F452136

General Info

Members Datasets Scaffolds Average Seq Length
479 348 958 365

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2857609550|2857612946
Length 401
Sequence FFNIQNDVISSFFSYNENNQYERMIEMLIGVPAEIKNNENRVAITPSGVATLVHAGHEVMIEKGAGLGSGFTDAEYARYGAQVTESAKDVWERADMVMKVKEPLASEYQYFRKDLLLFTYLHLAAEPALTKALVDSGVTGIAYETVTVNGTLPLLSPMSEVAGRMSTQIGAQFLEKNNGGKGVLLGGVPGVKRSRVTVIGGGMVGTNAARIAVGLGADVTIIDLSADRLRQLEEIFGASVQTLMSSPLNIAESVKESDLVIGAVLIPGAKAPKLVTEEMVKSMSPGSVIVDVAIDQGGIFETVDRITTHTDPTYEKHDVVHYAVANMPGAVPRTSTIALTNVTVPYALQIANKGFEQAIKQNPALERGVNTYGGYVTFEAVARDLGYEGKSIKELLDSLTV

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
87 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
98 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
114 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
115 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
166 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
167 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
168 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
194 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
195 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
196 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
197 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
198 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
199 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
200 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
208 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
224 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
225 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
226 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
227 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
228 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
229 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
230 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
231 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
232 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
233 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
234 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
235 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
236 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
237 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
238 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
239 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
240 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
241 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
242 2643221692 Nocardia sp. Root136 Isolate Unclassified
243 2643221731 Bacillus sp. Root147 Isolate Unclassified
244 2643221732 Bacillus sp. Root239 Isolate Unclassified
245 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
246 2671180694 Paenibacillus sp. A3 Isolate Unclassified
247 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
248 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
249 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
250 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
251 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
252 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
253 2738543010 Bacillus sp. YR335 Isolate Unclassified
254 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
255 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
256 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
257 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
258 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
259 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
260 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
261 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
262 2818991441 Niallia circulans 3243 Isolate Rhizosphere
263 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
264 2818991459 Paenibacillus sp. 597 Isolate Unclassified
265 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
266 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
267 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
268 2842682962 Bacillus sp. R-72492 Isolate Unclassified
269 2842882022 Bacillus sp. R-71893 Isolate Unclassified
270 2849139964 Bacillus sp. R-71875 Isolate Unclassified
271 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
272 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
273 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
274 2857581216 Bacillus sp. R-71922 Isolate Unclassified
275 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
276 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
277 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
278 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
279 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
280 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
281 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
282 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
283 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
284 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
285 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
286 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
287 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
288 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
289 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
290 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
291 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
292 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
293 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
294 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
295 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
296 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
297 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
298 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
299 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
300 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
301 2919720352 Priestia megaterium 4340 Isolate Unclassified
302 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
303 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
304 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
305 2929004312 Priestia megaterium 1104 Isolate Unclassified
306 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
307 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
308 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
309 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
310 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
311 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
312 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
313 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
314 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
315 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
316 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
317 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
318 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
319 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
320 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
321 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
322 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
323 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
324 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
325 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
326 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
327 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
328 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
329 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
330 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
331 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
332 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
333 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
334 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
335 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
336 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
337 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
338 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
339 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
340 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
341 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
342 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
343 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
344 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
345 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
346 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
347 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
348 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 64.72
Metatranscriptomes 1.04
Isolates 34.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.47
Nodule 0.42
Rhizoplane 6.68
Rhizosphere 61.8
Stem 0
Stem Tuber 0
Unclassified 2.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10002747 3300003187 Bacteria 10241
2 JGI25151J46595_10005640 3300003187 Bacteria 6435
3 JGI25151J46595_10007802 3300003187 Bacteria 5204
4 JGI25151J46595_10040976 3300003187 Bacteria 1690
5 rootL2_10005378 3300003322 Bacteria 17053
6 rootL2_10186512 3300003322 Bacteria 3945
7 rootH1_10090058 3300003323 Bacteria 2752
8 rootH1_10145168 3300003323 Bacteria 6340
9 Ga0006562J51391_1001817 3300003578 Bacteria 3430
10 Ga0055538_1000104 3300003751 Bacteria 67342
11 Ga0055538_1000302 3300003751 Bacteria 24606
12 Ga0055538_1000443 3300003751 Bacteria 15718
13 Ga0055535_1006391 3300003761 Bacteria 2391
14 Ga0055528_1022264 3300003790 Bacteria 1980
15 Ga0065712_10071811 3300005290 Bacteria 5051
16 Ga0070676_10013502 3300005328 Bacteria 4475
17 Ga0070676_10210609 3300005328 Bacteria 1279
18 Ga0070690_100000401 3300005330 Bacteria 21896
19 Ga0070690_100018215 3300005330 Bacteria 4237
20 Ga0070670_100020231 3300005331 Bacteria 5719
21 Ga0070680_100039523 3300005336 Bacteria 3817
22 Ga0068868_100174718 3300005338 Bacteria 1780
23 Ga0068868_100328320 3300005338 Bacteria 1305
24 Ga0070689_100004753 3300005340 Bacteria 9216
25 Ga0070668_100153844 3300005347 Bacteria 1862
26 Ga0070669_100010084 3300005353 Bacteria 6718
27 Ga0070669_100078636 3300005353 Bacteria 2452
28 Ga0070675_100067071 3300005354 Bacteria 2969
29 Ga0070671_100016550 3300005355 Bacteria 5962
30 Ga0070673_100241765 3300005364 Bacteria 1570
31 Ga0070701_10002972 3300005438 Bacteria 6624
32 Ga0070694_100149818 3300005444 Bacteria 1703
33 Ga0070678_100016891 3300005456 Bacteria 4681
34 Ga0070681_10141073 3300005458 Bacteria 2339
35 Ga0070684_100002854 3300005535 Bacteria 12848
36 Ga0070697_100325652 3300005536 Bacteria 1324
37 Ga0068853_100060219 3300005539 Bacteria 3280
38 Ga0070672_100019672 3300005543 Bacteria 4906
39 Ga0070672_100052122 3300005543 Bacteria 3194
40 Ga0070672_100140946 3300005543 Bacteria 1988
41 Ga0070686_100004233 3300005544 Bacteria 7900
42 Ga0070665_100035752 3300005548 Unclassified 4997
43 Ga0068861_100031392 3300005719 Bacteria 3903
44 Ga0068863_100085276 3300005841 Bacteria 2993
45 Ga0068863_100137187 3300005841 Bacteria 2337
46 Ga0075362_10071584 3300006177 Bacteria 1584
47 Ga0075434_100009274 3300006871 Bacteria 9169
48 Ga0075434_100011370 3300006871 Bacteria 8394
49 Ga0068865_100003001 3300006881 Bacteria 10080
50 Ga0068865_100062454 3300006881 Bacteria 2615
51 Ga0075436_100001974 3300006914 Bacteria 14145
52 Ga0075435_100012029 3300007076 Bacteria 6393
53 Ga0075435_100262029 3300007076 Bacteria 1473
54 Ga0099794_10047420 3300007265 Bacteria 2060
55 Ga0105251_10007602 3300009011 Bacteria 6648
56 Ga0105244_10005909 3300009036 Bacteria 8031
57 Ga0105250_10002946 3300009092 Bacteria 8300
58 Ga0111539_10020249 3300009094 Bacteria 8198
59 Ga0111539_10022877 3300009094 Bacteria 7675
60 Ga0105247_10003158 3300009101 Bacteria 10858
61 Ga0105243_10000830 3300009148 Bacteria 29349
62 Ga0105242_10004458 3300009176 Bacteria 10884
63 Ga0105242_10004754 3300009176 Bacteria 10516
64 Ga0105248_10017057 3300009177 Bacteria 7996
65 Ga0105239_10146129 3300010375 Bacteria 2637
66 Ga0105246_10013556 3300011119 Bacteria 5113
67 Ga0157326_1001275 3300012513 Bacteria 2796
68 Ga0157369_10223733 3300013105 Bacteria 1969
69 Ga0157374_10003527 3300013296 Bacteria 13160
70 Ga0157372_10093683 3300013307 Bacteria 3419
71 Ga0157376_10002391 3300014969 Bacteria 12680
72 Ga0209784_100038 3300025224 Bacteria 253212
73 Ga0209784_100114 3300025224 Bacteria 89590
74 Ga0209784_100312 3300025224 Bacteria 25509
75 Ga0209566_100490 3300025225 Bacteria 27730
76 Ga0209566_100644 3300025225 Bacteria 21095
77 Ga0209147_100098 3300025229 Bacteria 163978
78 Ga0209147_102694 3300025229 Bacteria 4082
79 Ga0209676_1001089 3300025292 Bacteria 30518
80 Ga0209676_1011471 3300025292 Bacteria 3568
81 Ga0209676_1012072 3300025292 Bacteria 3429
82 Ga0209025_1000684 3300025294 Bacteria 58110
83 Ga0209025_1000698 3300025294 Bacteria 57275
84 Ga0209025_1002223 3300025294 Bacteria 21381
85 Ga0209025_1002248 3300025294 Bacteria 21251
86 Ga0209025_1008116 3300025294 Bacteria 7628
87 Ga0209025_1019957 3300025294 Bacteria 3696
88 Ga0209025_1027312 3300025294 Bacteria 2833
89 Ga0209025_1032145 3300025294 Bacteria 2462
90 Ga0207696_1030602 3300025711 Bacteria 1634
91 Ga0207655_1006608 3300025728 Bacteria 7648
92 Ga0207655_1018248 3300025728 Bacteria 3736
93 Ga0207713_1001728 3300025735 Bacteria 16834
94 Ga0207713_1022398 3300025735 Bacteria 3000
95 Ga0207642_10099040 3300025899 Bacteria 1459
96 Ga0207688_10081531 3300025901 Bacteria 1848
97 Ga0207645_10020676 3300025907 Bacteria 4304
98 Ga0207707_10003545 3300025912 Bacteria 13812
99 Ga0207707_10204908 3300025912 Bacteria 1719
100 Ga0207662_10004935 3300025918 Bacteria 7054
101 Ga0207652_10042217 3300025921 Bacteria 3880
102 Ga0207681_10000877 3300025923 Bacteria 19797
103 Ga0207709_10003203 3300025935 Bacteria 9839
104 Ga0207709_10036538 3300025935 Bacteria 2911
105 Ga0207670_10009123 3300025936 Bacteria 5639
106 Ga0207670_10020308 3300025936 Bacteria 4080
107 Ga0207704_10020955 3300025938 Bacteria 3471
108 Ga0207691_10003882 3300025940 Bacteria 14510
109 Ga0207691_10111892 3300025940 Bacteria 2427
110 Ga0207651_10067202 3300025960 Bacteria 2522
111 Ga0207712_10164646 3300025961 Bacteria 1727
112 Ga0207668_10112362 3300025972 Bacteria 2046
113 Ga0207639_10035983 3300026041 Bacteria 3666
114 Ga0207708_10014290 3300026075 Bacteria 5939
115 Ga0207641_10117298 3300026088 Bacteria 2370
116 Ga0207641_10192998 3300026088 Bacteria 1873
117 Ga0207648_10026918 3300026089 Bacteria 5107
118 Ga0207675_100045151 3300026118 Bacteria 4117
119 Ga0207683_10068647 3300026121 Bacteria 3130
120 Ga0207683_10122890 3300026121 Bacteria 2332
121 Ga0209371_1015722 3300027312 Bacteria 2021
122 Ga0207428_10066001 3300027907 Bacteria 2852
123 Ga0268265_10362959 3300028380 Bacteria 1326
124 Ga0265318_10000720 3300028577 Bacteria 22212
125 Ga0265338_10089495 3300028800 Bacteria 2550
126 Ga0268256_1001244 3300030500 Bacteria 15959
127 Ga0265320_10088339 3300031240 Bacteria 1438
128 Ga0265325_10001395 3300031241 Bacteria 17041
129 Ga0265340_10003562 3300031247 Bacteria 8766
130 Ga0265316_10001465 3300031344 Bacteria 25280
131 Ga0265316_10014047 3300031344 Bacteria 7071
132 Ga0307408_100052199 3300031548 Bacteria 2948
133 Ga0265313_10000439 3300031595 Bacteria 44190
134 Ga0265313_10027970 3300031595 Bacteria 2940
135 Ga0265342_10016846 3300031712 Bacteria 4764
136 Ga0307405_10203254 3300031731 Bacteria 1440
137 Ga0307409_100028307 3300031995 Bacteria 3989
138 Ga0307416_100010597 3300032002 Bacteria 6098
139 Ga0316580_10014476 3300032139 Bacteria 2409
140 Ga0316593_10017029 3300032168 Bacteria 2212
141 Ga0373934_0022783 3300035086 Bacteria 2417
142 Ga0373954_0085035 3300035118 Bacteria 1514
143 Ga0373956_0003059 3300035119 Bacteria 6773
144 Ga0373955_0001694 3300035172 Bacteria 9429
145 Ga0316574_0009598 3300035398 Bacteria 5427
146 Ga0373927_0015718 3300035695 Bacteria 4997
147 Ga0373933_0080844 3300035724 Bacteria 1993
148 Ga0373947_0009273 3300035725 Bacteria 5655
149 Ga0373937_0003187 3300036401 Bacteria 13737
150 Ga0373937_0173696 3300036401 Bacteria 2022
151 Ga0316582_0008220 3300036647 Bacteria 5595
152 Ga0316584_0044212 3300036712 Bacteria 3321
153 Ga0395900_0292377 3300037418 Bacteria 1618
154 Ga0395901_0047127 3300038443 Bacteria 4476
155 Ga0395901_0114867 3300038443 Bacteria 2828
156 Ga0436362_0452241 3300039453 Bacteria 4110
157 Ga0436362_0833938 3300039453 Bacteria 4845
158 Ga0439439_0004313 3300041406 Bacteria 3199
159 Ga0439465_0045857 3300041413 Bacteria 1422
160 Ga0439433_0006880 3300041999 Unclassified 2451
161 Ga0439449_0000446 3300042007 Bacteria 15362
162 Ga0439449_0005709 3300042007 Bacteria 4757
163 Ga0439462_0019822 3300042015 Unclassified 1752
164 Ga0466969_0001947 3300044656 Bacteria 11040
165 Ga0453683_0000922 3300044673 Bacteria 27998
166 Ga0466966_0138675 3300044684 Bacteria 1487
167 Ga0466961_0148566 3300044693 Bacteria 1464
168 Ga0466963_0244653 3300044694 Bacteria 1258
169 Ga0466968_0026302 3300044735 Bacteria 2387
170 Ga0466959_0008257 3300045049 Bacteria 7352
171 Ga0451576_0185552 3300045051 Bacteria 2172
172 Ga0466967_0008078 3300045976 Bacteria 7673
173 Ga0466967_0011107 3300045976 Bacteria 6803
174 Ga0466967_0031457 3300045976 Bacteria 4467
175 Ga0495627_031136 3300046453 Bacteria 1687
176 Ga0495603_0053311 3300046455 Bacteria 2399
177 Ga0495585_0011371 3300046492 Bacteria 5267
178 Ga0495654_0086002 3300046530 Bacteria 1466
179 Ga0495586_0014168 3300046535 Bacteria 4237
180 Ga0495634_0016539 3300046642 Bacteria 5273
181 Ga0495613_0171667 3300046689 Bacteria 1539
182 Ga0495660_0020233 3300046810 Bacteria 3815
183 Ga0495660_0025951 3300046810 Bacteria 3324
184 Ga0495660_0142166 3300046810 Bacteria 1193
185 Ga0495604_0070348 3300047317 Bacteria 2650
186 Ga0495674_0021674 3300047319 Bacteria 5941
187 Ga0495683_0006183 3300047323 Bacteria 6559
188 Ga0495602_0093463 3300048088 Bacteria 2488
189 Ga0495626_0027357 3300048091 Bacteria 2774
190 Ga0496100_0004587 3300048903 Bacteria 7342
191 Ga0496101_0000506 3300048904 Bacteria 24503
192 Ga0496101_0055327 3300048904 Bacteria 2866
193 Ga0496101_0058527 3300048904 Bacteria 2791
194 Ga0496101_0140601 3300048904 Bacteria 1840
195 Ga0496102_0030795 3300048905 Bacteria 4804
196 Ga0496102_0211413 3300048905 Bacteria 1829
197 Ga0496103_0026704 3300048906 Bacteria 3494
198 Ga0496104_0001520 3300048907 Bacteria 20004
199 Ga0496105_0002680 3300048908 Bacteria 12974
200 Ga0496106_0000508 3300048909 Bacteria 27543
201 Ga0496106_0008435 3300048909 Bacteria 7624
202 Ga0496107_0000306 3300048910 Bacteria 26247
203 Ga0496108_0003790 3300048911 Bacteria 12102
204 Ga0496108_0043903 3300048911 Bacteria 3734
205 Ga0496109_0011467 3300048912 Bacteria 7623
206 Ga0496109_0286951 3300048912 Bacteria 1551
207 Ga0496109_0360072 3300048912 Bacteria 1374
208 Ga0496110_0002559 3300048913 Bacteria 13670
209 Ga0496110_0003882 3300048913 Bacteria 11503
210 Ga0496110_0008252 3300048913 Bacteria 8373
211 Ga0496110_0245770 3300048913 Bacteria 1629
212 Ga0496111_0035169 3300048914 Bacteria 3579
213 Ga0496112_0010743 3300048915 Bacteria 8325
214 Ga0496112_0096585 3300048915 Bacteria 2925
215 Ga0496113_0006809 3300048916 Bacteria 7286
216 Ga0496114_0002093 3300048917 Bacteria 15175
217 Ga0496114_0004154 3300048917 Bacteria 11202
218 Ga0496114_0014189 3300048917 Bacteria 6392
219 Ga0496115_0036190 3300048918 Bacteria 3907
220 Ga0496116_0000369 3300048919 Bacteria 68089
221 Ga0496116_0000782 3300048919 Bacteria 40453
222 Ga0496116_0002099 3300048919 Bacteria 21284
223 Ga0496116_0047794 3300048919 Bacteria 2877
224 Ga0496116_0086493 3300048919 Bacteria 1923
225 Ga0496116_0117736 3300048919 Bacteria 1545
226 Ga0496117_0115613 3300048920 Bacteria 1660
227 Ga0496119_0002498 3300048922 Bacteria 20103
228 Ga0496119_0082055 3300048922 Bacteria 1854
229 Ga0496121_0020762 3300048924 Bacteria 6475
230 Ga0496121_0158457 3300048924 Bacteria 1658
231 Ga0496122_0014821 3300048925 Bacteria 7509
232 Ga0496122_0020320 3300048925 Bacteria 6007
233 Ga0496122_0026458 3300048925 Bacteria 5000
234 Ga0496122_0035127 3300048925 Bacteria 4086
235 Ga0496122_0088950 3300048925 Unclassified 2114
236 Ga0496122_0122408 3300048925 Bacteria 1674
237 Ga0496122_0173053 3300048925 Bacteria 1298
238 Ga0496123_0021762 3300048926 Bacteria 4971
239 Ga0496123_0025686 3300048926 Bacteria 4432
240 Ga0496124_0001306 3300048927 Bacteria 37659
241 Ga0496124_0056383 3300048927 Bacteria 3314
242 Ga0496124_0093719 3300048927 Bacteria 2444
243 Ga0496124_0236819 3300048927 Bacteria 1360
244 Ga0496125_0000188 3300048928 Bacteria 134959
245 Ga0496125_0000340 3300048928 Bacteria 89358
246 Ga0496125_0001413 3300048928 Bacteria 35041
247 Ga0496125_0002751 3300048928 Bacteria 22244
248 Ga0496125_0003803 3300048928 Bacteria 17944
249 Ga0496125_0006643 3300048928 Bacteria 12446
250 Ga0496125_0007141 3300048928 Bacteria 11920
251 Ga0496125_0008061 3300048928 Bacteria 11115
252 Ga0496126_0005208 3300048929 Bacteria 15006
253 Ga0496126_0038524 3300048929 Bacteria 4447
254 Ga0496126_0138490 3300048929 Bacteria 2097
255 Ga0501294_005062 3300049517 Bacteria 1245
256 Ga0501298_000289 3300049521 Bacteria 6655
257 Ga0501299_000532 3300049522 Unclassified 4548
258 Ga0501312_008257 3300049528 Bacteria 1349
259 Ga0501315_007718 3300049531 Bacteria 1233
260 Ga0501336_001887 3300049552 Bacteria 1303
261 Ga0501031_0257830 3300049568 Bacteria 1133
262 Ga0501034_0003237 3300049571 Bacteria 18617
263 Ga0501034_0365922 3300049571 Bacteria 1368
264 Ga0501037_0052553 3300049573 Unclassified 2980
265 Ga0501038_0001462 3300049574 Bacteria 21731
266 Ga0501039_0000639 3300049575 Bacteria 25355
267 Ga0501040_0000116 3300049576 Bacteria 42224
268 Ga0501041_0000204 3300049577 Bacteria 27375
269 Ga0501042_0000125 3300049578 Bacteria 33043
270 Ga0501043_0002822 3300049579 Bacteria 14530
271 Ga0501047_0032743 3300049581 Bacteria 5018
272 Ga0501048_0002239 3300049582 Bacteria 14739
273 Ga0501067_0008145 3300049583 Bacteria 5823
274 Ga0501068_0081773 3300049584 Bacteria 1983
275 Ga0501069_0044892 3300049585 Bacteria 2447
276 Ga0501070_0000187 3300049586 Bacteria 58257
277 Ga0501071_0001701 3300049587 Bacteria 12920
278 Ga0501072_0076083 3300049588 Bacteria 2655
279 Ga0501073_0004575 3300049589 Bacteria 10399
280 Ga0501074_0024374 3300049590 Unclassified 4397
281 Ga0501075_0000183 3300049591 Bacteria 32368
282 Ga0501076_0156301 3300049592 Bacteria 1856
283 Ga0501077_0000382 3300049593 Bacteria 26512
284 Ga0501198_001066 3300049649 Bacteria 3501
285 Ga0501217_001194 3300049661 Unclassified 4787
286 Ga0501223_002974 3300049663 Bacteria 3720
287 Ga0501233_005530 3300049668 Bacteria 2346
288 Ga0501243_000215 3300049675 Bacteria 7095
289 Ga0501246_003729 3300049676 Bacteria 1237
290 Ga0501259_000850 3300049688 Bacteria 5016
291 Ga0501261_004928 3300049690 Bacteria 1666
292 Ga0501225_0001083 3300049705 Bacteria 8547
293 Ga0501234_003901 3300049707 Bacteria 2344
294 Ga0501079_0000265 3300049741 Bacteria 32220
295 Ga0501080_0003230 3300049742 Bacteria 14385
296 Ga0501081_0000367 3300049743 Bacteria 24583
297 Ga0501083_0018939 3300049744 Unclassified 4791
298 Ga0501270_002696 3300049767 Bacteria 1844
299 Ga0501283_018451 3300049779 Bacteria 1098
300 Ga0501044_0202096 3300049823 Bacteria 1945
301 Ga0501045_0023237 3300049824 Unclassified 4443
302 nmdc:mga03n38_35583_c1 3300050490 Bacteria 2134
303 nmdc:mga08y16_15956_c1 3300050511 Bacteria 7897
304 nmdc:mga0n895_130531_c1 3300050512 Bacteria 2538
305 nmdc:mga0n895_64975_c1 3300050512 Bacteria 3611
306 nmdc:mga0rr50_39641_c1 3300050513 Bacteria 3418
307 nmdc:mga0rr50_49907_c1 3300050513 Bacteria 3099
308 nmdc:mga08x19_96824_c1 3300050514 Bacteria 1953
309 Ga0495601_0029900 3300053077 Bacteria 3382
310 Ga0495619_0334308 3300053085 Bacteria 1048
311 Ga0500568_0008485 3300053139 Bacteria 4945
312 Ga0500616_0000410 3300053153 Bacteria 58241
313 Ga0501084_0000680 3300054114 Bacteria 25933
314 Ga0501082_0001782 3300060353 Bacteria 18931
315 Ga0530510_0004444 3300061734 Bacteria 9706
316 2857612946 2857609550 Bacteria 3753890
317 2511180028 2510917027 Bacteria 5287437
318 2511180175 2510917027 Bacteria 5287437
319 2512636636 2512564013 Bacteria 6286191
320 2512732454 2512564039 Bacteria 8739048
321 2512733000 2512564039 Bacteria 8739048
322 2524186282 2524023129 Bacteria 6762600
323 2550905639 2548877040 Bacteria 7507281
324 2552106939 2551306166 Bacteria 9731570
325 2556064244 2554235469 Bacteria 3590176
326 2563930015 2563366752 Bacteria 4961801
327 2571529090 2571042143 Bacteria 6986194
328 2571530250 2571042143 Bacteria 6986194
329 2573039152 2571042588 Bacteria 5045676
330 2578334749 2576861424 Bacteria 5270569
331 2578335697 2576861424 Bacteria 5270569
332 2580933934 2579778775 Bacteria 5360914
333 2587738491 2585428059 Bacteria 8696589
334 2587738637 2585428059 Bacteria 8696589
335 2595315632 2593339198 Bacteria 7267884
336 2601639713 2600255286 Bacteria 5390125
337 2601641036 2600255286 Bacteria 5390125
338 2621272778 2619619294 Bacteria 5575484
339 2643737001 2643221543 Bacteria 6628015
340 2644426850 2643221676 Bacteria 8119172
341 2644427000 2643221676 Bacteria 8119172
342 2644516666 2643221692 Bacteria 7282860
343 2644720498 2643221731 Bacteria 5623886
344 2644726417 2643221732 Bacteria 5756404
345 2672334448 2671180330 Bacteria 5521719
346 2673819675 2671180694 Bacteria 7506943
347 2673820426 2671180694 Bacteria 7506943
348 2705996794 2703719227 Bacteria 5631989
349 2712196649 2711768088 Bacteria 3195027
350 2723602566 2721755693 Bacteria 6126117
351 2728530080 2728368933 Bacteria 7044283
352 2728532219 2728368933 Bacteria 7044283
353 2730138558 2728369359 Bacteria 5621728
354 2738838314 2738541299 Bacteria 4020721
355 2739235027 2738543010 Bacteria 5583595
356 2745167394 2744054657 Bacteria 5016802
357 2753809307 2751185905 Bacteria 6142767
358 2793181701 2791355222 Bacteria 5898266
359 2802439082 2802428803 Bacteria 5806948
360 2808869741 2808606364 Bacteria 4465927
361 2816863290 2816332186 Bacteria 5331395
362 2817482335 2816332295 Bacteria 4352468
363 2817620590 2816332336 Bacteria 5207640
364 2819567444 2818991441 Bacteria 5062707
365 2819627814 2818991451 Bacteria 4697364
366 2819669305 2818991459 Bacteria 8736032
367 2819669432 2818991459 Bacteria 8736032
368 2819711001 2818991465 Bacteria 5388835
369 2821115617 2821111986 Bacteria 6894338
370 2831908490 2831905167 Bacteria 3319172
371 2842688181 2842682962 Bacteria 5589973
372 2842886438 2842882022 Bacteria 6158489
373 2849140172 2849139964 Bacteria 5613304
374 2857453600 2857453340 Bacteria 8090534
375 2857461228 2857460504 Bacteria 5194327
376 2857462939 2857460504 Bacteria 5194327
377 2857467778 2857465823 Bacteria 6772595
378 2857469985 2857465823 Bacteria 6772595
379 2857585035 2857581216 Bacteria 5522813
380 2857591675 2857591370 Bacteria 6569758
381 2857594702 2857591370 Bacteria 6569758
382 2857606799 2857604169 Bacteria 5111450
383 2857607050 2857604169 Bacteria 5111450
384 2857607399 2857604169 Bacteria 5111450
385 2864738016 2864733723 Bacteria 6770668
386 2864997892 2864997549 Bacteria 5139696
387 2865003617 2865002811 Bacteria 6333767
388 2881640639 2881636855 Bacteria 5205297
389 2881641471 2881636855 Bacteria 5205297
390 2881648449 2881644220 Bacteria 5302661
391 2885531129 2885526491 Bacteria 7164189
392 2888580094 2888578766 Bacteria 6743310
393 2888581098 2888578766 Bacteria 6743310
394 2889050225 2889049205 Bacteria 7524325
395 2889278533 2889276214 Bacteria 5979355
396 2889297264 2889295896 Bacteria 4704906
397 2898909904 2898907183 Bacteria 4067722
398 2898910489 2898907183 Bacteria 4067722
399 2904118221 2904113452 Bacteria 7796941
400 2904166610 2904162308 Bacteria 7086713
401 2904528851 2904524088 Bacteria 5887454
402 2904600301 2904595352 Bacteria 6124848
403 2904757412 2904755435 Bacteria 7986759
404 2904761856 2904755435 Bacteria 7986759
405 2904761996 2904755435 Bacteria 7986759
406 2915597358 2915597211 Bacteria 6475886
407 2915607260 2915606848 Bacteria 6032732
408 2915611431 2915606848 Bacteria 6032732
409 2916973199 2916971899 Bacteria 4250608
410 2916975656 2916971899 Bacteria 4250608
411 2919148481 2919143609 Bacteria 6219228
412 2919418513 2919414237 Bacteria 5429133
413 2919419433 2919414237 Bacteria 5429133
414 2919429849 2919425241 Bacteria 8055701
415 2919430791 2919425241 Bacteria 8055701
416 2919521750 2919517244 Bacteria 5858162
417 2919716638 2919713450 Bacteria 7431245
418 2919724880 2919720352 Bacteria 5986006
419 2925331643 2925326138 Bacteria 9652120
420 2925332513 2925326138 Bacteria 9652120
421 2928098173 2928093941 Bacteria 5965005
422 2928514422 2928510474 Bacteria 4815308
423 2929007607 2929004312 Bacteria 5678476
424 2929188812 2929183550 Bacteria 6377511
425 2929206948 2929206907 Bacteria 5918291
426 2936364660 2936361878 Bacteria 5632809
427 2938653613 2938649242 Bacteria 7118381
428 2938653856 2938649242 Bacteria 7118381
429 2939682433 2939679117 Bacteria 6921672
430 2939703944 2939702853 Bacteria 5139229
431 2956897967 2956897341 Bacteria 5447711
432 2960321420 2960319331 Bacteria 5502575
433 2960378346 2960375949 Bacteria 5361395
434 2964377773 2964375228 Bacteria 4909004
435 2964379155 2964375228 Bacteria 4909004
436 2968560884 2968558590 Bacteria 6956864
437 2968561160 2968558590 Bacteria 6956864
438 2971406416 2971403814 Bacteria 7370929
439 2971410003 2971403814 Bacteria 7370929
440 2971411040 2971410472 Bacteria 8311090
441 2971416029 2971410472 Bacteria 8311090
442 2971513342 2971511577 Bacteria 5404012
443 2971514876 2971511577 Bacteria 5404012
444 2977258863 2977254563 Bacteria 4828420
445 2979089698 2979083700 Bacteria 5894929
446 2980128947 2980125574 Bacteria 5567337
447 2980179298 2980176882 Bacteria 5397533
448 2980180982 2980176882 Bacteria 5397533
449 2980186498 2980182181 Bacteria 9454109
450 2980189807 2980182181 Bacteria 9454109
451 2981285743 2981284811 Bacteria 4641497
452 2981290690 2981289755 Bacteria 4641509
453 2981980688 2981980479 Bacteria 4641628
454 2981985566 2981985349 Bacteria 4641497
455 2988226400 2988225383 Bacteria 7221625
456 2988226869 2988225383 Bacteria 7221625
457 2990279883 2990275345 Bacteria 4887158
458 2996633379 2996632988 Bacteria 6921523
459 2996639313 2996632988 Bacteria 6921523
460 2996709323 2996706504 Bacteria 5757485
461 3001893934 3001892409 Bacteria 6328293
462 3006827215 3006826541 Bacteria 4678913
463 3006862766 3006858327 Bacteria 4317835
464 3006970956 3006969106 Bacteria 4739423
465 648168938 648028048 Bacteria 5394884
466 8022894468 8022893055 Bacteria 5300455
467 8022918420 8022914991 Bacteria 5584517
468 8022954055 8022948649 Bacteria 5366783
469 8054280861 8054280661 Bacteria 4232245
470 8054472146 8054465665 Bacteria 7323556
471 8054798298 8054795415 Bacteria 9785225
472 8055635704 8055632911 Bacteria 5283357
473 8055637493 8055632911 Bacteria 5283357
474 8055637892 8055632911 Bacteria 5283357
475 8056534140 8056533031 Bacteria 8964429
476 8056536417 8056533031 Bacteria 8964429
477 8057477717 8057473075 Bacteria 5892720
478 8057585874 8057582654 Bacteria 5218944
479 8057978970 8057977335 Bacteria 5694872
480 JGI25151J46595_10002747
481 JGI25151J46595_10005640
482 JGI25151J46595_10007802
483 JGI25151J46595_10040976
484 rootL2_10005378
485 rootL2_10186512
486 rootH1_10090058
487 rootH1_10145168
488 Ga0006562J51391_1001817
489 Ga0055538_1000104
490 Ga0055538_1000302
491 Ga0055538_1000443
492 Ga0055535_1006391
493 Ga0055528_1022264
494 Ga0065712_10071811
495 Ga0070676_10013502
496 Ga0070676_10210609
497 Ga0070690_100000401
498 Ga0070690_100018215
499 Ga0070670_100020231
500 Ga0070680_100039523
501 Ga0068868_100174718
502 Ga0068868_100328320
503 Ga0070689_100004753
504 Ga0070668_100153844
505 Ga0070669_100010084
506 Ga0070669_100078636
507 Ga0070675_100067071
508 Ga0070671_100016550
509 Ga0070673_100241765
510 Ga0070701_10002972
511 Ga0070694_100149818
512 Ga0070678_100016891
513 Ga0070681_10141073
514 Ga0070684_100002854
515 Ga0070697_100325652
516 Ga0068853_100060219
517 Ga0070672_100019672
518 Ga0070672_100052122
519 Ga0070672_100140946
520 Ga0070686_100004233
521 Ga0070665_100035752
522 Ga0068861_100031392
523 Ga0068863_100085276
524 Ga0068863_100137187
525 Ga0075362_10071584
526 Ga0075434_100009274
527 Ga0075434_100011370
528 Ga0068865_100003001
529 Ga0068865_100062454
530 Ga0075436_100001974
531 Ga0075435_100012029
532 Ga0075435_100262029
533 Ga0099794_10047420
534 Ga0105251_10007602
535 Ga0105244_10005909
536 Ga0105250_10002946
537 Ga0111539_10020249
538 Ga0111539_10022877
539 Ga0105247_10003158
540 Ga0105243_10000830
541 Ga0105242_10004458
542 Ga0105242_10004754
543 Ga0105248_10017057
544 Ga0105239_10146129
545 Ga0105246_10013556
546 Ga0157326_1001275
547 Ga0157369_10223733
548 Ga0157374_10003527
549 Ga0157372_10093683
550 Ga0157376_10002391
551 Ga0209784_100038
552 Ga0209784_100114
553 Ga0209784_100312
554 Ga0209566_100490
555 Ga0209566_100644
556 Ga0209147_100098
557 Ga0209147_102694
558 Ga0209676_1001089
559 Ga0209676_1011471
560 Ga0209676_1012072
561 Ga0209025_1000684
562 Ga0209025_1000698
563 Ga0209025_1002223
564 Ga0209025_1002248
565 Ga0209025_1008116
566 Ga0209025_1019957
567 Ga0209025_1027312
568 Ga0209025_1032145
569 Ga0207696_1030602
570 Ga0207655_1006608
571 Ga0207655_1018248
572 Ga0207713_1001728
573 Ga0207713_1022398
574 Ga0207642_10099040
575 Ga0207688_10081531
576 Ga0207645_10020676
577 Ga0207707_10003545
578 Ga0207707_10204908
579 Ga0207662_10004935
580 Ga0207652_10042217
581 Ga0207681_10000877
582 Ga0207709_10003203
583 Ga0207709_10036538
584 Ga0207670_10009123
585 Ga0207670_10020308
586 Ga0207704_10020955
587 Ga0207691_10003882
588 Ga0207691_10111892
589 Ga0207651_10067202
590 Ga0207712_10164646
591 Ga0207668_10112362
592 Ga0207639_10035983
593 Ga0207708_10014290
594 Ga0207641_10117298
595 Ga0207641_10192998
596 Ga0207648_10026918
597 Ga0207675_100045151
598 Ga0207683_10068647
599 Ga0207683_10122890
600 Ga0209371_1015722
601 Ga0207428_10066001
602 Ga0268265_10362959
603 Ga0265318_10000720
604 Ga0265338_10089495
605 Ga0268256_1001244
606 Ga0265320_10088339
607 Ga0265325_10001395
608 Ga0265340_10003562
609 Ga0265316_10001465
610 Ga0265316_10014047
611 Ga0307408_100052199
612 Ga0265313_10000439
613 Ga0265313_10027970
614 Ga0265342_10016846
615 Ga0307405_10203254
616 Ga0307409_100028307
617 Ga0307416_100010597
618 Ga0316580_10014476
619 Ga0316593_10017029
620 Ga0373934_0022783
621 Ga0373954_0085035
622 Ga0373956_0003059
623 Ga0373955_0001694
624 Ga0316574_0009598
625 Ga0373927_0015718
626 Ga0373933_0080844
627 Ga0373947_0009273
628 Ga0373937_0003187
629 Ga0373937_0173696
630 Ga0316582_0008220
631 Ga0316584_0044212
632 Ga0395900_0292377
633 Ga0395901_0047127
634 Ga0395901_0114867
635 Ga0436362_0452241
636 Ga0436362_0833938
637 Ga0439439_0004313
638 Ga0439465_0045857
639 Ga0439433_0006880
640 Ga0439449_0000446
641 Ga0439449_0005709
642 Ga0439462_0019822
643 Ga0466969_0001947
644 Ga0453683_0000922
645 Ga0466966_0138675
646 Ga0466961_0148566
647 Ga0466963_0244653
648 Ga0466968_0026302
649 Ga0466959_0008257
650 Ga0451576_0185552
651 Ga0466967_0008078
652 Ga0466967_0011107
653 Ga0466967_0031457
654 Ga0495627_031136
655 Ga0495603_0053311
656 Ga0495585_0011371
657 Ga0495654_0086002
658 Ga0495586_0014168
659 Ga0495634_0016539
660 Ga0495613_0171667
661 Ga0495660_0020233
662 Ga0495660_0025951
663 Ga0495660_0142166
664 Ga0495604_0070348
665 Ga0495674_0021674
666 Ga0495683_0006183
667 Ga0495602_0093463
668 Ga0495626_0027357
669 Ga0496100_0004587
670 Ga0496101_0000506
671 Ga0496101_0055327
672 Ga0496101_0058527
673 Ga0496101_0140601
674 Ga0496102_0030795
675 Ga0496102_0211413
676 Ga0496103_0026704
677 Ga0496104_0001520
678 Ga0496105_0002680
679 Ga0496106_0000508
680 Ga0496106_0008435
681 Ga0496107_0000306
682 Ga0496108_0003790
683 Ga0496108_0043903
684 Ga0496109_0011467
685 Ga0496109_0286951
686 Ga0496109_0360072
687 Ga0496110_0002559
688 Ga0496110_0003882
689 Ga0496110_0008252
690 Ga0496110_0245770
691 Ga0496111_0035169
692 Ga0496112_0010743
693 Ga0496112_0096585
694 Ga0496113_0006809
695 Ga0496114_0002093
696 Ga0496114_0004154
697 Ga0496114_0014189
698 Ga0496115_0036190
699 Ga0496116_0000369
700 Ga0496116_0000782
701 Ga0496116_0002099
702 Ga0496116_0047794
703 Ga0496116_0086493
704 Ga0496116_0117736
705 Ga0496117_0115613
706 Ga0496119_0002498
707 Ga0496119_0082055
708 Ga0496121_0020762
709 Ga0496121_0158457
710 Ga0496122_0014821
711 Ga0496122_0020320
712 Ga0496122_0026458
713 Ga0496122_0035127
714 Ga0496122_0088950
715 Ga0496122_0122408
716 Ga0496122_0173053
717 Ga0496123_0021762
718 Ga0496123_0025686
719 Ga0496124_0001306
720 Ga0496124_0056383
721 Ga0496124_0093719
722 Ga0496124_0236819
723 Ga0496125_0000188
724 Ga0496125_0000340
725 Ga0496125_0001413
726 Ga0496125_0002751
727 Ga0496125_0003803
728 Ga0496125_0006643
729 Ga0496125_0007141
730 Ga0496125_0008061
731 Ga0496126_0005208
732 Ga0496126_0038524
733 Ga0496126_0138490
734 Ga0501294_005062
735 Ga0501298_000289
736 Ga0501299_000532
737 Ga0501312_008257
738 Ga0501315_007718
739 Ga0501336_001887
740 Ga0501031_0257830
741 Ga0501034_0003237
742 Ga0501034_0365922
743 Ga0501037_0052553
744 Ga0501038_0001462
745 Ga0501039_0000639
746 Ga0501040_0000116
747 Ga0501041_0000204
748 Ga0501042_0000125
749 Ga0501043_0002822
750 Ga0501047_0032743
751 Ga0501048_0002239
752 Ga0501067_0008145
753 Ga0501068_0081773
754 Ga0501069_0044892
755 Ga0501070_0000187
756 Ga0501071_0001701
757 Ga0501072_0076083
758 Ga0501073_0004575
759 Ga0501074_0024374
760 Ga0501075_0000183
761 Ga0501076_0156301
762 Ga0501077_0000382
763 Ga0501198_001066
764 Ga0501217_001194
765 Ga0501223_002974
766 Ga0501233_005530
767 Ga0501243_000215
768 Ga0501246_003729
769 Ga0501259_000850
770 Ga0501261_004928
771 Ga0501225_0001083
772 Ga0501234_003901
773 Ga0501079_0000265
774 Ga0501080_0003230
775 Ga0501081_0000367
776 Ga0501083_0018939
777 Ga0501270_002696
778 Ga0501283_018451
779 Ga0501044_0202096
780 Ga0501045_0023237
781 nmdc:mga03n38_35583_c1
782 nmdc:mga08y16_15956_c1
783 nmdc:mga0n895_130531_c1
784 nmdc:mga0n895_64975_c1
785 nmdc:mga0rr50_39641_c1
786 nmdc:mga0rr50_49907_c1
787 nmdc:mga08x19_96824_c1
788 Ga0495601_0029900
789 Ga0495619_0334308
790 Ga0500568_0008485
791 Ga0500616_0000410
792 Ga0501084_0000680
793 Ga0501082_0001782
794 Ga0530510_0004444
795 2857612946
796 2511180028
797 2511180175
798 2512636636
799 2512732454
800 2512733000
801 2524186282
802 2550905639
803 2552106939
804 2556064244
805 2563930015
806 2571529090
807 2571530250
808 2573039152
809 2578334749
810 2578335697
811 2580933934
812 2587738491
813 2587738637
814 2595315632
815 2601639713
816 2601641036
817 2621272778
818 2643737001
819 2644426850
820 2644427000
821 2644516666
822 2644720498
823 2644726417
824 2672334448
825 2673819675
826 2673820426
827 2705996794
828 2712196649
829 2723602566
830 2728530080
831 2728532219
832 2730138558
833 2738838314
834 2739235027
835 2745167394
836 2753809307
837 2793181701
838 2802439082
839 2808869741
840 2816863290
841 2817482335
842 2817620590
843 2819567444
844 2819627814
845 2819669305
846 2819669432
847 2819711001
848 2821115617
849 2831908490
850 2842688181
851 2842886438
852 2849140172
853 2857453600
854 2857461228
855 2857462939
856 2857467778
857 2857469985
858 2857585035
859 2857591675
860 2857594702
861 2857606799
862 2857607050
863 2857607399
864 2864738016
865 2864997892
866 2865003617
867 2881640639
868 2881641471
869 2881648449
870 2885531129
871 2888580094
872 2888581098
873 2889050225
874 2889278533
875 2889297264
876 2898909904
877 2898910489
878 2904118221
879 2904166610
880 2904528851
881 2904600301
882 2904757412
883 2904761856
884 2904761996
885 2915597358
886 2915607260
887 2915611431
888 2916973199
889 2916975656
890 2919148481
891 2919418513
892 2919419433
893 2919429849
894 2919430791
895 2919521750
896 2919716638
897 2919724880
898 2925331643
899 2925332513
900 2928098173
901 2928514422
902 2929007607
903 2929188812
904 2929206948
905 2936364660
906 2938653613
907 2938653856
908 2939682433
909 2939703944
910 2956897967
911 2960321420
912 2960378346
913 2964377773
914 2964379155
915 2968560884
916 2968561160
917 2971406416
918 2971410003
919 2971411040
920 2971416029
921 2971513342
922 2971514876
923 2977258863
924 2979089698
925 2980128947
926 2980179298
927 2980180982
928 2980186498
929 2980189807
930 2981285743
931 2981290690
932 2981980688
933 2981985566
934 2988226400
935 2988226869
936 2990279883
937 2996633379
938 2996639313
939 2996709323
940 3001893934
941 3006827215
942 3006862766
943 3006970956
944 648168938
945 8022894468
946 8022918420
947 8022954055
948 8054280861
949 8054472146
950 8054798298
951 8055635704
952 8055637493
953 8055637892
954 8056534140
955 8056536417
956 8057477717
957 8057585874
958 8057978970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

166

379

0.99

PF05222

AlaDh_PNT_N

Alanine dehydrogenase/PNT, N-terminal domain

30

162

0.99

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

195

251

0.93

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

153

251

0.86

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

175

319

0.85

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

195

295

0.85

PF01488

Shikimate_DH

Shikimate / quinate 5-dehydrogenase

186

296

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hye-assembly1.cif.gz_C-2 structure of amino acid dehydrogenase-2752 with ligand 0.9592 1 347
8hye-assembly1.cif.gz_B-2 structure of amino acid dehydrogenase-2752 with ligand 0.9585 1 347
8hyh-assembly1.cif.gz_A structure of amino acid dehydrogenase3448 0.9538 1 347
8hye-assembly1.cif.gz_C-2 structure of amino acid dehydrogenase-2752 with ligand 0.9486 1 347
8hye-assembly1.cif.gz_B-2 structure of amino acid dehydrogenase-2752 with ligand 0.9478 1 347
ID Description Score Start End Superfamily
af_Q2FXL7_2_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9972 3 109 3.40.50.720
af_P9WQB1_2_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.996 3 113 3.40.50.720
af_Q2FYJ2_1_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9928 1 126 3.40.50.720
af_P9WQB1_2_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9785 3 113 3.40.50.720
af_Q2FXL7_2_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9698 3 109 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7G3D7S1-F1-model_v4 deleted 1.006 1 83
AF-A0A6I3EDQ2-F1-model_v4 Alanine dehydrogenase 1.005 1 78 GO:0000286
GO:0005886
GO:0006524
AF-A0A7Y7IS93-F1-model_v4 Alanine dehydrogenase 1.004 1 94 GO:0000286
GO:0005886
GO:0006524
AF-A0A7W0ZIX3-F1-model_v4 Alanine dehydrogenase 1.002 1 85 GO:0000286
GO:0005886
GO:0006524
AF-A0A2V6KGK6-F1-model_v4 Alanine dehydrogenase 1.002 1 81 GO:0000286
GO:0005886
GO:0006524

Map