F452053

General Info

Members Datasets Scaffolds Average Seq Length
479 300 479 201

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1001019|Ga0209758_100101936
Length 200
Sequence MPQRLSWLEGRRLLAVLTLSSIASMRQFDVDGIRMVIRFTARSSLLLFCLAFSAAALARLWPNPWTRWQRRNRRYLGLSFAASHVIHAIAIVVFAKMDPAGFAQATSPASYIFGGIGYLVIIAMSATSLDRTAALIGPRAWRALHLAGGYYLWLQFMVSFGKRVPATPVYAAFLIPLLAVMALRMIAMAAHPRARTAKAS

Samples

Sample ID Description Type Environment
1 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
271 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
272 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
273 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
274 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
275 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
276 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
277 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
280 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
281 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
282 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
283 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
284 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
287 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
288 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
289 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
290 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
291 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
292 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
293 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
294 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
297 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
298 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
299 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
300 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.03
Nodule 0.21
Rhizoplane 3.76
Rhizosphere 72.86
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1012565 3300002070 Bacteria 1124
2 JGI25406J46586_10007128 3300003203 Bacteria 5120
3 JGI25153J46596_10016810 3300003215 Bacteria 2913
4 JGI25153J46596_10030939 3300003215 Bacteria 1812
5 JGI25404J52841_10009537 3300003659 Bacteria 2076
6 JGI25404J52841_10041530 3300003659 Bacteria 973
7 JGI25404J52841_10042081 3300003659 Bacteria 966
8 Ga0065707_10044374 3300005295 Bacteria 928
9 Ga0070658_10121049 3300005327 Bacteria 2175
10 Ga0070676_10107497 3300005328 Bacteria 1732
11 Ga0070690_100075495 3300005330 Bacteria 2197
12 Ga0068869_100075370 3300005334 Bacteria 2506
13 Ga0068869_100314908 3300005334 Bacteria 1267
14 Ga0070666_10163143 3300005335 Bacteria 1558
15 Ga0070680_100066291 3300005336 Bacteria 2960
16 Ga0070682_100013375 3300005337 Bacteria 4719
17 Ga0068868_100217417 3300005338 Bacteria 1599
18 Ga0068868_100820026 3300005338 Bacteria 841
19 Ga0070660_100823991 3300005339 Bacteria 781
20 Ga0070689_100639330 3300005340 Bacteria 925
21 Ga0070687_100260552 3300005343 Bacteria 1082
22 Ga0070687_100337714 3300005343 Bacteria 968
23 Ga0070661_100062719 3300005344 Bacteria 2729
24 Ga0070668_100019764 3300005347 Bacteria 5072
25 Ga0070668_100039836 3300005347 Bacteria 3594
26 Ga0070668_100093005 3300005347 Bacteria 2379
27 Ga0070669_100259004 3300005353 Bacteria 1387
28 Ga0070675_100254801 3300005354 Bacteria 1537
29 Ga0070671_100136707 3300005355 Bacteria 2066
30 Ga0070674_100015865 3300005356 Bacteria 4712
31 Ga0070688_100209170 3300005365 Bacteria 1369
32 Ga0070688_100422582 3300005365 Bacteria 991
33 Ga0070659_100295392 3300005366 Bacteria 1350
34 Ga0070659_100392229 3300005366 Bacteria 1171
35 Ga0070703_10037401 3300005406 Bacteria 1495
36 Ga0070709_10007673 3300005434 Bacteria 5920
37 Ga0070709_10106933 3300005434 Bacteria 1874
38 Ga0070709_10537328 3300005434 Bacteria 893
39 Ga0070714_100036434 3300005435 Bacteria 4126
40 Ga0070714_100097835 3300005435 Bacteria 2581
41 Ga0070714_101185685 3300005435 Bacteria 745
42 Ga0070713_100015001 3300005436 Bacteria 5772
43 Ga0070713_100086777 3300005436 Bacteria 2684
44 Ga0070710_10000185 3300005437 Bacteria 28883
45 Ga0070701_10028384 3300005438 Bacteria 2751
46 Ga0070701_10697134 3300005438 Bacteria 683
47 Ga0070711_100035292 3300005439 Bacteria 3342
48 Ga0070694_100795926 3300005444 Bacteria 775
49 Ga0070708_100286239 3300005445 Bacteria 1551
50 Ga0070663_100025066 3300005455 Bacteria 4023
51 Ga0070663_100044345 3300005455 Bacteria 3134
52 Ga0070663_100118444 3300005455 Bacteria 1998
53 Ga0070663_100170377 3300005455 Bacteria 1682
54 Ga0070678_100032116 3300005456 Bacteria 3630
55 Ga0070678_100147623 3300005456 Bacteria 1890
56 Ga0070662_100159250 3300005457 Bacteria 1765
57 Ga0070662_100293937 3300005457 Bacteria 1318
58 Ga0070681_10017045 3300005458 Bacteria 7260
59 Ga0068867_100113318 3300005459 Bacteria 2086
60 Ga0070698_100255787 3300005471 Bacteria 1684
61 Ga0070699_100102158 3300005518 Bacteria 2514
62 Ga0070679_100006634 3300005530 Bacteria 10791
63 Ga0070679_100097259 3300005530 Bacteria 2931
64 Ga0070686_100207753 3300005544 Bacteria 1407
65 Ga0070695_100144123 3300005545 Bacteria 1656
66 Ga0070693_100144919 3300005547 Bacteria 1499
67 Ga0070665_100011962 3300005548 Bacteria 8763
68 Ga0070665_100131553 3300005548 Bacteria 2504
69 Ga0070665_100432286 3300005548 Bacteria 1325
70 Ga0070665_100437186 3300005548 Bacteria 1317
71 Ga0070665_100439781 3300005548 Bacteria 1313
72 Ga0068855_100256951 3300005563 Bacteria 1947
73 Ga0068855_100271859 3300005563 Bacteria 1884
74 Ga0068855_101402894 3300005563 Bacteria 720
75 Ga0070664_100519491 3300005564 Bacteria 1099
76 Ga0068854_100822195 3300005578 Bacteria 811
77 Ga0068854_101002497 3300005578 Bacteria 740
78 Ga0068854_101126954 3300005578 Bacteria 700
79 Ga0068859_100093160 3300005617 Bacteria 3064
80 Ga0068859_100348516 3300005617 Bacteria 1576
81 Ga0068859_100649969 3300005617 Bacteria 1146
82 Ga0068859_100656591 3300005617 Bacteria 1141
83 Ga0068864_100059092 3300005618 Bacteria 3316
84 Ga0068864_100469851 3300005618 Bacteria 1206
85 Ga0068866_10006477 3300005718 Bacteria 4878
86 Ga0068866_10213997 3300005718 Bacteria 1159
87 Ga0068861_100025502 3300005719 Bacteria 4288
88 Ga0068861_100030146 3300005719 Bacteria 3973
89 Ga0068861_100794738 3300005719 Bacteria 887
90 Ga0068858_100101792 3300005842 Bacteria 2679
91 Ga0068860_100175756 3300005843 Bacteria 2069
92 Ga0068860_100603177 3300005843 Bacteria 1103
93 Ga0068862_100084570 3300005844 Bacteria 2756
94 Ga0068862_100196478 3300005844 Bacteria 1817
95 Ga0068862_100204370 3300005844 Bacteria 1782
96 Ga0068862_100292327 3300005844 Bacteria 1497
97 Ga0068862_100458789 3300005844 Bacteria 1202
98 Ga0068862_100828097 3300005844 Bacteria 905
99 Ga0081455_10007056 3300005937 Bacteria 11924
100 Ga0081455_10029262 3300005937 Bacteria 5024
101 Ga0081455_10064680 3300005937 Bacteria 3062
102 Ga0081540_1002478 3300005983 Bacteria 15036
103 Ga0081540_1002562 3300005983 Bacteria 14747
104 Ga0081540_1004408 3300005983 Bacteria 10747
105 Ga0081540_1006093 3300005983 Bacteria 8860
106 Ga0081540_1007065 3300005983 Bacteria 8067
107 Ga0081540_1012964 3300005983 Bacteria 5446
108 Ga0081540_1013086 3300005983 Bacteria 5419
109 Ga0081539_10000486 3300005985 Bacteria 84009
110 Ga0081539_10085530 3300005985 Bacteria 1644
111 Ga0070717_10057553 3300006028 Bacteria 3214
112 Ga0070717_10217838 3300006028 Bacteria 1677
113 Ga0075365_10006792 3300006038 Bacteria 6337
114 Ga0075365_10175839 3300006038 Bacteria 1495
115 Ga0075368_10113182 3300006042 Bacteria 1120
116 Ga0075363_100028255 3300006048 Bacteria 2883
117 Ga0075364_10021799 3300006051 Bacteria 4039
118 Ga0075364_10240904 3300006051 Bacteria 1229
119 Ga0075364_10391883 3300006051 Bacteria 948
120 Ga0070716_100019435 3300006173 Bacteria 3550
121 Ga0070716_100084904 3300006173 Bacteria 1900
122 Ga0070716_100159351 3300006173 Bacteria 1460
123 Ga0070716_100775135 3300006173 Bacteria 740
124 Ga0070712_100065023 3300006175 Bacteria 2588
125 Ga0070712_100478234 3300006175 Bacteria 1041
126 Ga0075367_10026613 3300006178 Bacteria 3283
127 Ga0075367_10026845 3300006178 Bacteria 3269
128 Ga0075367_10085449 3300006178 Bacteria 1914
129 Ga0075367_10129308 3300006178 Bacteria 1560
130 Ga0075367_10328477 3300006178 Bacteria 964
131 Ga0075369_10026954 3300006186 Bacteria 2399
132 Ga0075369_10160754 3300006186 Bacteria 1029
133 Ga0075366_10023098 3300006195 Bacteria 3623
134 Ga0075366_10196434 3300006195 Bacteria 1226
135 Ga0075370_10067383 3300006353 Bacteria 2043
136 Ga0068871_100063453 3300006358 Bacteria 3022
137 Ga0097620_100093164 3300006931 Bacteria 3064
138 Ga0097620_100348511 3300006931 Bacteria 1576
139 Ga0097620_100649974 3300006931 Bacteria 1146
140 Ga0097620_100656585 3300006931 Bacteria 1141
141 Ga0075435_100114068 3300007076 Bacteria 2249
142 Ga0099795_10007051 3300007788 Bacteria 3110
143 Ga0105250_10095434 3300009092 Bacteria 1212
144 Ga0105240_10043416 3300009093 Bacteria 5720
145 Ga0105245_10032237 3300009098 Bacteria 4640
146 Ga0105243_10248248 3300009148 Bacteria 1587
147 Ga0105243_10322101 3300009148 Bacteria 1409
148 Ga0105241_10443461 3300009174 Bacteria 1147
149 Ga0105248_10017088 3300009177 Bacteria 7991
150 Ga0105248_10266131 3300009177 Bacteria 1930
151 Ga0105237_10091068 3300009545 Bacteria 3039
152 Ga0105249_10102870 3300009553 Bacteria 2689
153 Ga0105249_10105874 3300009553 Bacteria 2652
154 Ga0099796_10023998 3300010159 Bacteria 1910
155 Ga0099796_10034190 3300010159 Bacteria 1677
156 Ga0105239_10158803 3300010375 Bacteria 2526
157 Ga0105239_10209518 3300010375 Bacteria 2185
158 Ga0105239_10523857 3300010375 Bacteria 1349
159 Ga0105239_11012495 3300010375 Bacteria 955
160 Ga0157374_10032387 3300013296 Bacteria 4759
161 Ga0157378_10020349 3300013297 Bacteria 5837
162 Ga0157378_10400208 3300013297 Bacteria 1353
163 Ga0157378_10812257 3300013297 Bacteria 961
164 Ga0163162_10138467 3300013306 Bacteria 2545
165 Ga0163162_10227227 3300013306 Bacteria 1996
166 Ga0163163_10696864 3300014325 Bacteria 1079
167 Ga0157380_10024326 3300014326 Bacteria 4582
168 Ga0157379_10393723 3300014968 Bacteria 1273
169 Ga0157379_10401095 3300014968 Bacteria 1261
170 Ga0157379_10457309 3300014968 Bacteria 1179
171 Ga0157376_10085877 3300014969 Bacteria 2712
172 Ga0163161_10109376 3300017792 Bacteria 2065
173 Ga0163161_10208081 3300017792 Bacteria 1510
174 Ga0213873_10043727 3300021358 Bacteria 1163
175 Ga0213872_10106064 3300021361 Bacteria 1251
176 Ga0213876_10357095 3300021384 Bacteria 777
177 Ga0209758_1001019 3300025297 Bacteria 37066
178 Ga0209758_1001709 3300025297 Bacteria 24609
179 Ga0209758_1009213 3300025297 Bacteria 6196
180 Ga0207426_1057930 3300025302 Bacteria 1126
181 Ga0207653_10004133 3300025885 Bacteria 4565
182 Ga0207692_10003679 3300025898 Bacteria 6009
183 Ga0207642_10036365 3300025899 Bacteria 2112
184 Ga0207688_10014229 3300025901 Bacteria 4329
185 Ga0207680_10307158 3300025903 Bacteria 1107
186 Ga0207699_10020327 3300025906 Bacteria 3556
187 Ga0207699_10028812 3300025906 Bacteria 3091
188 Ga0207699_10347146 3300025906 Bacteria 1047
189 Ga0207645_10078713 3300025907 Bacteria 2112
190 Ga0207705_10086931 3300025909 Bacteria 2285
191 Ga0207707_10000754 3300025912 Bacteria 31878
192 Ga0207695_10058461 3300025913 Bacteria 4002
193 Ga0207671_10074867 3300025914 Bacteria 2531
194 Ga0207693_10368263 3300025915 Bacteria 1124
195 Ga0207663_10137935 3300025916 Bacteria 1695
196 Ga0207660_10006213 3300025917 Bacteria 7757
197 Ga0207662_10092353 3300025918 Bacteria 1863
198 Ga0207657_10264481 3300025919 Bacteria 1368
199 Ga0207649_10286832 3300025920 Bacteria 1199
200 Ga0207652_10105850 3300025921 Bacteria 2489
201 Ga0207652_10215980 3300025921 Bacteria 1727
202 Ga0207681_10285464 3300025923 Bacteria 1301
203 Ga0207694_10192236 3300025924 Bacteria 1658
204 Ga0207659_10278826 3300025926 Bacteria 1366
205 Ga0207687_10148899 3300025927 Bacteria 1784
206 Ga0207700_10041399 3300025928 Bacteria 3370
207 Ga0207664_10055506 3300025929 Bacteria 3143
208 Ga0207644_10369327 3300025931 Bacteria 1168
209 Ga0207690_10111101 3300025932 Bacteria 1974
210 Ga0207706_10033314 3300025933 Bacteria 4587
211 Ga0207706_10097958 3300025933 Bacteria 2579
212 Ga0207706_10416016 3300025933 Bacteria 1165
213 Ga0207686_10038456 3300025934 Bacteria 2895
214 Ga0207686_10135583 3300025934 Bacteria 1694
215 Ga0207669_10197044 3300025937 Bacteria 1458
216 Ga0207704_10024331 3300025938 Bacteria 3282
217 Ga0207665_10310177 3300025939 Bacteria 1182
218 Ga0207691_10041318 3300025940 Bacteria 4258
219 Ga0207711_10070547 3300025941 Bacteria 3030
220 Ga0207711_10091611 3300025941 Bacteria 2674
221 Ga0207689_10026793 3300025942 Bacteria 4827
222 Ga0207689_10196556 3300025942 Bacteria 1665
223 Ga0207667_10032271 3300025949 Bacteria 5645
224 Ga0207667_10053636 3300025949 Bacteria 4242
225 Ga0207712_10009636 3300025961 Bacteria 6119
226 Ga0207668_10035915 3300025972 Bacteria 3305
227 Ga0207668_10170425 3300025972 Bacteria 1706
228 Ga0207668_10228518 3300025972 Bacteria 1498
229 Ga0207677_10357392 3300026023 Bacteria 1226
230 Ga0207639_10221290 3300026041 Bacteria 1635
231 Ga0207678_10028714 3300026067 Bacteria 4856
232 Ga0207678_10050648 3300026067 Bacteria 3587
233 Ga0207678_10085368 3300026067 Bacteria 2699
234 Ga0207678_10088654 3300026067 Bacteria 2644
235 Ga0207708_10226660 3300026075 Bacteria 1499
236 Ga0207702_10088262 3300026078 Bacteria 2709
237 Ga0207648_10076107 3300026089 Bacteria 2925
238 Ga0207676_10237631 3300026095 Bacteria 1632
239 Ga0207674_10193283 3300026116 Bacteria 1985
240 Ga0207675_100032581 3300026118 Bacteria 4855
241 Ga0207675_100035549 3300026118 Bacteria 4647
242 Ga0207675_100207716 3300026118 Bacteria 1882
243 Ga0207683_10053188 3300026121 Bacteria 3550
244 Ga0207683_10178032 3300026121 Bacteria 1928
245 Ga0207698_11085618 3300026142 Bacteria 813
246 Ga0209179_1002205 3300027512 Bacteria 2587
247 Ga0209813_10092134 3300027866 Bacteria 1019
248 Ga0268266_10082633 3300028379 Bacteria 2802
249 Ga0268266_10308021 3300028379 Bacteria 1479
250 Ga0268266_10595550 3300028379 Bacteria 1062
251 Ga0268265_10115544 3300028380 Bacteria 2200
252 Ga0268265_10120266 3300028380 Bacteria 2162
253 Ga0268265_10376518 3300028380 Bacteria 1304
254 Ga0268265_10998731 3300028380 Bacteria 826
255 Ga0268264_10121075 3300028381 Bacteria 2306
256 Ga0307517_10279553 3300028786 Bacteria 953
257 Ga0265330_10032562 3300031235 Bacteria 2335
258 Ga0265328_10051666 3300031239 Bacteria 1509
259 Ga0265340_10009829 3300031247 Bacteria 5124
260 Ga0265339_10130901 3300031249 Bacteria 1283
261 Ga0265316_10130169 3300031344 Bacteria 1896
262 Ga0307509_10232973 3300031507 Bacteria 1642
263 Ga0307408_100144177 3300031548 Bacteria 1873
264 Ga0307408_100826674 3300031548 Bacteria 843
265 Ga0265314_10099962 3300031711 Bacteria 1867
266 Ga0265342_10182555 3300031712 Bacteria 1148
267 Ga0307406_10312459 3300031901 Bacteria 1212
268 Ga0307407_10336194 3300031903 Bacteria 1065
269 Ga0307412_10183174 3300031911 Bacteria 1577
270 Ga0307416_100608622 3300032002 Bacteria 1173
271 Ga0307416_100675331 3300032002 Bacteria 1120
272 Ga0307415_100726089 3300032126 Bacteria 899
273 Ga0307510_10003336 3300033180 Bacteria 18711
274 Ga0307510_10200054 3300033180 Bacteria 1534
275 Ga0315911_1000010 3300033442 Bacteria 322197
276 Ga0373926_0030543 3300035083 Bacteria 1897
277 Ga0373926_0271783 3300035083 Bacteria 659
278 Ga0373934_0122648 3300035086 Bacteria 1057
279 Ga0373940_0126521 3300035088 Bacteria 797
280 Ga0373944_0041320 3300035089 Bacteria 1426
281 Ga0373923_0014135 3300035111 Bacteria 2993
282 Ga0373923_0017895 3300035111 Bacteria 2717
283 Ga0373945_0066726 3300035116 Bacteria 1353
284 Ga0373954_0115899 3300035118 Bacteria 1298
285 Ga0373943_0002869 3300035170 Bacteria 7824
286 Ga0373955_0006124 3300035172 Bacteria 5464
287 Ga0373924_0011746 3300035410 Bacteria 3258
288 Ga0373935_0000757 3300035692 Bacteria 17195
289 Ga0373935_0102867 3300035692 Bacteria 1885
290 Ga0373927_0001069 3300035695 Bacteria 20955
291 Ga0373927_0010098 3300035695 Bacteria 6318
292 Ga0373927_0329640 3300035695 Bacteria 1005
293 Ga0373933_0581505 3300035724 Bacteria 735
294 Ga0373947_0003046 3300035725 Bacteria 9970
295 Ga0373937_0102931 3300036401 Bacteria 2651
296 Ga0373925_0010697 3300037068 Bacteria 6654
297 Ga0373925_0188069 3300037068 Bacteria 1637
298 Ga0395905_0089462 3300037471 Bacteria 2886
299 Ga0436365_1560328 3300039437 Bacteria 1917
300 Ga0436360_1114925 3300039438 Bacteria 1025
301 Ga0436360_1154752 3300039438 Bacteria 1319
302 Ga0436360_1262818 3300039438 Bacteria 1189
303 Ga0436361_0990038 3300039447 Bacteria 1866
304 Ga0436361_1079148 3300039447 Bacteria 1692
305 Ga0436362_1240820 3300039453 Bacteria 6215
306 Ga0439465_0030457 3300041413 Bacteria 1717
307 Ga0451793_0061689 3300041452 Bacteria 862
308 Ga0466967_0507023 3300045976 Bacteria 1185
309 Ga0495617_052951 3300046452 Bacteria 1348
310 Ga0495603_0000064 3300046455 Bacteria 46716
311 Ga0495603_0004299 3300046455 Bacteria 8492
312 Ga0495603_0042831 3300046455 Bacteria 2705
313 Ga0495638_0009522 3300046460 Bacteria 6810
314 Ga0495641_0004409 3300046461 Bacteria 9961
315 Ga0495641_0092610 3300046461 Bacteria 1350
316 Ga0495651_0171557 3300046462 Bacteria 1544
317 Ga0495580_0019120 3300046472 Bacteria 5092
318 Ga0495580_0063430 3300046472 Bacteria 2592
319 Ga0495582_0000197 3300046473 Bacteria 33437
320 Ga0495605_0102152 3300046474 Bacteria 1317
321 Ga0495605_0125599 3300046474 Bacteria 1160
322 Ga0495639_0000218 3300046475 Bacteria 29492
323 Ga0495639_0075237 3300046475 Bacteria 1565
324 Ga0495662_0002788 3300046476 Bacteria 8833
325 Ga0495664_0002480 3300046477 Bacteria 9934
326 Ga0495664_0026081 3300046477 Bacteria 3403
327 Ga0495594_0007452 3300046499 Bacteria 5630
328 Ga0495607_0246451 3300046501 Bacteria 862
329 Ga0495606_0117589 3300046507 Bacteria 1595
330 Ga0495610_0157796 3300046512 Bacteria 962
331 Ga0495618_0033226 3300046514 Bacteria 3234
332 Ga0495618_0118477 3300046514 Bacteria 1696
333 Ga0495630_0056514 3300046517 Bacteria 2940
334 Ga0495643_0137598 3300046522 Bacteria 1221
335 Ga0495666_0076791 3300046526 Bacteria 1583
336 Ga0495652_0048148 3300046529 Bacteria 3654
337 Ga0495654_0228336 3300046530 Bacteria 784
338 Ga0495665_0000902 3300046531 Bacteria 15623
339 Ga0495665_0031420 3300046531 Bacteria 2842
340 Ga0495640_0001505 3300046533 Bacteria 18356
341 Ga0495587_0284140 3300046536 Bacteria 927
342 Ga0495622_0001436 3300046557 Bacteria 12023
343 Ga0495622_0122667 3300046557 Bacteria 1186
344 Ga0495633_0198218 3300046558 Bacteria 922
345 Ga0495667_0040186 3300046559 Bacteria 3107
346 Ga0495634_0002545 3300046642 Bacteria 15078
347 Ga0495625_0067127 3300046660 Bacteria 2525
348 Ga0495625_0558972 3300046660 Bacteria 692
349 Ga0495635_0000356 3300046663 Bacteria 29094
350 Ga0495661_0272765 3300046665 Bacteria 855
351 Ga0495588_0000619 3300046674 Bacteria 16696
352 Ga0495588_0033223 3300046674 Bacteria 2604
353 Ga0495588_0093628 3300046674 Bacteria 1575
354 Ga0495588_0233331 3300046674 Bacteria 971
355 Ga0495599_0085646 3300046678 Bacteria 1968
356 Ga0495646_0018090 3300046680 Bacteria 4463
357 Ga0495647_0339035 3300046681 Bacteria 683
358 Ga0495658_0004088 3300046683 Bacteria 7185
359 Ga0495669_0002200 3300046684 Bacteria 8005
360 Ga0495613_0001784 3300046689 Bacteria 16356
361 Ga0495613_0121428 3300046689 Bacteria 1876
362 Ga0495624_0001264 3300046690 Bacteria 19934
363 Ga0495600_0378246 3300046809 Bacteria 884
364 Ga0495581_0001121 3300047315 Bacteria 14654
365 Ga0495581_0123154 3300047315 Bacteria 1509
366 Ga0495604_0299827 3300047317 Bacteria 1080
367 Ga0495674_0000910 3300047319 Bacteria 28292
368 Ga0495674_0007674 3300047319 Bacteria 10304
369 Ga0495674_0493307 3300047319 Bacteria 980
370 Ga0495672_0014045 3300047320 Bacteria 5500
371 Ga0495673_0095746 3300047469 Bacteria 1207
372 Ga0495684_0036603 3300047471 Bacteria 3762
373 Ga0495686_0069755 3300047472 Bacteria 2166
374 Ga0495686_0149901 3300047472 Bacteria 1370
375 Ga0495593_0000053 3300047673 Bacteria 47697
376 Ga0495593_0027298 3300047673 Bacteria 3143
377 Ga0495614_0005483 3300048089 Bacteria 5719
378 Ga0495615_0058973 3300048090 Bacteria 1008
379 Ga0495626_0046698 3300048091 Bacteria 2016
380 Ga0496100_0051151 3300048903 Bacteria 2681
381 Ga0496100_0245743 3300048903 Bacteria 1322
382 Ga0496100_0893272 3300048903 Bacteria 698
383 Ga0496101_0139174 3300048904 Bacteria 1849
384 Ga0496102_0081179 3300048905 Bacteria 2989
385 Ga0496102_0484316 3300048905 Bacteria 1159
386 Ga0496104_0127383 3300048907 Bacteria 2445
387 Ga0496106_0005619 3300048909 Bacteria 9280
388 Ga0496106_0066022 3300048909 Bacteria 2755
389 Ga0496106_0373981 3300048909 Bacteria 1145
390 Ga0496108_0044389 3300048911 Bacteria 3711
391 Ga0496108_0264504 3300048911 Bacteria 1497
392 Ga0496109_0902730 3300048912 Bacteria 821
393 Ga0496112_0298664 3300048915 Bacteria 1556
394 Ga0496113_0302782 3300048916 Bacteria 1280
395 Ga0496114_0044410 3300048917 Bacteria 3687
396 Ga0496114_0447670 3300048917 Bacteria 1144
397 Ga0496117_0057193 3300048920 Bacteria 2711
398 Ga0496117_0068003 3300048920 Bacteria 2407
399 Ga0496117_0083188 3300048920 Bacteria 2093
400 Ga0496118_0014444 3300048921 Bacteria 7394
401 Ga0496118_0038391 3300048921 Bacteria 3839
402 Ga0496118_0086192 3300048921 Bacteria 2183
403 Ga0496118_0106819 3300048921 Bacteria 1871
404 Ga0496118_0278785 3300048921 Bacteria 932
405 Ga0496119_0071821 3300048922 Bacteria 2025
406 Ga0496119_0180667 3300048922 Bacteria 1107
407 Ga0496120_0234458 3300048923 Bacteria 870
408 Ga0496121_0000099 3300048924 Bacteria 200160
409 Ga0496121_0011958 3300048924 Bacteria 9547
410 Ga0496121_0016905 3300048924 Bacteria 7499
411 Ga0496121_0032403 3300048924 Bacteria 4750
412 Ga0496121_0150236 3300048924 Bacteria 1715
413 Ga0496121_0189858 3300048924 Bacteria 1474
414 Ga0496121_0285302 3300048924 Bacteria 1127
415 Ga0496122_0039814 3300048925 Bacteria 3743
416 Ga0496123_0094977 3300048926 Bacteria 1755
417 Ga0496124_0008073 3300048927 Bacteria 11067
418 Ga0496124_0012843 3300048927 Bacteria 8228
419 Ga0496125_0000203 3300048928 Bacteria 125569
420 Ga0496125_0022336 3300048928 Bacteria 5878
421 Ga0496125_0097454 3300048928 Bacteria 2179
422 Ga0496125_0110356 3300048928 Bacteria 1995
423 Ga0496125_0131425 3300048928 Bacteria 1761
424 Ga0496126_0025411 3300048929 Bacteria 5698
425 Ga0496126_0127508 3300048929 Bacteria 2201
426 Ga0496126_0131827 3300048929 Bacteria 2159
427 Ga0496126_0166423 3300048929 Bacteria 1881
428 Ga0496126_0424369 3300048929 Bacteria 1074
429 Ga0496126_0721686 3300048929 Bacteria 772
430 Ga0495682_0143414 3300049460 Bacteria 853
431 Ga0501040_0189360 3300049576 Bacteria 1460
432 nmdc:mga00v17_82063_c1 3300050491 Bacteria 2014
433 nmdc:mga0yw44_284771_c1 3300050492 Bacteria 1105
434 nmdc:mga0yw44_5575_c1 3300050492 Bacteria 5973
435 nmdc:mga0k408_106652_c1 3300050493 Bacteria 1655
436 nmdc:mga0k408_119739_c1 3300050493 Bacteria 1559
437 nmdc:mga06z11_17526_c1 3300050494 Bacteria 3252
438 nmdc:mga06z11_299534_c1 3300050494 Bacteria 956
439 nmdc:mga06z11_4441_c1 3300050494 Bacteria 5518
440 nmdc:mga04h51_105805_c1 3300050495 Bacteria 1031
441 nmdc:mga07m45_62635_c1 3300050496 Bacteria 2108
442 nmdc:mga0sz30_23495_c1 3300050516 Bacteria 2179
443 Ga0500610_0223025 3300053079 Bacteria 891
444 Ga0500635_0001315 3300053080 Bacteria 5938
445 Ga0500644_0033125 3300053088 Bacteria 1656
446 Ga0500646_0053515 3300053090 Bacteria 1171
447 Ga0500583_0139345 3300053092 Bacteria 1205
448 Ga0500651_0002318 3300053093 Bacteria 10006
449 Ga0500651_0034467 3300053093 Bacteria 3192
450 Ga0500566_0057900 3300053094 Bacteria 2201
451 Ga0500641_0083172 3300053096 Bacteria 1360
452 Ga0500554_061162 3300053102 Bacteria 1208
453 Ga0500556_0000778 3300053104 Bacteria 18849
454 Ga0500562_108697 3300053108 Bacteria 755
455 Ga0500569_010464 3300053109 Bacteria 2186
456 Ga0500569_062241 3300053109 Bacteria 1155
457 Ga0500592_005878 3300053116 Bacteria 1950
458 Ga0500593_077894 3300053117 Bacteria 1426
459 Ga0500595_007694 3300053119 Bacteria 4455
460 Ga0500595_009666 3300053119 Bacteria 3881
461 Ga0500595_013406 3300053119 Bacteria 3141
462 Ga0500626_060325 3300053128 Bacteria 1697
463 Ga0500642_0000294 3300053130 Bacteria 18100
464 Ga0500652_000507 3300053131 Bacteria 13704
465 Ga0500658_0091595 3300053134 Bacteria 1315
466 Ga0500559_0291717 3300053136 Bacteria 766
467 Ga0500577_0065996 3300053142 Bacteria 1406
468 Ga0500586_012547 3300053145 Bacteria 2469
469 Ga0500603_139587 3300053150 Bacteria 745
470 Ga0500603_170402 3300053150 Bacteria 682
471 Ga0500604_0082202 3300053151 Bacteria 1042
472 Ga0500616_0000180 3300053153 Bacteria 106053
473 Ga0500622_0003781 3300053156 Bacteria 9870
474 Ga0500627_0004149 3300053158 Bacteria 4604
475 Ga0500627_0161743 3300053158 Bacteria 1010
476 Ga0500627_0224504 3300053158 Bacteria 837
477 Ga0500638_017996 3300053162 Bacteria 3290
478 Ga0500636_0136440 3300053177 Bacteria 1362
479 Ga0500637_0174843 3300053178 Bacteria 1232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0424369 Ga0496126_0424369_80_754 186
2 3300003215 JGI25153J46596_10016810 JGI25153J46596_100168103 187
3 3300025297 Ga0209758_1001019 Ga0209758_100101936 187
4 3300047320 Ga0495672_0014045 Ga0495672_0014045_1862_2530 187
5 3300046809 Ga0495600_0378246 Ga0495600_0378246_97_720 188
6 3300003215 JGI25153J46596_10030939 JGI25153J46596_100309392 189
7 3300005718 Ga0068866_10213997 Ga0068866_102139971 189
8 3300010375 Ga0105239_10158803 Ga0105239_101588033 189
9 3300025297 Ga0209758_1001709 Ga0209758_100170916 189
10 3300005471 Ga0070698_100255787 Ga0070698_1002557872 190
11 3300025939 Ga0207665_10310177 Ga0207665_103101771 190
12 3300026023 Ga0207677_10357392 Ga0207677_103573923 190
13 3300033180 Ga0307510_10200054 Ga0307510_102000544 190
14 3300035083 Ga0373926_0271783 Ga0373926_0271783_22_633 190
15 3300035695 Ga0373927_0010098 Ga0373927_0010098_5577_6221 190
16 3300046474 Ga0495605_0102152 Ga0495605_0102152_426_1070 190
17 3300046557 Ga0495622_0122667 Ga0495622_0122667_498_1142 190
18 3300046681 Ga0495647_0339035 Ga0495647_0339035_29_643 190
19 3300048909 Ga0496106_0005619 Ga0496106_0005619_5022_5666 190
20 3300048920 Ga0496117_0068003 Ga0496117_0068003_1529_2173 190
21 3300048921 Ga0496118_0014444 Ga0496118_0014444_2809_3450 190
22 3300048923 Ga0496120_0234458 Ga0496120_0234458_175_819 190
23 3300048924 Ga0496121_0000099 Ga0496121_0000099_5496_6140 190
24 3300048924 Ga0496121_0016905 Ga0496121_0016905_6796_7437 190
25 3300048927 Ga0496124_0008073 Ga0496124_0008073_5636_6280 190
26 3300048928 Ga0496125_0097454 Ga0496125_0097454_418_1062 190
27 3300048928 Ga0496125_0110356 Ga0496125_0110356_186_827 190
28 3300048929 Ga0496126_0025411 Ga0496126_0025411_5027_5671 190
29 3300053080 Ga0500635_0001315 Ga0500635_0001315_476_1120 190
30 3300053094 Ga0500566_0057900 Ga0500566_0057900_1269_1913 190
31 3300053119 Ga0500595_007694 Ga0500595_007694_1728_2372 190
32 3300053150 Ga0500603_139587 Ga0500603_139587_35_679 190
33 3300005436 Ga0070713_100015001 Ga0070713_1000150017 191
34 3300005437 Ga0070710_10000185 Ga0070710_1000018523 191
35 3300005439 Ga0070711_100035292 Ga0070711_1000352924 191
36 3300006173 Ga0070716_100019435 Ga0070716_1000194353 191
37 3300006175 Ga0070712_100065023 Ga0070712_1000650234 191
38 3300009545 Ga0105237_10091068 Ga0105237_100910682 191
39 3300013297 Ga0157378_10812257 Ga0157378_108122572 191
40 3300025898 Ga0207692_10003679 Ga0207692_100036791 191
41 3300025916 Ga0207663_10137935 Ga0207663_101379352 191
42 3300025929 Ga0207664_10055506 Ga0207664_100555062 191
43 3300048920 Ga0496117_0057193 Ga0496117_0057193_1108_1728 191
44 3300048922 Ga0496119_0071821 Ga0496119_0071821_403_1023 191
45 3300048924 Ga0496121_0032403 Ga0496121_0032403_444_1064 191
46 3300048929 Ga0496126_0166423 Ga0496126_0166423_218_862 191
47 3300048929 Ga0496126_0721686 Ga0496126_0721686_28_648 191
48 3300053119 Ga0500595_013406 Ga0500595_013406_537_1157 191
49 3300053128 Ga0500626_060325 Ga0500626_060325_987_1625 191
50 3300053158 Ga0500627_0161743 Ga0500627_0161743_160_780 191
51 3300005338 Ga0068868_100217417 Ga0068868_1002174173 192
52 3300005347 Ga0070668_100019764 Ga0070668_1000197643 192
53 3300005347 Ga0070668_100093005 Ga0070668_1000930052 192
54 3300005365 Ga0070688_100422582 Ga0070688_1004225822 192
55 3300005445 Ga0070708_100286239 Ga0070708_1002862392 192
56 3300005455 Ga0070663_100118444 Ga0070663_1001184441 192
57 3300005456 Ga0070678_100147623 Ga0070678_1001476234 192
58 3300005548 Ga0070665_100011962 Ga0070665_1000119622 192
59 3300005564 Ga0070664_100519491 Ga0070664_1005194912 192
60 3300005617 Ga0068859_100093160 Ga0068859_1000931604 192
61 3300005617 Ga0068859_100348516 Ga0068859_1003485162 192
62 3300005844 Ga0068862_100084570 Ga0068862_1000845704 192
63 3300005844 Ga0068862_100196478 Ga0068862_1001964782 192
64 3300005985 Ga0081539_10085530 Ga0081539_100855302 192
65 3300006173 Ga0070716_100775135 Ga0070716_1007751351 192
66 3300006931 Ga0097620_100093164 Ga0097620_1000931644 192
67 3300006931 Ga0097620_100348511 Ga0097620_1003485112 192
68 3300009177 Ga0105248_10266131 Ga0105248_102661314 192
69 3300010159 Ga0099796_10023998 Ga0099796_100239982 192
70 3300010375 Ga0105239_11012495 Ga0105239_110124951 192
71 3300014968 Ga0157379_10393723 Ga0157379_103937231 192
72 3300025926 Ga0207659_10278826 Ga0207659_102788262 192
73 3300027512 Ga0209179_1002205 Ga0209179_10022053 192
74 3300028379 Ga0268266_10308021 Ga0268266_103080212 192
75 3300033442 Ga0315911_1000010 Ga0315911_1000010247 192
76 3300035692 Ga0373935_0102867 Ga0373935_0102867_140_763 192
77 3300035695 Ga0373927_0329640 Ga0373927_0329640_265_885 192
78 3300041452 Ga0451793_0061689 Ga0451793_0061689_133_753 192
79 3300046462 Ga0495651_0171557 Ga0495651_0171557_448_1068 192
80 3300047319 Ga0495674_0493307 Ga0495674_0493307_290_913 192
81 3300047472 Ga0495686_0149901 Ga0495686_0149901_266_931 192
82 3300048903 Ga0496100_0893272 Ga0496100_0893272_42_656 192
83 3300048924 Ga0496121_0150236 Ga0496121_0150236_879_1499 192
84 3300048924 Ga0496121_0285302 Ga0496121_0285302_192_812 192
85 3300048927 Ga0496124_0012843 Ga0496124_0012843_915_1535 192
86 3300048928 Ga0496125_0022336 Ga0496125_0022336_3703_4323 192
87 3300048929 Ga0496126_0127508 Ga0496126_0127508_1171_1839 192
88 3300053102 Ga0500554_061162 Ga0500554_061162_99_719 192
89 3300053119 Ga0500595_009666 Ga0500595_009666_1116_1736 192
90 3300053142 Ga0500577_0065996 Ga0500577_0065996_23_694 192
91 3300053162 Ga0500638_017996 Ga0500638_017996_643_1263 192
92 3300053177 Ga0500636_0136440 Ga0500636_0136440_327_950 192
93 3300053178 Ga0500637_0174843 Ga0500637_0174843_190_810 192
94 3300003203 JGI25406J46586_10007128 JGI25406J46586_100071283 193
95 3300003659 JGI25404J52841_10009537 JGI25404J52841_100095372 193
96 3300003659 JGI25404J52841_10041530 JGI25404J52841_100415302 193
97 3300003659 JGI25404J52841_10042081 JGI25404J52841_100420812 193
98 3300005295 Ga0065707_10044374 Ga0065707_100443741 193
99 3300005327 Ga0070658_10121049 Ga0070658_101210492 193
100 3300005334 Ga0068869_100075370 Ga0068869_1000753703 193
101 3300005334 Ga0068869_100314908 Ga0068869_1003149082 193
102 3300005335 Ga0070666_10163143 Ga0070666_101631432 193
103 3300005336 Ga0070680_100066291 Ga0070680_1000662914 193
104 3300005337 Ga0070682_100013375 Ga0070682_1000133753 193
105 3300005339 Ga0070660_100823991 Ga0070660_1008239911 193
106 3300005340 Ga0070689_100639330 Ga0070689_1006393301 193
107 3300005343 Ga0070687_100337714 Ga0070687_1003377141 193
108 3300005344 Ga0070661_100062719 Ga0070661_1000627195 193
109 3300005347 Ga0070668_100039836 Ga0070668_1000398363 193
110 3300005353 Ga0070669_100259004 Ga0070669_1002590043 193
111 3300005354 Ga0070675_100254801 Ga0070675_1002548012 193
112 3300005355 Ga0070671_100136707 Ga0070671_1001367072 193
113 3300005366 Ga0070659_100392229 Ga0070659_1003922292 193
114 3300005406 Ga0070703_10037401 Ga0070703_100374015 193
115 3300005434 Ga0070709_10007673 Ga0070709_100076733 193
116 3300005434 Ga0070709_10106933 Ga0070709_101069333 193
117 3300005434 Ga0070709_10537328 Ga0070709_105373281 193
118 3300005435 Ga0070714_100036434 Ga0070714_1000364345 193
119 3300005435 Ga0070714_100097835 Ga0070714_1000978353 193
120 3300005435 Ga0070714_101185685 Ga0070714_1011856851 193
121 3300005436 Ga0070713_100086777 Ga0070713_1000867773 193
122 3300005438 Ga0070701_10697134 Ga0070701_106971341 193
123 3300005444 Ga0070694_100795926 Ga0070694_1007959261 193
124 3300005455 Ga0070663_100025066 Ga0070663_1000250662 193
125 3300005455 Ga0070663_100044345 Ga0070663_1000443453 193
126 3300005456 Ga0070678_100032116 Ga0070678_1000321163 193
127 3300005457 Ga0070662_100159250 Ga0070662_1001592502 193
128 3300005457 Ga0070662_100293937 Ga0070662_1002939373 193
129 3300005458 Ga0070681_10017045 Ga0070681_100170453 193
130 3300005518 Ga0070699_100102158 Ga0070699_1001021584 193
131 3300005530 Ga0070679_100006634 Ga0070679_1000066346 193
132 3300005530 Ga0070679_100097259 Ga0070679_1000972593 193
133 3300005545 Ga0070695_100144123 Ga0070695_1001441232 193
134 3300005547 Ga0070693_100144919 Ga0070693_1001449192 193
135 3300005548 Ga0070665_100131553 Ga0070665_1001315532 193
136 3300005548 Ga0070665_100432286 Ga0070665_1004322862 193
137 3300005548 Ga0070665_100437186 Ga0070665_1004371863 193
138 3300005548 Ga0070665_100439781 Ga0070665_1004397812 193
139 3300005563 Ga0068855_100256951 Ga0068855_1002569513 193
140 3300005563 Ga0068855_100271859 Ga0068855_1002718593 193
141 3300005563 Ga0068855_101402894 Ga0068855_1014028941 193
142 3300005578 Ga0068854_100822195 Ga0068854_1008221951 193
143 3300005578 Ga0068854_101002497 Ga0068854_1010024971 193
144 3300005578 Ga0068854_101126954 Ga0068854_1011269541 193
145 3300005617 Ga0068859_100649969 Ga0068859_1006499691 193
146 3300005618 Ga0068864_100059092 Ga0068864_1000590923 193
147 3300005618 Ga0068864_100469851 Ga0068864_1004698512 193
148 3300005719 Ga0068861_100025502 Ga0068861_1000255024 193
149 3300005719 Ga0068861_100794738 Ga0068861_1007947381 193
150 3300005842 Ga0068858_100101792 Ga0068858_1001017923 193
151 3300005843 Ga0068860_100603177 Ga0068860_1006031771 193
152 3300005844 Ga0068862_100204370 Ga0068862_1002043702 193
153 3300005844 Ga0068862_100292327 Ga0068862_1002923272 193
154 3300005844 Ga0068862_100828097 Ga0068862_1008280972 193
155 3300005937 Ga0081455_10007056 Ga0081455_100070568 193
156 3300005937 Ga0081455_10029262 Ga0081455_100292624 193
157 3300005937 Ga0081455_10064680 Ga0081455_100646803 193
158 3300005983 Ga0081540_1002478 Ga0081540_100247810 193
159 3300005983 Ga0081540_1002562 Ga0081540_10025624 193
160 3300005983 Ga0081540_1004408 Ga0081540_10044087 193
161 3300005983 Ga0081540_1006093 Ga0081540_10060937 193
162 3300005983 Ga0081540_1007065 Ga0081540_10070656 193
163 3300005983 Ga0081540_1012964 Ga0081540_10129644 193
164 3300005983 Ga0081540_1013086 Ga0081540_10130863 193
165 3300005985 Ga0081539_10000486 Ga0081539_1000048675 193
166 3300006028 Ga0070717_10057553 Ga0070717_100575535 193
167 3300006028 Ga0070717_10217838 Ga0070717_102178383 193
168 3300006038 Ga0075365_10006792 Ga0075365_100067925 193
169 3300006038 Ga0075365_10175839 Ga0075365_101758393 193
170 3300006042 Ga0075368_10113182 Ga0075368_101131821 193
171 3300006048 Ga0075363_100028255 Ga0075363_1000282553 193
172 3300006051 Ga0075364_10021799 Ga0075364_100217993 193
173 3300006051 Ga0075364_10240904 Ga0075364_102409042 193
174 3300006051 Ga0075364_10391883 Ga0075364_103918831 193
175 3300006173 Ga0070716_100084904 Ga0070716_1000849041 193
176 3300006173 Ga0070716_100159351 Ga0070716_1001593512 193
177 3300006175 Ga0070712_100478234 Ga0070712_1004782341 193
178 3300006178 Ga0075367_10026613 Ga0075367_100266132 193
179 3300006178 Ga0075367_10026845 Ga0075367_100268452 193
180 3300006178 Ga0075367_10085449 Ga0075367_100854493 193
181 3300006178 Ga0075367_10129308 Ga0075367_101293082 193
182 3300006178 Ga0075367_10328477 Ga0075367_103284772 193
183 3300006186 Ga0075369_10026954 Ga0075369_100269541 193
184 3300006186 Ga0075369_10160754 Ga0075369_101607542 193
185 3300006195 Ga0075366_10023098 Ga0075366_100230982 193
186 3300006195 Ga0075366_10196434 Ga0075366_101964342 193
187 3300006353 Ga0075370_10067383 Ga0075370_100673831 193
188 3300006358 Ga0068871_100063453 Ga0068871_1000634532 193
189 3300006931 Ga0097620_100649974 Ga0097620_1006499741 193
190 3300007076 Ga0075435_100114068 Ga0075435_1001140682 193
191 3300007788 Ga0099795_10007051 Ga0099795_100070513 193
192 3300009092 Ga0105250_10095434 Ga0105250_100954342 193
193 3300009093 Ga0105240_10043416 Ga0105240_100434165 193
194 3300009148 Ga0105243_10322101 Ga0105243_103221012 193
195 3300009174 Ga0105241_10443461 Ga0105241_104434611 193
196 3300009177 Ga0105248_10017088 Ga0105248_100170886 193
197 3300009553 Ga0105249_10105874 Ga0105249_101058743 193
198 3300010159 Ga0099796_10034190 Ga0099796_100341902 193
199 3300010375 Ga0105239_10523857 Ga0105239_105238572 193
200 3300013296 Ga0157374_10032387 Ga0157374_100323873 193
201 3300013297 Ga0157378_10020349 Ga0157378_100203494 193
202 3300013297 Ga0157378_10400208 Ga0157378_104002081 193
203 3300013306 Ga0163162_10138467 Ga0163162_101384672 193
204 3300014325 Ga0163163_10696864 Ga0163163_106968641 193
205 3300014968 Ga0157379_10457309 Ga0157379_104573091 193
206 3300017792 Ga0163161_10208081 Ga0163161_102080811 193
207 3300021358 Ga0213873_10043727 Ga0213873_100437272 193
208 3300021361 Ga0213872_10106064 Ga0213872_101060642 193
209 3300021384 Ga0213876_10357095 Ga0213876_103570951 193
210 3300025297 Ga0209758_1009213 Ga0209758_10092134 193
211 3300025302 Ga0207426_1057930 Ga0207426_10579302 193
212 3300025885 Ga0207653_10004133 Ga0207653_100041334 193
213 3300025903 Ga0207680_10307158 Ga0207680_103071581 193
214 3300025906 Ga0207699_10020327 Ga0207699_100203273 193
215 3300025906 Ga0207699_10028812 Ga0207699_100288122 193
216 3300025906 Ga0207699_10347146 Ga0207699_103471462 193
217 3300025907 Ga0207645_10078713 Ga0207645_100787131 193
218 3300025909 Ga0207705_10086931 Ga0207705_100869313 193
219 3300025912 Ga0207707_10000754 Ga0207707_1000075419 193
220 3300025913 Ga0207695_10058461 Ga0207695_100584615 193
221 3300025914 Ga0207671_10074867 Ga0207671_100748671 193
222 3300025915 Ga0207693_10368263 Ga0207693_103682632 193
223 3300025917 Ga0207660_10006213 Ga0207660_100062135 193
224 3300025920 Ga0207649_10286832 Ga0207649_102868321 193
225 3300025921 Ga0207652_10105850 Ga0207652_101058502 193
226 3300025921 Ga0207652_10215980 Ga0207652_102159803 193
227 3300025923 Ga0207681_10285464 Ga0207681_102854642 193
228 3300025924 Ga0207694_10192236 Ga0207694_101922362 193
229 3300025928 Ga0207700_10041399 Ga0207700_100413991 193
230 3300025931 Ga0207644_10369327 Ga0207644_103693272 193
231 3300025933 Ga0207706_10097958 Ga0207706_100979582 193
232 3300025933 Ga0207706_10416016 Ga0207706_104160163 193
233 3300025934 Ga0207686_10135583 Ga0207686_101355832 193
234 3300025940 Ga0207691_10041318 Ga0207691_100413185 193
235 3300025941 Ga0207711_10070547 Ga0207711_100705472 193
236 3300025941 Ga0207711_10091611 Ga0207711_100916111 193
237 3300025942 Ga0207689_10026793 Ga0207689_100267934 193
238 3300025942 Ga0207689_10196556 Ga0207689_101965562 193
239 3300025949 Ga0207667_10032271 Ga0207667_100322714 193
240 3300025949 Ga0207667_10053636 Ga0207667_100536362 193
241 3300025972 Ga0207668_10035915 Ga0207668_100359153 193
242 3300025972 Ga0207668_10170425 Ga0207668_101704254 193
243 3300026041 Ga0207639_10221290 Ga0207639_102212901 193
244 3300026067 Ga0207678_10028714 Ga0207678_100287143 193
245 3300026067 Ga0207678_10085368 Ga0207678_100853683 193
246 3300026067 Ga0207678_10088654 Ga0207678_100886542 193
247 3300026078 Ga0207702_10088262 Ga0207702_100882623 193
248 3300026095 Ga0207676_10237631 Ga0207676_102376312 193
249 3300026116 Ga0207674_10193283 Ga0207674_101932833 193
250 3300026118 Ga0207675_100035549 Ga0207675_1000355493 193
251 3300026118 Ga0207675_100207716 Ga0207675_1002077162 193
252 3300026121 Ga0207683_10053188 Ga0207683_100531883 193
253 3300026121 Ga0207683_10178032 Ga0207683_101780324 193
254 3300026142 Ga0207698_11085618 Ga0207698_110856181 193
255 3300027866 Ga0209813_10092134 Ga0209813_100921342 193
256 3300028379 Ga0268266_10082633 Ga0268266_100826333 193
257 3300028379 Ga0268266_10595550 Ga0268266_105955501 193
258 3300028380 Ga0268265_10115544 Ga0268265_101155443 193
259 3300028380 Ga0268265_10376518 Ga0268265_103765181 193
260 3300028380 Ga0268265_10998731 Ga0268265_109987311 193
261 3300028381 Ga0268264_10121075 Ga0268264_101210751 193
262 3300028786 Ga0307517_10279553 Ga0307517_102795532 193
263 3300031235 Ga0265330_10032562 Ga0265330_100325623 193
264 3300031239 Ga0265328_10051666 Ga0265328_100516662 193
265 3300031247 Ga0265340_10009829 Ga0265340_100098293 193
266 3300031249 Ga0265339_10130901 Ga0265339_101309012 193
267 3300031344 Ga0265316_10130169 Ga0265316_101301693 193
268 3300031507 Ga0307509_10232973 Ga0307509_102329732 193
269 3300031548 Ga0307408_100144177 Ga0307408_1001441772 193
270 3300031548 Ga0307408_100826674 Ga0307408_1008266741 193
271 3300031711 Ga0265314_10099962 Ga0265314_100999623 193
272 3300031712 Ga0265342_10182555 Ga0265342_101825551 193
273 3300031901 Ga0307406_10312459 Ga0307406_103124593 193
274 3300031903 Ga0307407_10336194 Ga0307407_103361942 193
275 3300031911 Ga0307412_10183174 Ga0307412_101831743 193
276 3300032002 Ga0307416_100608622 Ga0307416_1006086221 193
277 3300032002 Ga0307416_100675331 Ga0307416_1006753312 193
278 3300032126 Ga0307415_100726089 Ga0307415_1007260892 193
279 3300033180 Ga0307510_10003336 Ga0307510_100033364 193
280 3300035083 Ga0373926_0030543 Ga0373926_0030543_91_717 193
281 3300035086 Ga0373934_0122648 Ga0373934_0122648_379_1005 193
282 3300035089 Ga0373944_0041320 Ga0373944_0041320_92_718 193
283 3300035111 Ga0373923_0014135 Ga0373923_0014135_1915_2535 193
284 3300035111 Ga0373923_0017895 Ga0373923_0017895_579_1205 193
285 3300035116 Ga0373945_0066726 Ga0373945_0066726_646_1266 193
286 3300035118 Ga0373954_0115899 Ga0373954_0115899_588_1208 193
287 3300035170 Ga0373943_0002869 Ga0373943_0002869_5628_6248 193
288 3300035172 Ga0373955_0006124 Ga0373955_0006124_1752_2372 193
289 3300035410 Ga0373924_0011746 Ga0373924_0011746_2518_3144 193
290 3300035692 Ga0373935_0000757 Ga0373935_0000757_14221_14841 193
291 3300035695 Ga0373927_0001069 Ga0373927_0001069_8055_8675 193
292 3300035724 Ga0373933_0581505 Ga0373933_0581505_37_657 193
293 3300035725 Ga0373947_0003046 Ga0373947_0003046_4590_5210 193
294 3300036401 Ga0373937_0102931 Ga0373937_0102931_691_1311 193
295 3300037068 Ga0373925_0010697 Ga0373925_0010697_2945_3565 193
296 3300037068 Ga0373925_0188069 Ga0373925_0188069_224_850 193
297 3300037471 Ga0395905_0089462 Ga0395905_0089462_1259_1879 193
298 3300039437 Ga0436365_1560328 Ga0436365_1560328_1246_1869 193
299 3300039438 Ga0436360_1114925 Ga0436360_1114925_101_721 193
300 3300039438 Ga0436360_1154752 Ga0436360_1154752_448_1074 193
301 3300039447 Ga0436361_0990038 Ga0436361_0990038_157_783 193
302 3300039447 Ga0436361_1079148 Ga0436361_1079148_693_1319 193
303 3300039453 Ga0436362_1240820 Ga0436362_1240820_3385_4011 193
304 3300041413 Ga0439465_0030457 Ga0439465_0030457_253_870 193
305 3300045976 Ga0466967_0507023 Ga0466967_0507023_10_630 193
306 3300046452 Ga0495617_052951 Ga0495617_052951_402_1046 193
307 3300046455 Ga0495603_0000064 Ga0495603_0000064_33610_34230 193
308 3300046455 Ga0495603_0004299 Ga0495603_0004299_1377_2021 193
309 3300046455 Ga0495603_0042831 Ga0495603_0042831_666_1289 193
310 3300046460 Ga0495638_0009522 Ga0495638_0009522_2709_3338 193
311 3300046461 Ga0495641_0004409 Ga0495641_0004409_8482_9102 193
312 3300046461 Ga0495641_0092610 Ga0495641_0092610_195_839 193
313 3300046472 Ga0495580_0019120 Ga0495580_0019120_1646_2272 193
314 3300046472 Ga0495580_0063430 Ga0495580_0063430_1153_1773 193
315 3300046473 Ga0495582_0000197 Ga0495582_0000197_15940_16560 193
316 3300046475 Ga0495639_0000218 Ga0495639_0000218_27440_28060 193
317 3300046475 Ga0495639_0075237 Ga0495639_0075237_245_889 193
318 3300046476 Ga0495662_0002788 Ga0495662_0002788_4386_5006 193
319 3300046477 Ga0495664_0002480 Ga0495664_0002480_6658_7278 193
320 3300046477 Ga0495664_0026081 Ga0495664_0026081_152_778 193
321 3300046499 Ga0495594_0007452 Ga0495594_0007452_1280_1900 193
322 3300046501 Ga0495607_0246451 Ga0495607_0246451_71_691 193
323 3300046507 Ga0495606_0117589 Ga0495606_0117589_188_832 193
324 3300046512 Ga0495610_0157796 Ga0495610_0157796_35_679 193
325 3300046514 Ga0495618_0033226 Ga0495618_0033226_434_1060 193
326 3300046514 Ga0495618_0118477 Ga0495618_0118477_47_667 193
327 3300046517 Ga0495630_0056514 Ga0495630_0056514_2018_2638 193
328 3300046522 Ga0495643_0137598 Ga0495643_0137598_285_914 193
329 3300046526 Ga0495666_0076791 Ga0495666_0076791_118_738 193
330 3300046529 Ga0495652_0048148 Ga0495652_0048148_2933_3553 193
331 3300046530 Ga0495654_0228336 Ga0495654_0228336_11_655 193
332 3300046531 Ga0495665_0000902 Ga0495665_0000902_882_1502 193
333 3300046531 Ga0495665_0031420 Ga0495665_0031420_923_1549 193
334 3300046533 Ga0495640_0001505 Ga0495640_0001505_14305_14925 193
335 3300046536 Ga0495587_0284140 Ga0495587_0284140_249_869 193
336 3300046557 Ga0495622_0001436 Ga0495622_0001436_8352_8972 193
337 3300046559 Ga0495667_0040186 Ga0495667_0040186_840_1460 193
338 3300046642 Ga0495634_0002545 Ga0495634_0002545_6129_6749 193
339 3300046660 Ga0495625_0067127 Ga0495625_0067127_1752_2381 193
340 3300046660 Ga0495625_0558972 Ga0495625_0558972_52_669 193
341 3300046663 Ga0495635_0000356 Ga0495635_0000356_14734_15354 193
342 3300046665 Ga0495661_0272765 Ga0495661_0272765_145_774 193
343 3300046674 Ga0495588_0000619 Ga0495588_0000619_4594_5214 193
344 3300046674 Ga0495588_0033223 Ga0495588_0033223_1974_2591 193
345 3300046674 Ga0495588_0093628 Ga0495588_0093628_908_1537 193
346 3300046674 Ga0495588_0233331 Ga0495588_0233331_151_774 193
347 3300046678 Ga0495599_0085646 Ga0495599_0085646_137_757 193
348 3300046680 Ga0495646_0018090 Ga0495646_0018090_1445_2065 193
349 3300046683 Ga0495658_0004088 Ga0495658_0004088_3118_3744 193
350 3300046689 Ga0495613_0001784 Ga0495613_0001784_13559_14179 193
351 3300046689 Ga0495613_0121428 Ga0495613_0121428_262_888 193
352 3300046690 Ga0495624_0001264 Ga0495624_0001264_12768_13388 193
353 3300047315 Ga0495581_0001121 Ga0495581_0001121_271_891 193
354 3300047315 Ga0495581_0123154 Ga0495581_0123154_578_1204 193
355 3300047317 Ga0495604_0299827 Ga0495604_0299827_53_670 193
356 3300047319 Ga0495674_0000910 Ga0495674_0000910_5854_6474 193
357 3300047319 Ga0495674_0007674 Ga0495674_0007674_5733_6359 193
358 3300047469 Ga0495673_0095746 Ga0495673_0095746_530_1174 193
359 3300047471 Ga0495684_0036603 Ga0495684_0036603_1722_2342 193
360 3300047472 Ga0495686_0069755 Ga0495686_0069755_874_1503 193
361 3300047673 Ga0495593_0000053 Ga0495593_0000053_33480_34100 193
362 3300047673 Ga0495593_0027298 Ga0495593_0027298_1741_2367 193
363 3300048089 Ga0495614_0005483 Ga0495614_0005483_4079_4699 193
364 3300048090 Ga0495615_0058973 Ga0495615_0058973_312_980 193
365 3300048091 Ga0495626_0046698 Ga0495626_0046698_865_1494 193
366 3300048903 Ga0496100_0051151 Ga0496100_0051151_1961_2629 193
367 3300048905 Ga0496102_0484316 Ga0496102_0484316_22_639 193
368 3300048907 Ga0496104_0127383 Ga0496104_0127383_1660_2277 193
369 3300048909 Ga0496106_0373981 Ga0496106_0373981_71_688 193
370 3300048911 Ga0496108_0044389 Ga0496108_0044389_2965_3636 193
371 3300048911 Ga0496108_0264504 Ga0496108_0264504_206_826 193
372 3300048912 Ga0496109_0902730 Ga0496109_0902730_16_633 193
373 3300048915 Ga0496112_0298664 Ga0496112_0298664_425_1045 193
374 3300048916 Ga0496113_0302782 Ga0496113_0302782_600_1268 193
375 3300048917 Ga0496114_0447670 Ga0496114_0447670_501_1118 193
376 3300048920 Ga0496117_0083188 Ga0496117_0083188_361_990 193
377 3300048921 Ga0496118_0038391 Ga0496118_0038391_954_1583 193
378 3300048921 Ga0496118_0086192 Ga0496118_0086192_395_1045 193
379 3300048921 Ga0496118_0106819 Ga0496118_0106819_289_918 193
380 3300048921 Ga0496118_0278785 Ga0496118_0278785_61_735 193
381 3300048922 Ga0496119_0180667 Ga0496119_0180667_173_793 193
382 3300048924 Ga0496121_0011958 Ga0496121_0011958_2717_3346 193
383 3300048924 Ga0496121_0189858 Ga0496121_0189858_137_862 193
384 3300048925 Ga0496122_0039814 Ga0496122_0039814_156_785 193
385 3300048926 Ga0496123_0094977 Ga0496123_0094977_730_1359 193
386 3300048928 Ga0496125_0000203 Ga0496125_0000203_88751_89464 193
387 3300048928 Ga0496125_0131425 Ga0496125_0131425_177_806 193
388 3300048929 Ga0496126_0131827 Ga0496126_0131827_1169_1798 193
389 3300049460 Ga0495682_0143414 Ga0495682_0143414_71_694 193
390 3300049576 Ga0501040_0189360 Ga0501040_0189360_343_960 193
391 3300050491 nmdc:mga00v17_82063_c1 nmdc:mga00v17_82063_c1_90_719 193
392 3300050492 nmdc:mga0yw44_284771_c1 nmdc:mga0yw44_284771_c1_167_784 193
393 3300050492 nmdc:mga0yw44_5575_c1 nmdc:mga0yw44_5575_c1_3223_3852 193
394 3300050493 nmdc:mga0k408_106652_c1 nmdc:mga0k408_106652_c1_747_1364 193
395 3300050493 nmdc:mga0k408_119739_c1 nmdc:mga0k408_119739_c1_15_740 193
396 3300050494 nmdc:mga06z11_17526_c1 nmdc:mga06z11_17526_c1_1156_1773 193
397 3300050494 nmdc:mga06z11_299534_c1 nmdc:mga06z11_299534_c1_167_784 193
398 3300050494 nmdc:mga06z11_4441_c1 nmdc:mga06z11_4441_c1_450_1067 193
399 3300050495 nmdc:mga04h51_105805_c1 nmdc:mga04h51_105805_c1_152_769 193
400 3300050496 nmdc:mga07m45_62635_c1 nmdc:mga07m45_62635_c1_228_848 193
401 3300050516 nmdc:mga0sz30_23495_c1 nmdc:mga0sz30_23495_c1_405_1130 193
402 3300053088 Ga0500644_0033125 Ga0500644_0033125_1002_1631 193
403 3300053090 Ga0500646_0053515 Ga0500646_0053515_394_1023 193
404 3300053092 Ga0500583_0139345 Ga0500583_0139345_571_1188 193
405 3300053093 Ga0500651_0002318 Ga0500651_0002318_812_1441 193
406 3300053093 Ga0500651_0034467 Ga0500651_0034467_2454_3086 193
407 3300053096 Ga0500641_0083172 Ga0500641_0083172_346_963 193
408 3300053104 Ga0500556_0000778 Ga0500556_0000778_7819_8448 193
409 3300053108 Ga0500562_108697 Ga0500562_108697_106_735 193
410 3300053109 Ga0500569_010464 Ga0500569_010464_749_1378 193
411 3300053109 Ga0500569_062241 Ga0500569_062241_486_1133 193
412 3300053116 Ga0500592_005878 Ga0500592_005878_1017_1646 193
413 3300053117 Ga0500593_077894 Ga0500593_077894_404_1033 193
414 3300053130 Ga0500642_0000294 Ga0500642_0000294_11395_12030 193
415 3300053131 Ga0500652_000507 Ga0500652_000507_8485_9114 193
416 3300053134 Ga0500658_0091595 Ga0500658_0091595_389_1018 193
417 3300053136 Ga0500559_0291717 Ga0500559_0291717_72_701 193
418 3300053145 Ga0500586_012547 Ga0500586_012547_1283_1912 193
419 3300053150 Ga0500603_170402 Ga0500603_170402_17_664 193
420 3300053151 Ga0500604_0082202 Ga0500604_0082202_127_756 193
421 3300053153 Ga0500616_0000180 Ga0500616_0000180_12098_12727 193
422 3300053156 Ga0500622_0003781 Ga0500622_0003781_7358_7987 193
423 3300053158 Ga0500627_0004149 Ga0500627_0004149_1448_2077 193
424 3300053158 Ga0500627_0224504 Ga0500627_0224504_194_823 193
425 3300039438 Ga0436360_1262818 Ga0436360_1262818_197_835 194
426 3300053079 Ga0500610_0223025 Ga0500610_0223025_143_775 196
427 3300002070 JGI24750J21931_1012565 JGI24750J21931_10125652 198
428 3300005328 Ga0070676_10107497 Ga0070676_101074971 198
429 3300005330 Ga0070690_100075495 Ga0070690_1000754953 198
430 3300005338 Ga0068868_100820026 Ga0068868_1008200261 198
431 3300005343 Ga0070687_100260552 Ga0070687_1002605522 198
432 3300005356 Ga0070674_100015865 Ga0070674_1000158653 198
433 3300005365 Ga0070688_100209170 Ga0070688_1002091701 198
434 3300005366 Ga0070659_100295392 Ga0070659_1002953922 198
435 3300005438 Ga0070701_10028384 Ga0070701_100283842 198
436 3300005455 Ga0070663_100170377 Ga0070663_1001703772 198
437 3300005459 Ga0068867_100113318 Ga0068867_1001133183 198
438 3300005544 Ga0070686_100207753 Ga0070686_1002077532 198
439 3300005617 Ga0068859_100656591 Ga0068859_1006565912 198
440 3300005718 Ga0068866_10006477 Ga0068866_100064776 198
441 3300005719 Ga0068861_100030146 Ga0068861_1000301463 198
442 3300005843 Ga0068860_100175756 Ga0068860_1001757562 198
443 3300005844 Ga0068862_100458789 Ga0068862_1004587893 198
444 3300006931 Ga0097620_100656585 Ga0097620_1006565852 198
445 3300009098 Ga0105245_10032237 Ga0105245_100322373 198
446 3300009148 Ga0105243_10248248 Ga0105243_102482484 198
447 3300009553 Ga0105249_10102870 Ga0105249_101028705 198
448 3300010375 Ga0105239_10209518 Ga0105239_102095184 198
449 3300013306 Ga0163162_10227227 Ga0163162_102272272 198
450 3300014326 Ga0157380_10024326 Ga0157380_100243265 198
451 3300014968 Ga0157379_10401095 Ga0157379_104010952 198
452 3300014969 Ga0157376_10085877 Ga0157376_100858772 198
453 3300017792 Ga0163161_10109376 Ga0163161_101093765 198
454 3300025899 Ga0207642_10036365 Ga0207642_100363652 198
455 3300025901 Ga0207688_10014229 Ga0207688_100142292 198
456 3300025918 Ga0207662_10092353 Ga0207662_100923532 198
457 3300025919 Ga0207657_10264481 Ga0207657_102644812 198
458 3300025927 Ga0207687_10148899 Ga0207687_101488994 198
459 3300025932 Ga0207690_10111101 Ga0207690_101111013 198
460 3300025933 Ga0207706_10033314 Ga0207706_100333144 198
461 3300025934 Ga0207686_10038456 Ga0207686_100384562 198
462 3300025937 Ga0207669_10197044 Ga0207669_101970444 198
463 3300025938 Ga0207704_10024331 Ga0207704_100243312 198
464 3300025961 Ga0207712_10009636 Ga0207712_100096366 198
465 3300025972 Ga0207668_10228518 Ga0207668_102285181 198
466 3300026067 Ga0207678_10050648 Ga0207678_100506481 198
467 3300026075 Ga0207708_10226660 Ga0207708_102266601 198
468 3300026089 Ga0207648_10076107 Ga0207648_100761072 198
469 3300026118 Ga0207675_100032581 Ga0207675_1000325813 198
470 3300028380 Ga0268265_10120266 Ga0268265_101202662 198
471 3300035088 Ga0373940_0126521 Ga0373940_0126521_71_703 198
472 3300046474 Ga0495605_0125599 Ga0495605_0125599_105_737 198
473 3300046558 Ga0495633_0198218 Ga0495633_0198218_240_872 198
474 3300046684 Ga0495669_0002200 Ga0495669_0002200_3288_3920 198
475 3300048903 Ga0496100_0245743 Ga0496100_0245743_536_1168 198
476 3300048904 Ga0496101_0139174 Ga0496101_0139174_852_1484 198
477 3300048905 Ga0496102_0081179 Ga0496102_0081179_630_1262 198
478 3300048909 Ga0496106_0066022 Ga0496106_0066022_1836_2468 198
479 3300048917 Ga0496114_0044410 Ga0496114_0044410_862_1494 198

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ic9-assembly2.cif.gz_B the coiled-coil domain (residues 1-93) structure of the sin nombre virus nucleocapsid protein 0.7056 40 111
2ic9-assembly2.cif.gz_B the coiled-coil domain (residues 1-93) structure of the sin nombre virus nucleocapsid protein 0.6797 40 111
6hcy-assembly1.cif.gz_A human steap4 bound to nadp, fad, heme and fe(iii)-nta. 0.6717 18 179
7nkj-assembly1.cif.gz_G mycobacterium smegmatis atp synthase f1 state 3 0.6679 41 127
1kqf-assembly1.cif.gz_C formate dehydrogenase n from e. coli 0.6202 47 174
ID Description Score Start End Superfamily
af_F1Q9R5_247_394_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.7748 52 164 1.20.950.20
af_P76343_47_161_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.7739 52 164 1.20.950.20
af_P76343_47_161_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.7501 52 164 1.20.950.20
af_Q687X5_247_395_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.7495 52 168 1.20.950.20
2ic9B00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7056 40 111 1.20.58.90
ID Description Score Start End GO Terms
AF-A0A1I3GZ86-F1-model_v4 DMSO/TMAO reductase YedYZ, heme-binding membrane subunit 0.9814 12 179 GO:0016020
AF-A0A2D6Y1I0-F1-model_v4 Ferric oxidoreductase domain-containing protein 0.9765 15 136 GO:0016020
AF-A0A2M8U0W4-F1-model_v4 Ferric oxidoreductase domain-containing protein 0.9663 12 183 GO:0016020
AF-A0A2W5PTB7-F1-model_v4 Ferric oxidoreductase domain-containing protein 0.9612 19 183 GO:0016020
AF-A0A0N1BSG2-F1-model_v4 Ferric oxidoreductase domain-containing protein 0.9596 12 183 GO:0016020

Feature Viewer

pLDDT pTM Quality
86.86 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map