ga0207712_10489987 3300025961 Bacteria 1049
288 Ga0207668_10001078 3300025972 Bacteria 16262
289 Ga0207668_10077632 3300025972 Bacteria 2395
290 Ga0207640_10000450 3300025981 Bacteria 25025
291 Ga0207640_10005399 3300025981 Bacteria 6968
292 Ga0207640_10006261 3300025981 Bacteria 6525
293 Ga0207640_10290273 3300025981 Bacteria 1289
294 Ga0207658_10005642 3300025986 Bacteria 8564
295 Ga0207658_10094823 3300025986 Bacteria 2323
296 Ga0207658_10529366 3300025986 Bacteria 1052
297 Ga0207658_10840882 3300025986 Bacteria 834
298 Ga0207677_10000532 3300026023 Bacteria 24064
299 Ga0207703_10010957 3300026035 Bacteria 7066
300 Ga0207703_10091171 3300026035 Bacteria 2563
301 Ga0207639_10000289 3300026041 Bacteria 35884
302 Ga0207639_10015419 3300026041 Bacteria 5393
303 Ga0207639_10105199 3300026041 Bacteria 2289
304 Ga0207639_10142978 3300026041 Bacteria 1995
305 Ga0207639_10306469 3300026041 Bacteria 1406
306 Ga0207678_10005936 3300026067 Bacteria 10877
307 Ga0207678_10201842 3300026067 Bacteria 1700
308 Ga0207702_10150291 3300026078 Bacteria 2118
309 Ga0207702_10379027 3300026078 Bacteria 1360
310 Ga0207641_10002559 3300026088 Bacteria 16736
311 Ga0207641_10012445 3300026088 Bacteria 6975
312 Ga0207641_10030293 3300026088 Bacteria 4482
313 Ga0207648_10000876 3300026089 Bacteria 33914
314 Ga0207648_10001177 3300026089 Bacteria 29264
315 Ga0207648_10220771 3300026089 Bacteria 1684
316 Ga0207676_10000220 3300026095 Bacteria 49329
317 Ga0207674_10001201 3300026116 Bacteria 33701
318 Ga0207674_10076557 3300026116 Bacteria 3353
319 Ga0207674_10523153 3300026116 Bacteria 1146
320 Ga0207675_100056177 3300026118 Bacteria 3671
321 Ga0207675_100082757 3300026118 Bacteria 3010
322 Ga0207675_100143187 3300026118 Bacteria 2272
323 Ga0207683_10025476 3300026121 Bacteria 5103
324 Ga0207698_10024898 3300026142 Bacteria 4206
325 Ga0207698_10125273 3300026142 Bacteria 2183
326 Ga0207698_10225955 3300026142 Bacteria 1695
327 Ga0209971_1029498 3300027682 Bacteria 1314
328 Ga0209974_10045163 3300027876 Bacteria 1470
329 Ga0207428_10000660 3300027907 Bacteria 40431
330 Ga0207428_10085002 3300027907 Bacteria 2465
331 Ga0268266_10303890 3300028379 Bacteria 1489
332 Ga0268265_10002320 3300028380 Bacteria 14466
333 Ga0268265_10055792 3300028380 Bacteria 3003
334 Ga0268265_10086452 3300028380 Bacteria 2492
335 Ga0268265_10352448 3300028380 Bacteria 1344
336 Ga0268265_10731014 3300028380 Bacteria 959
337 Ga0268264_10022858 3300028381 Bacteria 5101
338 Ga0268264_10031388 3300028381 Bacteria 4356
339 Ga0268264_10212060 3300028381 Bacteria 1778
340 Ga0265331_10025383 3300031250 Bacteria 2992
341 Ga0265327_10000044 3300031251 Bacteria 284808
342 Ga0307408_100019242 3300031548 Bacteria 4595
343 Ga0307408_100180620 3300031548 Bacteria 1692
344 Ga0307408_100265664 3300031548 Bacteria 1422
345 Ga0307405_10016845 3300031731 Bacteria 3995
346 Ga0307405_10026154 3300031731 Bacteria 3363
347 Ga0307405_10130169 3300031731 Bacteria 1737
348 Ga0307405_10147086 3300031731 Bacteria 1652
349 Ga0307413_10064708 3300031824 Bacteria 2273
350 Ga0307413_10082711 3300031824 Bacteria 2063
351 Ga0307413_10292486 3300031824 Bacteria 1231
352 Ga0307410_10010947 3300031852 Bacteria 5164
353 Ga0307410_10015534 3300031852 Bacteria 4519
354 Ga0307410_10033929 3300031852 Bacteria 3299
355 Ga0307410_10038729 3300031852 Bacteria 3125
356 Ga0307406_10081836 3300031901 Bacteria 2148
357 Ga0307407_10009646 3300031903 Bacteria 4507
358 Ga0307407_10048900 3300031903 Bacteria 2410
359 Ga0307407_10068336 3300031903 Bacteria 2104
360 Ga0307412_10011889 3300031911 Bacteria 5055
361 Ga0307412_10079822 3300031911 Bacteria 2258
362 Ga0307412_10415249 3300031911 Bacteria 1099
363 Ga0307412_10631243 3300031911 Bacteria 911
364 Ga0307409_100006895 3300031995 Bacteria 6734
365 Ga0307409_100026811 3300031995 Bacteria 4071
366 Ga0307409_100928859 3300031995 Bacteria 885
367 Ga0307416_100002230 3300032002 Bacteria 11029
368 Ga0307416_100031584 3300032002 Bacteria 3989
369 Ga0307416_100087745 3300032002 Bacteria 2657
370 Ga0307416_100093478 3300032002 Bacteria 2590
371 Ga0307416_100126312 3300032002 Bacteria 2291
372 Ga0307414_10124204 3300032004 Bacteria 1990
373 Ga0307414_10736893 3300032004 Bacteria 895
374 Ga0307411_10009745 3300032005 Bacteria 5075
375 Ga0307411_10019050 3300032005 Bacteria 3953
376 Ga0307411_10069213 3300032005 Bacteria 2382
377 Ga0307411_10122168 3300032005 Bacteria 1887
378 Ga0307411_10178578 3300032005 Bacteria 1609
379 Ga0307411_10285133 3300032005 Bacteria 1316
380 Ga0307411_10361826 3300032005 Bacteria 1187
381 Ga0307415_100013618 3300032126 Bacteria 4753
382 Ga0373944_0012808 3300035089 Bacteria 2317
383 Ga0373949_0108839 3300035090 Bacteria 767
384 Ga0373936_0018615 3300035113 Bacteria 2684
385 Ga0373945_0093214 3300035116 Bacteria 1169
386 Ga0373945_0114339 3300035116 Bacteria 1068
387 Ga0373954_0006304 3300035118 Bacteria 5169
388 Ga0373956_0018098 3300035119 Bacteria 2979
389 Ga0373943_0124221 3300035170 Bacteria 1374
390 Ga0373946_0006462 3300035171 Bacteria 4249
391 Ga0373924_0054045 3300035410 Bacteria 1669
392 Ga0373947_0263990 3300035725 Bacteria 1141
393 Ga0373937_0003573 3300036401 Bacteria 13106
394 Ga0373937_0004473 3300036401 Bacteria 11873
395 Ga0373925_0037290 3300037068 Bacteria 3588
396 Ga0395899_0166154 3300037312 Bacteria 1556
397 Ga0395900_0035979 3300037418 Bacteria 5102
398 Ga0395900_0810981 3300037418 Bacteria 863
399 Ga0395898_0008628 3300037466 Bacteria 10755
400 Ga0395898_0117381 3300037466 Bacteria 2549
401 Ga0395898_0384736 3300037466 Bacteria 1338
402 Ga0395905_0005494 3300037471 Bacteria 12929
403 Ga0395905_0088598 3300037471 Bacteria 2900
404 Ga0395905_0111198 3300037471 Bacteria 2573
405 Ga0395905_0321305 3300037471 Bacteria 1437
406 Ga0395905_0547408 3300037471 Bacteria 1058
407 Ga0395905_0720889 3300037471 Bacteria 899
408 Ga0395905_0736148 3300037471 Bacteria 888
409 Ga0395901_0003575 3300038443 Bacteria 15679
410 Ga0395901_0137934 3300038443 Bacteria 2563
411 Ga0395901_0951605 3300038443 Bacteria 837
412 Ga0242420_000878 3300038996 Bacteria 3725
413 Ga0451807_1907884 3300041486 Bacteria 3029
414 Ga0439464_0199758 3300042439 Bacteria 637
415 Ga0451577_0300099 3300042876 Bacteria 1455
416 Ga0453683_0028825 3300044673 Bacteria 3513
417 Ga0453683_0298208 3300044673 Bacteria 1031
418 Ga0453683_0301594 3300044673 Bacteria 1025
419 Ga0466966_0216582 3300044684 Bacteria 1157
420 Ga0466961_0141224 3300044693 Bacteria 1508
421 Ga0466963_0086197 3300044694 Bacteria 2133
422 Ga0466963_0205215 3300044694 Bacteria 1378
423 Ga0466957_0004260 3300044842 Bacteria 7931
424 Ga0451576_0442179 3300045051 Bacteria 1365
425 Ga0466967_0005342 3300045976 Bacteria 8877
426 Ga0466967_0097370 3300045976 Bacteria 2685
427 Ga0466967_0216341 3300045976 Bacteria 1819
428 Ga0466967_0468011 3300045976 Bacteria 1234
429 Ga0466967_0927280 3300045976 Bacteria 866
430 Ga0495580_0105929 3300046472 Bacteria 1953
431 Ga0495607_0301640 3300046501 Bacteria 754
432 Ga0495620_0002601 3300046515 Bacteria 10440
433 Ga0495644_0012123 3300046523 Bacteria 3314
434 Ga0495663_0161101 3300046525 Bacteria 770
435 Ga0495666_0104287 3300046526 Bacteria 1335
436 Ga0495586_0340268 3300046535 Bacteria 861
437 Ga0495656_0127017 3300046615 Bacteria 1210
438 Ga0495668_0484282 3300046616 Bacteria 682
439 Ga0495611_0268814 3300046648 Bacteria 789
440 Ga0495659_0095646 3300046664 Bacteria 1145
441 Ga0495647_0014191 3300046681 Bacteria 2773
442 Ga0495669_0106208 3300046684 Bacteria 1308
443 Ga0495671_0300857 3300046692 Bacteria 772
444 Ga0495636_0112950 3300047318 Bacteria 1197
445 Ga0501042_0253911 3300049578 Bacteria 1269
446 Ga0501070_0017033 3300049586 Bacteria 6099
447 Ga0501072_0412728 3300049588 Bacteria 1071
448 Ga0501074_0346296 3300049590 Bacteria 1055
449 Ga0501076_0877620 3300049592 Bacteria 740
450 Ga0501077_0408000 3300049593 Bacteria 869
451 Ga0501081_0060573 3300049743 Bacteria 2623
452 Ga0501083_0488061 3300049744 Bacteria 802
453 nmdc:mga03683_10286_c1 3300050489 Bacteria 3352
454 nmdc:mga00v17_24094_c1 3300050491 Bacteria 3526
455 nmdc:mga0yw44_16031_c1 3300050492 Bacteria 4036
456 nmdc:mga0k408_100161_c1 3300050493 Bacteria 1708
457 nmdc:mga0k408_1635_c1 3300050493 Bacteria 12117
458 nmdc:mga0k408_43349_c1 3300050493 Bacteria 2592
459 nmdc:mga06z11_4759_c1 3300050494 Bacteria 5368
460 nmdc:mga06z11_64334_c1 3300050494 Bacteria 1922
461 nmdc:mga07m45_32451_c1 3300050496 Bacteria 2896
462 nmdc:mga05p37_290767_c1 3300050507 Bacteria 1945
463 nmdc:mga05p37_307889_c1 3300050507 Bacteria 1879
464 nmdc:mga09592_1069905_c1 3300050508 Bacteria 672
465 nmdc:mga09592_61858_c1 3300050508 Bacteria 3167
466 nmdc:mga09592_69168_c1 3300050508 Bacteria 2995
467 nmdc:mga06r32_83857_c1 3300050510 Bacteria 3106
468 nmdc:mga08y16_23017_c1 3300050511 Bacteria 6578
469 nmdc:mga08y16_422706_c1 3300050511 Bacteria 1362
470 nmdc:mga0n895_88878_c1 3300050512 Bacteria 3090
471 nmdc:mga0rr50_425476_c1 3300050513 Bacteria 1124
472 nmdc:mga0a205_165784_c1 3300050515 Bacteria 2105
473 nmdc:mga0a205_430576_c1 3300050515 Bacteria 1181
474 nmdc:mga0a205_75577_c1 3300050515 Bacteria 3255
475 Ga0500583_0009927 3300053092 Bacteria 3504
476 Ga0500617_098094 3300053124 Bacteria 1242
477 Ga0500658_0103894 3300053134 Bacteria 1243
478 Ga0500588_0016242 3300053146 Bacteria 1923
479 Ga0590077_058562 3300059426 Bacteria 872
480 2885429070 2885427238 Bacteria 2291351
481 JGI24736J21556_1004416
482 JGI24740J21852_10019081
483 JGI24739J22299_10000785
484 JGI24737J22298_10000076
485 JGI24735J21928_10008713
486 JGI24738J21930_10000015
487 JGI24742J22300_10002226
488 JGI24751J29686_10052880
489 rootH1_10122915
490 Ga0055530_10000049
491 Ga0055530_10000073
492 Ga0055531_10000017
493 JGI25405J52794_10016060
494 Ga0070658_10014808
495 Ga0070658_10078315
496 Ga0070676_10076294
497 Ga0070676_10086203
498 Ga0070683_100448535
499 Ga0070690_100010898
500 Ga0070677_10028862
501 Ga0068869_100000193
502 Ga0068869_100115171
503 Ga0070680_100019069
504 Ga0070680_100222874
505 Ga0070682_100156491
506 Ga0070682_100295078
507 Ga0068868_100006091
508 Ga0068868_100122406
509 Ga0070660_100001378
510 Ga0070660_100029364
511 Ga0070660_100047061
512 Ga0070689_100011417
513 Ga0070661_100017253
514 Ga0070661_100033999
515 Ga0070661_100376269
516 Ga0070692_10006718
517 Ga0070668_100019614
518 Ga0070668_100031616
519 Ga0070669_100000586
520 Ga0070669_100018539
521 Ga0070675_100030843
522 Ga0070671_100003627
523 Ga0070671_100146306
524 Ga0070671_100259992
525 Ga0070674_100001176
526 Ga0070673_100013079
527 Ga0070673_100148025
528 Ga0070673_100165000
529 Ga0070659_100004304
530 Ga0070659_100010984
531 Ga0070659_100016304
532 Ga0070659_100029813
533 Ga0070667_100003196
534 Ga0070667_100229262
535 Ga0070667_101074383
536 Ga0070714_100364899
537 Ga0070713_100154916
538 Ga0070711_100006313
539 Ga0070694_100017169
540 Ga0070678_100019654
541 Ga0070678_100214994
542 Ga0070662_100003645
543 Ga0070662_100012424
544 Ga0070681_10003859
545 Ga0070681_10115276
546 Ga0070681_10328129
547 Ga0068867_100001734
548 Ga0068867_100006111
549 Ga0068867_100075665
550 Ga0070706_100107637
551 Ga0070707_100018944
552 Ga0070707_100116805
553 Ga0070698_100062720
554 Ga0070698_100703284
555 Ga0070699_100045501
556 Ga0070679_100055910
557 Ga0068853_100005597
558 Ga0068853_100014861
559 Ga0068853_100072655
560 Ga0068853_100072689
561 Ga0068853_100091713
562 Ga0068853_100150094
563 Ga0068853_100550319
564 Ga0070672_100001067
565 Ga0070672_100268594
566 Ga0070695_100297520
567 Ga0070696_100007242
568 Ga0070696_100070740
569 Ga0070665_100009353
570 Ga0068855_100002788
571 Ga0068855_100030767
572 Ga0068855_100034017
573 Ga0068855_100372360
574 Ga0070664_100027379
575 Ga0070664_100039530
576 Ga0070664_100708555
577 Ga0070664_101049799
578 Ga0068857_100000338
579 Ga0068854_100001900
580 Ga0068854_100007395
581 Ga0068854_100012472
582 Ga0068854_100047880
583 Ga0068856_100177864
584 Ga0068856_100341771
585 Ga0070702_100201417
586 Ga0068852_100001883
587 Ga0068852_100030978
588 Ga0068852_100105184
589 Ga0068859_100006502
590 Ga0068859_100104895
591 Ga0068859_100133465
592 Ga0068859_100640056
593 Ga0068864_100000247
594 Ga0068866_10220438
595 Ga0068861_100034796
596 Ga0068861_100120477
597 Ga0068861_100189413
598 Ga0068870_10023775
599 Ga0068863_100038901
600 Ga0068858_100001094
601 Ga0068858_100029259
602 Ga0068858_100785027
603 Ga0068860_100003357
604 Ga0068860_100030624
605 Ga0068860_100033479
606 Ga0068860_100111415
607 Ga0068860_100132811
608 Ga0068862_100001250
609 Ga0068862_100044559
610 Ga0068862_100077449
611 Ga0081455_10005703
612 Ga0081538_10077496
613 Ga0075365_10044861
614 Ga0075364_10029453
615 Ga0070712_100000337
616 Ga0075362_10069452
617 Ga0075367_10000860
618 Ga0075367_10067690
619 Ga0075366_10000191
620 Ga0075366_10103768
621 Ga0097621_100006503
622 Ga0097621_100206899
623 Ga0068871_100026894
624 Ga0068871_100060854
625 Ga0068871_100209306
626 Ga0075428_100003092
627 Ga0075428_100176244
628 Ga0075428_100186609
629 Ga0075430_100007253
630 Ga0075431_100004942
631 Ga0075431_100022109
632 Ga0075433_10038868
633 Ga0075433_10172470
634 Ga0075433_10372705
635 Ga0075434_100398965
636 Ga0075429_100026894
637 Ga0075429_100108205
638 Ga0075429_100111259
639 Ga0068865_100004687
640 Ga0068865_100110720
641 Ga0097620_100006502
642 Ga0097620_100058999
643 Ga0097620_100104886
644 Ga0097620_100133464
645 Ga0097620_100640075
646 Ga0075435_100526455
647 Ga0105240_10032399
648 Ga0105240_10064276
649 Ga0111539_10000076
650 Ga0111539_10329625
651 Ga0105245_10000128
652 Ga0105245_10087966
653 Ga0105245_10943589
654 Ga0114129_10171659
655 Ga0114129_10188547
656 Ga0114129_10373589
657 Ga0105243_10018896
658 Ga0105243_10394911
659 Ga0105242_10037857
660 Ga0105248_10000787
661 Ga0105248_10034069
662 Ga0105248_10099206
663 Ga0105248_11326494
664 Ga0105238_10032221
665 Ga0105238_10052960
666 Ga0105249_11086565
667 Ga0105246_10080927
668 Ga0105246_10237896
669 Ga0157341_1010956
670 Ga0157373_10001744
671 Ga0157373_10016222
672 Ga0157373_10089590
673 Ga0157373_10116778
674 Ga0157371_10000850
675 Ga0157371_10056815
676 Ga0157371_10108891
677 Ga0157370_10066542
678 Ga0157370_10104259
679 Ga0157369_10002034
680 Ga0157369_10260191
681 Ga0157369_10769911
682 Ga0157374_10020944
683 Ga0157378_10000396
684 Ga0157378_10002179
685 Ga0163162_10005800
686 Ga0163162_10666497
687 Ga0157372_10002766
688 Ga0157372_10133979
689 Ga0157372_10190148
690 Ga0157375_10095391
691 Ga0157375_10548295
692 Ga0163163_10000163
693 Ga0163163_10013271
694 Ga0163163_10020639
695 Ga0157380_10025062
696 Ga0157379_10002601
697 Ga0157379_10034259
698 Ga0157376_10242862
699 Ga0207673_1004440
700 Ga0207697_10000461
701 Ga0207697_10005921
702 Ga0207697_10073056
703 Ga0207656_10276501
704 Ga0207642_10051702
705 Ga0207642_10095942
706 Ga0207688_10000063
707 Ga0207680_10076462
708 Ga0207680_10134027
709 Ga0207647_10000227
710 Ga0207647_10003088
711 Ga0207699_10171273
712 Ga0207699_10185505
713 Ga0207645_10016035
714 Ga0207645_10018000
715 Ga0207645_10087121
716 Ga0207643_10069472
717 Ga0207705_10010820
718 Ga0207705_10014415
719 Ga0207705_10019346
720 Ga0207684_10749006
721 Ga0207695_10028155
722 Ga0207671_10106463
723 Ga0207693_10000270
724 Ga0207663_10004818
725 Ga0207660_10139370
726 Ga0207660_10182400
727 Ga0207657_10002137
728 Ga0207657_10027012
729 Ga0207657_10049375
730 Ga0207649_10003288
731 Ga0207649_10168137
732 Ga0207646_10040122
733 Ga0207646_10158661
734 Ga0207681_10001851
735 Ga0207681_10165435
736 Ga0207694_10012198
737 Ga0207694_10023343
738 Ga0207659_10140841
739 Ga0207659_10316293
740 Ga0207687_10702540
741 Ga0207644_10023258
742 Ga0207644_10054891
743 Ga0207690_10007462
744 Ga0207690_10009691
745 Ga0207690_10361940
746 Ga0207706_10000648
747 Ga0207706_10014378
748 Ga0207706_10167431
749 Ga0207706_10769095
750 Ga0207686_10016186
751 Ga0207709_10143159
752 Ga0207709_10258232
753 Ga0207670_10051273
754 Ga0207691_10000447
755 Ga0207711_10001621
756 Ga0207711_10008671
757 Ga0207711_10224154
758 Ga0207711_11043265
759 Ga0207689_10001047
760 Ga0207689_10023218
761 Ga0207661_10295846
762 Ga0207679_10010663
763 Ga0207679_10020821
764 Ga0207651_10034860
765 Ga0207651_10084039
766 Ga0207651_10870828
767 Ga0207712_10489987
768 Ga0207668_10001078
769 Ga0207668_10077632
770 Ga0207640_10000450
771 Ga0207640_10005399
772 Ga0207640_10006261
773 Ga0207640_10290273
774 Ga0207658_10005642
775 Ga0207658_10094823
776 Ga0207658_10529366
777 Ga0207658_10840882
778 Ga0207677_10000532
779 Ga0207703_10010957
780 Ga0207703_10091171
781 Ga0207639_10000289
782 Ga0207639_10015419
783 Ga0207639_10105199
784 Ga0207639_10142978
785 Ga0207639_10306469
786 Ga0207678_10005936
787 Ga0207678_10201842
788 Ga0207702_10150291
789 Ga0207702_10379027
790 Ga0207641_10002559
791 Ga0207641_10012445
792 Ga0207641_10030293
793 Ga0207648_10000876
794 Ga0207648_10001177
795 Ga0207648_10220771
796 Ga0207676_10000220
797 Ga0207674_10001201
798 Ga0207674_10076557
799 Ga0207674_10523153
800 Ga0207675_100056177
801 Ga0207675_100082757
802 Ga0207675_100143187
803 Ga0207683_10025476
804 Ga0207698_10024898
805 Ga0207698_10125273
806 Ga0207698_10225955
807 Ga0209971_1029498
808 Ga0209974_10045163
809 Ga0207428_10000660
810 Ga0207428_10085002
811 Ga0268266_10303890
812 Ga0268265_10002320
813 Ga0268265_10055792
814 Ga0268265_10086452
815 Ga0268265_10352448
816 Ga0268265_10731014
817 Ga0268264_10022858
818 Ga0268264_10031388
819 Ga0268264_10212060
820 Ga0265331_10025383
821 Ga0265327_10000044
822 Ga0307408_100019242
823 Ga0307408_100180620
824 Ga0307408_100265664
825 Ga0307405_10016845
826 Ga0307405_10026154
827 Ga0307405_10130169
828 Ga0307405_10147086
829 Ga0307413_10064708
830 Ga0307413_10082711
831 Ga0307413_10292486
832 Ga0307410_10010947
833 Ga0307410_10015534
834 Ga0307410_10033929
835 Ga0307410_10038729
836 Ga0307406_10081836
837 Ga0307407_10009646
838 Ga0307407_10048900
839 Ga0307407_10068336
840 Ga0307412_10011889
841 Ga0307412_10079822
842 Ga0307412_10415249
843 Ga0307412_10631243
844 Ga0307409_100006895
845 Ga0307409_100026811
846 Ga0307409_100928859
847 Ga0307416_100002230
848 Ga0307416_100031584
849 Ga0307416_100087745
850 Ga0307416_100093478
851 Ga0307416_100126312
852 Ga0307414_10124204
853 Ga0307414_10736893
854 Ga0307411_10009745
855 Ga0307411_10019050
856 Ga0307411_10069213
857 Ga0307411_10122168
858 Ga0307411_10178578
859 Ga0307411_10285133
860 Ga0307411_10361826
861 Ga0307415_100013618
862 Ga0373944_0012808
863 Ga0373949_0108839
864 Ga0373936_0018615
865 Ga0373945_0093214
866 Ga0373945_0114339
867 Ga0373954_0006304
868 Ga0373956_0018098
869 Ga0373943_0124221
870 Ga0373946_0006462
871 Ga0373924_0054045
872 Ga0373947_0263990
873 Ga0373937_0003573
874 Ga0373937_0004473
875 Ga0373925_0037290
876 Ga0395899_0166154
877 Ga0395900_0035979
878 Ga0395900_0810981
879 Ga0395898_0008628
880 Ga0395898_0117381
881 Ga0395898_0384736
882 Ga0395905_0005494
883 Ga0395905_0088598
884 Ga0395905_0111198
885 Ga0395905_0321305
886 Ga0395905_0547408
887 Ga0395905_0720889
888 Ga0395905_0736148
889 Ga0395901_0003575
890 Ga0395901_0137934
891 Ga0395901_0951605
892 Ga0242420_000878
893 Ga0451807_1907884
894 Ga0439464_0199758
895 Ga0451577_0300099
896 Ga0453683_0028825
897 Ga0453683_0298208
898 Ga0453683_0301594
899 Ga0466966_0216582
900 Ga0466961_0141224
901 Ga0466963_0086197
902 Ga0466963_0205215
903 Ga0466957_0004260
904 Ga0451576_0442179
905 Ga0466967_0005342
906 Ga0466967_0097370
907 Ga0466967_0216341
908 Ga0466967_0468011
909 Ga0466967_0927280
910 Ga0495580_0105929
911 Ga0495607_0301640
912 Ga0495620_0002601
913 Ga0495644_0012123
914 Ga0495663_0161101
915 Ga0495666_0104287
916 Ga0495586_0340268
917 Ga0495656_0127017
918 Ga0495668_0484282
919 Ga0495611_0268814
920 Ga0495659_0095646
921 Ga0495647_0014191
922 Ga0495669_0106208
923 Ga0495671_0300857
924 Ga0495636_0112950
925 Ga0501042_0253911
926 Ga0501070_0017033
927 Ga0501072_0412728
928 Ga0501074_0346296
929 Ga0501076_0877620
930 Ga0501077_0408000
931 Ga0501081_0060573
932 Ga0501083_0488061
933 nmdc:mga03683_10286_c1
934 nmdc:mga00v17_24094_c1
935 nmdc:mga0yw44_16031_c1
936 nmdc:mga0k408_100161_c1
937 nmdc:mga0k408_1635_c1
938 nmdc:mga0k408_43349_c1
939 nmdc:mga06z11_4759_c1
940 nmdc:mga06z11_64334_c1
941 nmdc:mga07m45_32451_c1
942 nmdc:mga05p37_290767_c1
943 nmdc:mga05p37_307889_c1
944 nmdc:mga09592_1069905_c1
945 nmdc:mga09592_61858_c1
946 nmdc:mga09592_69168_c1
947 nmdc:mga06r32_83857_c1
948 nmdc:mga08y16_23017_c1
949 nmdc:mga08y16_422706_c1
950 nmdc:mga0n895_88878_c1
951 nmdc:mga0rr50_425476_c1
952 nmdc:mga0a205_165784_c1
953 nmdc:mga0a205_430576_c1
954 nmdc:mga0a205_75577_c1
955 Ga0500583_0009927
956 Ga0500617_098094
957 Ga0500658_0103894
958 Ga0500588_0016242
959 Ga0590077_058562
960 2885429070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

2

186

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7811 1 192
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7783 1 192
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.777 1 192
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7743 1 192
3tqa-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with nadph 0.7684 3 190
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7778 1 192 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7737 1 192 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7735 3 196 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7684 3 190 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7654 3 196 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A3D0WIX1-F1-model_v4 deleted 0.9689 25 192
AF-A0A3D0WIX1-F1-model_v4 deleted 0.9523 25 192
AF-A0A6N9T9G1-F1-model_v4 Dihydrofolate reductase 0.9519 1 204 GO:0008703
GO:0009231
AF-A0A6N9T9G1-F1-model_v4 Dihydrofolate reductase 0.9473 1 204 GO:0008703
GO:0009231
AF-A0A528A7F9-F1-model_v4 Dihydrofolate reductase 0.9371 1 157 GO:0008703
GO:0009231

Map