F452043

General Info

Members Datasets Scaffolds Average Seq Length
479 256 958 350

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10297877|Ga0157370_102978771
Length 370
Sequence MIAGAARVIRRIDLLPEQWETFKRAARREKMDKIPMALIVDSPWIPGYLGISHMDYFLDPELWFQSNLKIMREFPNIIFIPSWWMEYGMAAEPSVLGAKIKFWQDNTPSEYHTLYRLEDIDNFPEYEVEADAFAGLTLHRIGMARQRILDAGYILPMVTSRGPLCTAGFVRGTTEFMIDLVENPTGAHKLIDLCTRVIIDWLKAQQKVMGDTVESIFILDDIVGFVNEEHYLEFAHPYLKRICDAFPKDWVKLYHNDAEVDACLDHLPDTGFNVLNWGKQRHITEVKRRIGDRMCLMGNVNPLEIGVRGTPEEVKDETLEVLEGAGGEGIILSVGGGVSPGMPRENILAMLEALEEFNAKRSANAGALSR

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
116 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
157 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
202 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
203 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
204 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
205 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
222 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
223 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
224 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
225 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
226 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
227 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
228 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
229 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.31
Nodule 0
Rhizoplane 2.3
Rhizosphere 89.14
Stem 0
Stem Tuber 0
Unclassified 3.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10297877 3300013104 Bacteria 1489
2 Ga0065712_10000695 3300005290 Bacteria 9164
3 Ga0065712_10024559 3300005290 Bacteria 1519
4 Ga0065712_10083728 3300005290 Bacteria 2815
5 Ga0065715_10004449 3300005293 Bacteria 7659
6 Ga0065715_10019213 3300005293 Bacteria 2619
7 Ga0065715_10112814 3300005293 Bacteria 2500
8 Ga0065707_10085144 3300005295 Bacteria 6413
9 Ga0070683_100000025 3300005329 Bacteria 173339
10 Ga0070683_100005354 3300005329 Bacteria 10700
11 Ga0070683_100028222 3300005329 Bacteria 5071
12 Ga0070683_100038998 3300005329 Bacteria 4358
13 Ga0070690_100215432 3300005330 Bacteria 1343
14 Ga0070670_100001152 3300005331 Bacteria 20970
15 Ga0068869_100055733 3300005334 Bacteria 2882
16 Ga0070680_100093453 3300005336 Bacteria 2492
17 Ga0070689_100069193 3300005340 Bacteria 2754
18 Ga0070669_100007713 3300005353 Bacteria 7695
19 Ga0070671_100027761 3300005355 Bacteria 4660
20 Ga0070671_100035673 3300005355 Bacteria 4120
21 Ga0070673_100015358 3300005364 Bacteria 5376
22 Ga0070667_100286307 3300005367 Bacteria 1481
23 Ga0070709_10192395 3300005434 Unclassified 1440
24 Ga0070713_100107746 3300005436 Bacteria 2425
25 Ga0070701_10100388 3300005438 Bacteria 1602
26 Ga0070663_100156553 3300005455 Bacteria 1751
27 Ga0070678_100069227 3300005456 Bacteria 2634
28 Ga0070681_10148798 3300005458 Bacteria 2269
29 Ga0070681_10375821 3300005458 Bacteria 1332
30 Ga0070679_100000725 3300005530 Bacteria 28466
31 Ga0070684_100000383 3300005535 Bacteria 30734
32 Ga0070684_100000515 3300005535 Bacteria 26549
33 Ga0070672_100196332 3300005543 Bacteria 1686
34 Ga0070693_100130720 3300005547 Bacteria 1569
35 Ga0070665_100312449 3300005548 Bacteria 1575
36 Ga0068855_100135966 3300005563 Bacteria 2805
37 Ga0068855_100169814 3300005563 Bacteria 2471
38 Ga0068855_100437949 3300005563 Bacteria 1428
39 Ga0070664_100001660 3300005564 Bacteria 17800
40 Ga0070664_100084799 3300005564 Bacteria 2735
41 Ga0068857_100004089 3300005577 Bacteria 12293
42 Ga0068856_100144233 3300005614 Bacteria 2389
43 Ga0068856_100396572 3300005614 Unclassified 1400
44 Ga0068859_100130647 3300005617 Bacteria 2583
45 Ga0068859_100297903 3300005617 Bacteria 1706
46 Ga0068864_100045810 3300005618 Bacteria 3752
47 Ga0068864_100069806 3300005618 Bacteria 3056
48 Ga0068861_100020252 3300005719 Bacteria 4760
49 Ga0068870_10034164 3300005840 Bacteria 2601
50 Ga0068863_100118480 3300005841 Bacteria 2523
51 Ga0068860_100291512 3300005843 Bacteria 1597
52 Ga0068860_100562147 3300005843 Bacteria 1143
53 Ga0068862_100149842 3300005844 Bacteria 2076
54 Ga0068862_100171101 3300005844 Bacteria 1945
55 Ga0075365_10252719 3300006038 Bacteria 1239
56 Ga0075368_10032408 3300006042 Bacteria 2030
57 Ga0075368_10035912 3300006042 Bacteria 1935
58 Ga0075364_10007642 3300006051 Bacteria 6430
59 Ga0075364_10049183 3300006051 Bacteria 2749
60 Ga0075362_10000867 3300006177 Bacteria 9141
61 Ga0075367_10014418 3300006178 Bacteria 4279
62 Ga0075367_10022625 3300006178 Bacteria 3527
63 Ga0075367_10115633 3300006178 Bacteria 1649
64 Ga0075369_10098818 3300006186 Bacteria 1308
65 Ga0075366_10006098 3300006195 Bacteria 6570
66 Ga0075366_10035660 3300006195 Bacteria 2933
67 Ga0075366_10066261 3300006195 Bacteria 2148
68 Ga0097621_100442184 3300006237 Bacteria 1170
69 Ga0075370_10018028 3300006353 Bacteria 3824
70 Ga0075370_10060534 3300006353 Bacteria 2157
71 Ga0075370_10065897 3300006353 Bacteria 2065
72 Ga0075370_10139043 3300006353 Bacteria 1419
73 Ga0075428_100038144 3300006844 Bacteria 5288
74 Ga0075430_100030750 3300006846 Bacteria 4560
75 Ga0075430_100042498 3300006846 Bacteria 3843
76 Ga0075431_100071106 3300006847 Bacteria 3589
77 Ga0075433_10060313 3300006852 Bacteria 3321
78 Ga0068865_100032475 3300006881 Bacteria 3487
79 Ga0097620_100130643 3300006931 Bacteria 2583
80 Ga0097620_100297934 3300006931 Bacteria 1706
81 Ga0075435_100025360 3300007076 Bacteria 4615
82 Ga0105240_10059056 3300009093 Bacteria 4787
83 Ga0105240_10208985 3300009093 Bacteria 2282
84 Ga0105240_10284697 3300009093 Bacteria 1897
85 Ga0105240_10556459 3300009093 Bacteria 1268
86 Ga0111539_10000982 3300009094 Bacteria 37391
87 Ga0111539_10002888 3300009094 Bacteria 22812
88 Ga0111539_10046037 3300009094 Bacteria 5220
89 Ga0111539_10059246 3300009094 Bacteria 4541
90 Ga0105245_10155663 3300009098 Bacteria 2164
91 Ga0105247_10029462 3300009101 Unclassified 3326
92 Ga0114129_10001828 3300009147 Bacteria 28970
93 Ga0114129_10009923 3300009147 Bacteria 13570
94 Ga0114129_10028915 3300009147 Bacteria 7852
95 Ga0114129_10445817 3300009147 Bacteria 1698
96 Ga0105243_10371876 3300009148 Bacteria 1319
97 Ga0105242_10231305 3300009176 Bacteria 1657
98 Ga0105248_10008845 3300009177 Bacteria 11063
99 Ga0105248_10174269 3300009177 Bacteria 2425
100 Ga0105248_10622405 3300009177 Bacteria 1218
101 Ga0105237_10007191 3300009545 Bacteria 12222
102 Ga0105238_10015968 3300009551 Bacteria 7597
103 Ga0105238_10061900 3300009551 Bacteria 3744
104 Ga0105238_10215862 3300009551 Bacteria 1894
105 Ga0105249_10001093 3300009553 Bacteria 24114
106 Ga0105239_10017178 3300010375 Bacteria 7997
107 Ga0105239_10112497 3300010375 Bacteria 3019
108 Ga0105239_10520075 3300010375 Bacteria 1354
109 Ga0105246_10090191 3300011119 Bacteria 2207
110 Ga0105246_10106844 3300011119 Bacteria 2048
111 Ga0105246_10232420 3300011119 Bacteria 1453
112 Ga0157371_10213207 3300013102 Bacteria 1386
113 Ga0157370_10005724 3300013104 Bacteria 13896
114 Ga0157370_10021040 3300013104 Bacteria 6504
115 Ga0157370_10036169 3300013104 Bacteria 4794
116 Ga0157369_10016856 3300013105 Bacteria 8209
117 Ga0157369_10017268 3300013105 Bacteria 8111
118 Ga0157369_10148709 3300013105 Unclassified 2476
119 Ga0157369_10225839 3300013105 Unclassified 1959
120 Ga0157369_10229196 3300013105 Bacteria 1942
121 Ga0157369_10404233 3300013105 Bacteria 1417
122 Ga0157374_10059748 3300013296 Bacteria 3566
123 Ga0157374_10160182 3300013296 Bacteria 2192
124 Ga0157374_10224481 3300013296 Bacteria 1844
125 Ga0157378_10129408 3300013297 Bacteria 2335
126 Ga0163162_10200910 3300013306 Bacteria 2122
127 Ga0163162_10459895 3300013306 Bacteria 1404
128 Ga0157372_10061096 3300013307 Bacteria 4218
129 Ga0157372_10584989 3300013307 Bacteria 1301
130 Ga0157372_10595907 3300013307 Bacteria 1288
131 Ga0157375_10205816 3300013308 Bacteria 2124
132 Ga0157375_10617901 3300013308 Bacteria 1242
133 Ga0163163_10005247 3300014325 Bacteria 11173
134 Ga0163163_10055243 3300014325 Bacteria 3925
135 Ga0163163_10147057 3300014325 Bacteria 2401
136 Ga0157377_10027435 3300014745 Bacteria 3057
137 Ga0213876_10007958 3300021384 Bacteria 5750
138 Ga0209233_1002882 3300025261 Bacteria 6148
139 Ga0207697_10014467 3300025315 Bacteria 3271
140 Ga0207682_10012457 3300025893 Bacteria 3318
141 Ga0207680_10246180 3300025903 Bacteria 1233
142 Ga0207645_10160289 3300025907 Bacteria 1471
143 Ga0207707_10080973 3300025912 Bacteria 2835
144 Ga0207695_10001734 3300025913 Bacteria 34698
145 Ga0207695_10006829 3300025913 Bacteria 14696
146 Ga0207695_10034409 3300025913 Bacteria 5511
147 Ga0207695_10095926 3300025913 Bacteria 2968
148 Ga0207695_10171918 3300025913 Bacteria 2092
149 Ga0207652_10002846 3300025921 Bacteria 14495
150 Ga0207652_10016608 3300025921 Bacteria 6014
151 Ga0207681_10031346 3300025923 Bacteria 3471
152 Ga0207694_10016197 3300025924 Bacteria 5627
153 Ga0207694_10024523 3300025924 Bacteria 4582
154 Ga0207650_10010189 3300025925 Bacteria 6441
155 Ga0207650_10073234 3300025925 Bacteria 2580
156 Ga0207650_10113485 3300025925 Bacteria 2101
157 Ga0207659_10029883 3300025926 Bacteria 3718
158 Ga0207659_10143804 3300025926 Bacteria 1854
159 Ga0207700_10085718 3300025928 Bacteria 2473
160 Ga0207644_10184003 3300025931 Bacteria 1639
161 Ga0207644_10311121 3300025931 Bacteria 1272
162 Ga0207706_10052532 3300025933 Bacteria 3598
163 Ga0207691_10015571 3300025940 Bacteria 7230
164 Ga0207711_10037819 3300025941 Bacteria 4102
165 Ga0207711_10074845 3300025941 Bacteria 2946
166 Ga0207711_10207816 3300025941 Bacteria 1788
167 Ga0207689_10025700 3300025942 Bacteria 4933
168 Ga0207661_10000028 3300025944 Bacteria 173347
169 Ga0207661_10044348 3300025944 Bacteria 3514
170 Ga0207661_10145192 3300025944 Bacteria 2046
171 Ga0207661_10145740 3300025944 Bacteria 2042
172 Ga0207679_10005441 3300025945 Bacteria 7978
173 Ga0207679_10258913 3300025945 Bacteria 1483
174 Ga0207667_10041971 3300025949 Bacteria 4865
175 Ga0207667_10296547 3300025949 Bacteria 1652
176 Ga0207651_10102342 3300025960 Bacteria 2129
177 Ga0207651_10170004 3300025960 Bacteria 1718
178 Ga0207712_10012177 3300025961 Bacteria 5494
179 Ga0207658_10239273 3300025986 Bacteria 1537
180 Ga0207639_10182565 3300026041 Bacteria 1786
181 Ga0207678_10010487 3300026067 Bacteria 8138
182 Ga0207678_10201430 3300026067 Bacteria 1702
183 Ga0207708_10032850 3300026075 Bacteria 3940
184 Ga0207702_10089299 3300026078 Bacteria 2695
185 Ga0207702_10100497 3300026078 Bacteria 2552
186 Ga0207676_10039114 3300026095 Bacteria 3626
187 Ga0207676_10065241 3300026095 Bacteria 2899
188 Ga0207675_100443045 3300026118 Bacteria 1286
189 Ga0207698_10102384 3300026142 Bacteria 2377
190 Ga0207428_10217042 3300027907 Bacteria 1435
191 Ga0268265_10172113 3300028380 Bacteria 1852
192 Ga0268264_10059658 3300028381 Bacteria 3197
193 Ga0265337_1001143 3300028556 Bacteria 13556
194 Ga0265337_1001703 3300028556 Bacteria 10665
195 Ga0265337_1015210 3300028556 Unclassified 2526
196 Ga0265337_1020070 3300028556 Bacteria 2098
197 Ga0265337_1035631 3300028556 Bacteria 1457
198 Ga0265326_10001819 3300028558 Bacteria 7343
199 Ga0265326_10016522 3300028558 Bacteria 2133
200 Ga0265326_10034127 3300028558 Bacteria 1447
201 Ga0265319_1002524 3300028563 Bacteria 9914
202 Ga0265319_1002543 3300028563 Bacteria 9874
203 Ga0265319_1009012 3300028563 Bacteria 4303
204 Ga0265334_10001421 3300028573 Bacteria 11518
205 Ga0265334_10012568 3300028573 Bacteria 3555
206 Ga0265318_10003976 3300028577 Bacteria 7276
207 Ga0265318_10004022 3300028577 Bacteria 7221
208 Ga0265318_10007744 3300028577 Bacteria 4829
209 Ga0265323_10032860 3300028653 Bacteria 1924
210 Ga0265322_10020507 3300028654 Bacteria 1894
211 Ga0265336_10000966 3300028666 Bacteria 14351
212 Ga0265336_10005850 3300028666 Bacteria 4492
213 Ga0265336_10029357 3300028666 Bacteria 1715
214 Ga0265338_10000132 3300028800 Bacteria 137378
215 Ga0265338_10001599 3300028800 Bacteria 36351
216 Ga0265338_10001670 3300028800 Bacteria 35304
217 Ga0265338_10009220 3300028800 Bacteria 11814
218 Ga0265338_10010002 3300028800 Bacteria 11214
219 Ga0265338_10010230 3300028800 Bacteria 11049
220 Ga0265338_10015625 3300028800 Bacteria 8318
221 Ga0265338_10018088 3300028800 Bacteria 7561
222 Ga0265338_10039855 3300028800 Bacteria 4422
223 Ga0265338_10057593 3300028800 Unclassified 3436
224 Ga0265338_10099272 3300028800 Bacteria 2379
225 Ga0265338_10100770 3300028800 Bacteria 2354
226 Ga0265338_10117937 3300028800 Bacteria 2122
227 Ga0265338_10206088 3300028800 Bacteria 1479
228 Ga0265338_10233483 3300028800 Unclassified 1366
229 Ga0265338_10243600 3300028800 Bacteria 1330
230 Ga0265324_10004411 3300029957 Bacteria 6374
231 Ga0265324_10005726 3300029957 Bacteria 5296
232 Ga0265324_10031447 3300029957 Bacteria 1859
233 Ga0265330_10000643 3300031235 Bacteria 22456
234 Ga0265330_10009412 3300031235 Bacteria 4642
235 Ga0265320_10000674 3300031240 Bacteria 26001
236 Ga0265320_10002829 3300031240 Bacteria 11927
237 Ga0265320_10003295 3300031240 Bacteria 10899
238 Ga0265320_10005800 3300031240 Bacteria 7870
239 Ga0265320_10006581 3300031240 Bacteria 7305
240 Ga0265320_10010468 3300031240 Bacteria 5523
241 Ga0265325_10000415 3300031241 Bacteria 30438
242 Ga0265325_10014888 3300031241 Bacteria 4385
243 Ga0265325_10032487 3300031241 Bacteria 2786
244 Ga0265325_10033079 3300031241 Bacteria 2757
245 Ga0265325_10038507 3300031241 Bacteria 2523
246 Ga0265329_10010148 3300031242 Bacteria 3474
247 Ga0265340_10012897 3300031247 Bacteria 4403
248 Ga0265340_10018134 3300031247 Bacteria 3634
249 Ga0265340_10071874 3300031247 Unclassified 1639
250 Ga0265339_10005985 3300031249 Bacteria 8037
251 Ga0265339_10009576 3300031249 Bacteria 6072
252 Ga0265339_10013931 3300031249 Bacteria 4864
253 Ga0265339_10024014 3300031249 Bacteria 3518
254 Ga0265339_10112374 3300031249 Unclassified 1408
255 Ga0265339_10128976 3300031249 Bacteria 1295
256 Ga0265331_10006568 3300031250 Bacteria 6856
257 Ga0265327_10000047 3300031251 Bacteria 273466
258 Ga0265327_10008670 3300031251 Bacteria 7527
259 Ga0265316_10002791 3300031344 Bacteria 17906
260 Ga0265316_10003308 3300031344 Bacteria 16346
261 Ga0265316_10007041 3300031344 Bacteria 10656
262 Ga0265316_10007204 3300031344 Bacteria 10507
263 Ga0265316_10011590 3300031344 Bacteria 7940
264 Ga0265316_10011953 3300031344 Bacteria 7802
265 Ga0265316_10020837 3300031344 Bacteria 5568
266 Ga0265316_10022979 3300031344 Bacteria 5247
267 Ga0265316_10026816 3300031344 Bacteria 4785
268 Ga0265316_10037656 3300031344 Bacteria 3902
269 Ga0265316_10055733 3300031344 Bacteria 3090
270 Ga0265316_10064065 3300031344 Bacteria 2848
271 Ga0307408_100010754 3300031548 Bacteria 6037
272 Ga0307408_100022013 3300031548 Bacteria 4324
273 Ga0265313_10001128 3300031595 Bacteria 25524
274 Ga0265313_10001781 3300031595 Bacteria 19674
275 Ga0265313_10017457 3300031595 Bacteria 4077
276 Ga0265313_10026745 3300031595 Unclassified 3033
277 Ga0307508_10000027 3300031616 Bacteria 171013
278 Ga0265314_10003847 3300031711 Bacteria 14311
279 Ga0265314_10004319 3300031711 Bacteria 13262
280 Ga0265314_10008959 3300031711 Bacteria 8517
281 Ga0265314_10011710 3300031711 Bacteria 7215
282 Ga0265314_10013566 3300031711 Bacteria 6575
283 Ga0265314_10030120 3300031711 Bacteria 4022
284 Ga0265314_10081600 3300031711 Bacteria 2130
285 Ga0265342_10000156 3300031712 Bacteria 77615
286 Ga0265342_10003085 3300031712 Bacteria 13920
287 Ga0265342_10008929 3300031712 Bacteria 7121
288 Ga0265342_10017750 3300031712 Bacteria 4621
289 Ga0265342_10068780 3300031712 Bacteria 2069
290 Ga0265342_10104689 3300031712 Bacteria 1608
291 Ga0265342_10183586 3300031712 Bacteria 1144
292 Ga0307405_10119880 3300031731 Bacteria 1799
293 Ga0307406_10185115 3300031901 Bacteria 1520
294 Ga0307407_10173423 3300031903 Bacteria 1423
295 Ga0307409_100113311 3300031995 Bacteria 2279
296 Ga0307409_100273940 3300031995 Bacteria 1556
297 Ga0307416_100032405 3300032002 Bacteria 3948
298 Ga0307411_10083461 3300032005 Bacteria 2207
299 Ga0307411_10174726 3300032005 Bacteria 1624
300 Ga0307415_100334196 3300032126 Bacteria 1269
301 Ga0373946_0072755 3300035171 Bacteria 1489
302 Ga0316574_0066160 3300035398 Bacteria 2277
303 Ga0373935_0184317 3300035692 Bacteria 1435
304 Ga0373933_0038088 3300035724 Bacteria 2825
305 Ga0373933_0076971 3300035724 Bacteria 2039
306 Ga0373937_0005049 3300036401 Bacteria 11236
307 Ga0373937_0007845 3300036401 Bacteria 9254
308 Ga0316584_0117525 3300036712 Bacteria 1989
309 Ga0373925_0256408 3300037068 Bacteria 1404
310 Ga0395899_0048388 3300037312 Bacteria 3164
311 Ga0395900_0032074 3300037418 Bacteria 5401
312 Ga0395905_0005426 3300037471 Bacteria 13027
313 Ga0395905_0519169 3300037471 Bacteria 1092
314 Ga0436364_1284239 3300037853 Bacteria 2888
315 Ga0395901_0006659 3300038443 Bacteria 11675
316 Ga0436365_0873143 3300039437 Bacteria 5878
317 Ga0451802_1945057 3300041460 Bacteria 1480
318 Ga0451853_1472122 3300041512 Bacteria 1354
319 Ga0450920_009157 3300042122 Bacteria 1820
320 Ga0450896_003444 3300042133 Bacteria 2104
321 Ga0451577_0000524 3300042876 Bacteria 63869
322 Ga0451577_0021108 3300042876 Bacteria 5965
323 Ga0451577_0029436 3300042876 Bacteria 4964
324 Ga0453683_0002185 3300044673 Bacteria 15562
325 Ga0466966_0050837 3300044684 Bacteria 2636
326 Ga0453684_0014599 3300044712 Bacteria 12541
327 Ga0453684_0080998 3300044712 Bacteria 4051
328 Ga0453684_0279910 3300044712 Bacteria 1903
329 Ga0451576_0000163 3300045051 Bacteria 170072
330 Ga0451576_0009070 3300045051 Bacteria 11582
331 Ga0451576_0016231 3300045051 Bacteria 8225
332 Ga0451576_0049758 3300045051 Bacteria 4398
333 Ga0451576_0196937 3300045051 Bacteria 2105
334 Ga0495651_0027447 3300046462 Bacteria 4435
335 Ga0495580_0002514 3300046472 Bacteria 15995
336 Ga0495582_0207324 3300046473 Bacteria 1120
337 Ga0495662_0016644 3300046476 Bacteria 3562
338 Ga0495664_0052026 3300046477 Bacteria 2432
339 Ga0495628_0199428 3300046516 Bacteria 1508
340 Ga0495630_0000399 3300046517 Bacteria 34168
341 Ga0495630_0014993 3300046517 Bacteria 5654
342 Ga0495630_0091462 3300046517 Bacteria 2299
343 Ga0495630_0319035 3300046517 Unclassified 1188
344 Ga0495666_0072393 3300046526 Bacteria 1637
345 Ga0495652_0022451 3300046529 Bacteria 5599
346 Ga0495652_0112589 3300046529 Bacteria 2186
347 Ga0495652_0138933 3300046529 Bacteria 1913
348 Ga0495640_0026153 3300046533 Bacteria 4221
349 Ga0495640_0101713 3300046533 Bacteria 1886
350 Ga0495586_0000074 3300046535 Bacteria 60646
351 Ga0495586_0034589 3300046535 Bacteria 2714
352 Ga0495587_0101111 3300046536 Bacteria 1661
353 Ga0495645_0195693 3300046543 Bacteria 1375
354 Ga0495645_0245617 3300046543 Unclassified 1192
355 Ga0495622_0033327 3300046557 Bacteria 2404
356 Ga0495667_0015880 3300046559 Bacteria 5091
357 Ga0495667_0040645 3300046559 Bacteria 3087
358 Ga0495667_0070656 3300046559 Bacteria 2277
359 Ga0495634_0002925 3300046642 Bacteria 13957
360 Ga0495634_0004477 3300046642 Bacteria 10962
361 Ga0495634_0044015 3300046642 Bacteria 3023
362 Ga0495634_0151428 3300046642 Bacteria 1467
363 Ga0495635_0082470 3300046663 Bacteria 2200
364 Ga0495599_0026728 3300046678 Bacteria 3617
365 Ga0495623_0054749 3300046679 Unclassified 2516
366 Ga0495647_0028452 3300046681 Bacteria 2061
367 Ga0495613_0002192 3300046689 Bacteria 14793
368 Ga0495613_0051397 3300046689 Bacteria 3037
369 Ga0495613_0082864 3300046689 Bacteria 2329
370 Ga0495613_0161447 3300046689 Bacteria 1594
371 Ga0495600_0215875 3300046809 Bacteria 1228
372 Ga0495604_0184732 3300047317 Bacteria 1457
373 Ga0495604_0217169 3300047317 Bacteria 1318
374 Ga0495674_0000585 3300047319 Bacteria 34090
375 Ga0495674_0006811 3300047319 Bacteria 10942
376 Ga0495674_0080534 3300047319 Bacteria 2794
377 Ga0495676_0094335 3300047321 Bacteria 2229
378 Ga0495680_0012653 3300047322 Bacteria 7411
379 Ga0495680_0020792 3300047322 Bacteria 5510
380 Ga0495675_0048672 3300047444 Bacteria 2696
381 Ga0495684_0004971 3300047471 Bacteria 10381
382 Ga0495684_0024798 3300047471 Bacteria 4612
383 Ga0495684_0107309 3300047471 Bacteria 2109
384 Ga0495602_0030249 3300048088 Bacteria 5141
385 Ga0495602_0123007 3300048088 Bacteria 2084
386 Ga0496102_0112610 3300048905 Bacteria 2538
387 Ga0496103_0152357 3300048906 Bacteria 1481
388 Ga0496104_0004106 3300048907 Bacteria 12639
389 Ga0496105_0006312 3300048908 Bacteria 9107
390 Ga0496107_0190207 3300048910 Bacteria 1525
391 Ga0496108_0022291 3300048911 Bacteria 5206
392 Ga0496109_0003511 3300048912 Bacteria 13099
393 Ga0496112_0005594 3300048915 Bacteria 10895
394 Ga0496112_0185161 3300048915 Bacteria 2046
395 Ga0496115_0061523 3300048918 Bacteria 3027
396 Ga0501292_006494 3300049515 Bacteria 1663
397 Ga0501295_013506 3300049518 Bacteria 1357
398 Ga0501298_011325 3300049521 Bacteria 1547
399 Ga0501299_005777 3300049522 Bacteria 1915
400 Ga0501300_016195 3300049523 Bacteria 1088
401 Ga0501031_0068845 3300049568 Bacteria 2306
402 Ga0501032_0001367 3300049569 Bacteria 19349
403 Ga0501034_0016694 3300049571 Bacteria 7527
404 Ga0501036_0087765 3300049572 Bacteria 2629
405 Ga0501039_0128409 3300049575 Bacteria 1989
406 Ga0501041_0115296 3300049577 Bacteria 1668
407 Ga0501042_0020724 3300049578 Bacteria 4576
408 Ga0501042_0084702 3300049578 Bacteria 2273
409 Ga0501046_0148029 3300049580 Bacteria 1772
410 Ga0501047_0277953 3300049581 Bacteria 1519
411 Ga0501048_0103836 3300049582 Bacteria 2006
412 Ga0501070_0243552 3300049586 Bacteria 1472
413 Ga0501071_0006942 3300049587 Bacteria 7390
414 Ga0501071_0086277 3300049587 Bacteria 2302
415 Ga0501072_0142607 3300049588 Bacteria 1910
416 Ga0501075_0011737 3300049591 Bacteria 6210
417 Ga0501075_0024152 3300049591 Bacteria 4453
418 Ga0501075_0180180 3300049591 Bacteria 1612
419 Ga0501076_0299913 3300049592 Bacteria 1317
420 Ga0501207_003905 3300049654 Bacteria 2009
421 Ga0501208_002617 3300049655 Bacteria 1904
422 Ga0501208_014094 3300049655 Bacteria 1203
423 Ga0501216_009361 3300049660 Bacteria 1560
424 Ga0501217_010764 3300049661 Bacteria 2011
425 Ga0501228_002638 3300049666 Bacteria 1421
426 Ga0501233_013159 3300049668 Bacteria 1672
427 Ga0501243_014856 3300049675 Bacteria 1247
428 Ga0501225_0048834 3300049705 Bacteria 1176
429 Ga0501245_006523 3300049708 Bacteria 1633
430 Ga0501079_0031805 3300049741 Bacteria 4055
431 Ga0501079_0125621 3300049741 Bacteria 1996
432 Ga0501079_0212605 3300049741 Bacteria 1511
433 Ga0501080_0180745 3300049742 Bacteria 1941
434 Ga0501081_0048241 3300049743 Bacteria 2931
435 Ga0501083_0091835 3300049744 Bacteria 2004
436 Ga0501035_0006789 3300049822 Bacteria 10695
437 Ga0501044_0000178 3300049823 Bacteria 78835
438 Ga0501045_0035959 3300049824 Bacteria 3596
439 Ga0501212_012817 3300049851 Bacteria 1224
440 nmdc:mga03683_954_c1 3300050489 Bacteria 8400
441 nmdc:mga00v17_162721_c1 3300050491 Bacteria 1437
442 nmdc:mga00v17_26379_c1 3300050491 Bacteria 3386
443 nmdc:mga00v17_77923_c1 3300050491 Bacteria 2065
444 nmdc:mga0yw44_77313_c1 3300050492 Bacteria 2079
445 nmdc:mga0yw44_83340_c1 3300050492 Bacteria 2008
446 nmdc:mga0k408_18357_c1 3300050493 Bacteria 3904
447 nmdc:mga0k408_1897_c1 3300050493 Bacteria 11189
448 nmdc:mga0k408_20427_c1 3300050493 Bacteria 3710
449 nmdc:mga0k408_30867_c1 3300050493 Bacteria 3057
450 nmdc:mga06z11_18559_c1 3300050494 Bacteria 2870
451 nmdc:mga06z11_24286_c1 3300050494 Bacteria 2857
452 nmdc:mga06z11_54649_c1 3300050494 Bacteria 2059
453 nmdc:mga06z11_71792_c1 3300050494 Bacteria 1834
454 nmdc:mga07m45_134293_c1 3300050496 Bacteria 1432
455 nmdc:mga07m45_40871_c1 3300050496 Bacteria 1773
456 nmdc:mga07m45_62836_c1 3300050496 Bacteria 2105
457 nmdc:mga05p37_2487_c1 3300050507 Bacteria 21426
458 nmdc:mga05p37_426_c1 3300050507 Bacteria 45626
459 nmdc:mga05p37_6042_c1 3300050507 Bacteria 14252
460 nmdc:mga09592_23119_c1 3300050508 Bacteria 5132
461 nmdc:mga09592_90257_c1 3300050508 Bacteria 2618
462 nmdc:mga0qj67_3700_c1 3300050509 Bacteria 11041
463 nmdc:mga0qj67_9883_c1 3300050509 Bacteria 7113
464 nmdc:mga06r32_111566_c1 3300050510 Bacteria 2691
465 nmdc:mga06r32_500108_c1 3300050510 Bacteria 1193
466 nmdc:mga06r32_6023_c1 3300050510 Bacteria 10911
467 nmdc:mga08y16_161951_c1 3300050511 Bacteria 2325
468 nmdc:mga08y16_396212_c1 3300050511 Bacteria 1414
469 nmdc:mga08y16_539620_c1 3300050511 Bacteria 1181
470 nmdc:mga08y16_65382_c1 3300050511 Bacteria 3797
471 nmdc:mga0n895_196712_c1 3300050512 Bacteria 2047
472 nmdc:mga0rr50_33300_c1 3300050513 Bacteria 3680
473 nmdc:mga0a205_110742_c1 3300050515 Bacteria 2644
474 nmdc:mga0a205_131591_c1 3300050515 Bacteria 2402
475 Ga0495601_0118382 3300053077 Bacteria 1719
476 Ga0495619_0116791 3300053085 Unclassified 1827
477 Ga0501084_0124681 3300054114 Bacteria 2167
478 Ga0501082_0000180 3300060353 Bacteria 54743
479 2788434580 2786546940 Bacteria 6396474
480 Ga0157370_10297877
481 Ga0065712_10000695
482 Ga0065712_10024559
483 Ga0065712_10083728
484 Ga0065715_10004449
485 Ga0065715_10019213
486 Ga0065715_10112814
487 Ga0065707_10085144
488 Ga0070683_100000025
489 Ga0070683_100005354
490 Ga0070683_100028222
491 Ga0070683_100038998
492 Ga0070690_100215432
493 Ga0070670_100001152
494 Ga0068869_100055733
495 Ga0070680_100093453
496 Ga0070689_100069193
497 Ga0070669_100007713
498 Ga0070671_100027761
499 Ga0070671_100035673
500 Ga0070673_100015358
501 Ga0070667_100286307
502 Ga0070709_10192395
503 Ga0070713_100107746
504 Ga0070701_10100388
505 Ga0070663_100156553
506 Ga0070678_100069227
507 Ga0070681_10148798
508 Ga0070681_10375821
509 Ga0070679_100000725
510 Ga0070684_100000383
511 Ga0070684_100000515
512 Ga0070672_100196332
513 Ga0070693_100130720
514 Ga0070665_100312449
515 Ga0068855_100135966
516 Ga0068855_100169814
517 Ga0068855_100437949
518 Ga0070664_100001660
519 Ga0070664_100084799
520 Ga0068857_100004089
521 Ga0068856_100144233
522 Ga0068856_100396572
523 Ga0068859_100130647
524 Ga0068859_100297903
525 Ga0068864_100045810
526 Ga0068864_100069806
527 Ga0068861_100020252
528 Ga0068870_10034164
529 Ga0068863_100118480
530 Ga0068860_100291512
531 Ga0068860_100562147
532 Ga0068862_100149842
533 Ga0068862_100171101
534 Ga0075365_10252719
535 Ga0075368_10032408
536 Ga0075368_10035912
537 Ga0075364_10007642
538 Ga0075364_10049183
539 Ga0075362_10000867
540 Ga0075367_10014418
541 Ga0075367_10022625
542 Ga0075367_10115633
543 Ga0075369_10098818
544 Ga0075366_10006098
545 Ga0075366_10035660
546 Ga0075366_10066261
547 Ga0097621_100442184
548 Ga0075370_10018028
549 Ga0075370_10060534
550 Ga0075370_10065897
551 Ga0075370_10139043
552 Ga0075428_100038144
553 Ga0075430_100030750
554 Ga0075430_100042498
555 Ga0075431_100071106
556 Ga0075433_10060313
557 Ga0068865_100032475
558 Ga0097620_100130643
559 Ga0097620_100297934
560 Ga0075435_100025360
561 Ga0105240_10059056
562 Ga0105240_10208985
563 Ga0105240_10284697
564 Ga0105240_10556459
565 Ga0111539_10000982
566 Ga0111539_10002888
567 Ga0111539_10046037
568 Ga0111539_10059246
569 Ga0105245_10155663
570 Ga0105247_10029462
571 Ga0114129_10001828
572 Ga0114129_10009923
573 Ga0114129_10028915
574 Ga0114129_10445817
575 Ga0105243_10371876
576 Ga0105242_10231305
577 Ga0105248_10008845
578 Ga0105248_10174269
579 Ga0105248_10622405
580 Ga0105237_10007191
581 Ga0105238_10015968
582 Ga0105238_10061900
583 Ga0105238_10215862
584 Ga0105249_10001093
585 Ga0105239_10017178
586 Ga0105239_10112497
587 Ga0105239_10520075
588 Ga0105246_10090191
589 Ga0105246_10106844
590 Ga0105246_10232420
591 Ga0157371_10213207
592 Ga0157370_10005724
593 Ga0157370_10021040
594 Ga0157370_10036169
595 Ga0157369_10016856
596 Ga0157369_10017268
597 Ga0157369_10148709
598 Ga0157369_10225839
599 Ga0157369_10229196
600 Ga0157369_10404233
601 Ga0157374_10059748
602 Ga0157374_10160182
603 Ga0157374_10224481
604 Ga0157378_10129408
605 Ga0163162_10200910
606 Ga0163162_10459895
607 Ga0157372_10061096
608 Ga0157372_10584989
609 Ga0157372_10595907
610 Ga0157375_10205816
611 Ga0157375_10617901
612 Ga0163163_10005247
613 Ga0163163_10055243
614 Ga0163163_10147057
615 Ga0157377_10027435
616 Ga0213876_10007958
617 Ga0209233_1002882
618 Ga0207697_10014467
619 Ga0207682_10012457
620 Ga0207680_10246180
621 Ga0207645_10160289
622 Ga0207707_10080973
623 Ga0207695_10001734
624 Ga0207695_10006829
625 Ga0207695_10034409
626 Ga0207695_10095926
627 Ga0207695_10171918
628 Ga0207652_10002846
629 Ga0207652_10016608
630 Ga0207681_10031346
631 Ga0207694_10016197
632 Ga0207694_10024523
633 Ga0207650_10010189
634 Ga0207650_10073234
635 Ga0207650_10113485
636 Ga0207659_10029883
637 Ga0207659_10143804
638 Ga0207700_10085718
639 Ga0207644_10184003
640 Ga0207644_10311121
641 Ga0207706_10052532
642 Ga0207691_10015571
643 Ga0207711_10037819
644 Ga0207711_10074845
645 Ga0207711_10207816
646 Ga0207689_10025700
647 Ga0207661_10000028
648 Ga0207661_10044348
649 Ga0207661_10145192
650 Ga0207661_10145740
651 Ga0207679_10005441
652 Ga0207679_10258913
653 Ga0207667_10041971
654 Ga0207667_10296547
655 Ga0207651_10102342
656 Ga0207651_10170004
657 Ga0207712_10012177
658 Ga0207658_10239273
659 Ga0207639_10182565
660 Ga0207678_10010487
661 Ga0207678_10201430
662 Ga0207708_10032850
663 Ga0207702_10089299
664 Ga0207702_10100497
665 Ga0207676_10039114
666 Ga0207676_10065241
667 Ga0207675_100443045
668 Ga0207698_10102384
669 Ga0207428_10217042
670 Ga0268265_10172113
671 Ga0268264_10059658
672 Ga0265337_1001143
673 Ga0265337_1001703
674 Ga0265337_1015210
675 Ga0265337_1020070
676 Ga0265337_1035631
677 Ga0265326_10001819
678 Ga0265326_10016522
679 Ga0265326_10034127
680 Ga0265319_1002524
681 Ga0265319_1002543
682 Ga0265319_1009012
683 Ga0265334_10001421
684 Ga0265334_10012568
685 Ga0265318_10003976
686 Ga0265318_10004022
687 Ga0265318_10007744
688 Ga0265323_10032860
689 Ga0265322_10020507
690 Ga0265336_10000966
691 Ga0265336_10005850
692 Ga0265336_10029357
693 Ga0265338_10000132
694 Ga0265338_10001599
695 Ga0265338_10001670
696 Ga0265338_10009220
697 Ga0265338_10010002
698 Ga0265338_10010230
699 Ga0265338_10015625
700 Ga0265338_10018088
701 Ga0265338_10039855
702 Ga0265338_10057593
703 Ga0265338_10099272
704 Ga0265338_10100770
705 Ga0265338_10117937
706 Ga0265338_10206088
707 Ga0265338_10233483
708 Ga0265338_10243600
709 Ga0265324_10004411
710 Ga0265324_10005726
711 Ga0265324_10031447
712 Ga0265330_10000643
713 Ga0265330_10009412
714 Ga0265320_10000674
715 Ga0265320_10002829
716 Ga0265320_10003295
717 Ga0265320_10005800
718 Ga0265320_10006581
719 Ga0265320_10010468
720 Ga0265325_10000415
721 Ga0265325_10014888
722 Ga0265325_10032487
723 Ga0265325_10033079
724 Ga0265325_10038507
725 Ga0265329_10010148
726 Ga0265340_10012897
727 Ga0265340_10018134
728 Ga0265340_10071874
729 Ga0265339_10005985
730 Ga0265339_10009576
731 Ga0265339_10013931
732 Ga0265339_10024014
733 Ga0265339_10112374
734 Ga0265339_10128976
735 Ga0265331_10006568
736 Ga0265327_10000047
737 Ga0265327_10008670
738 Ga0265316_10002791
739 Ga0265316_10003308
740 Ga0265316_10007041
741 Ga0265316_10007204
742 Ga0265316_10011590
743 Ga0265316_10011953
744 Ga0265316_10020837
745 Ga0265316_10022979
746 Ga0265316_10026816
747 Ga0265316_10037656
748 Ga0265316_10055733
749 Ga0265316_10064065
750 Ga0307408_100010754
751 Ga0307408_100022013
752 Ga0265313_10001128
753 Ga0265313_10001781
754 Ga0265313_10017457
755 Ga0265313_10026745
756 Ga0307508_10000027
757 Ga0265314_10003847
758 Ga0265314_10004319
759 Ga0265314_10008959
760 Ga0265314_10011710
761 Ga0265314_10013566
762 Ga0265314_10030120
763 Ga0265314_10081600
764 Ga0265342_10000156
765 Ga0265342_10003085
766 Ga0265342_10008929
767 Ga0265342_10017750
768 Ga0265342_10068780
769 Ga0265342_10104689
770 Ga0265342_10183586
771 Ga0307405_10119880
772 Ga0307406_10185115
773 Ga0307407_10173423
774 Ga0307409_100113311
775 Ga0307409_100273940
776 Ga0307416_100032405
777 Ga0307411_10083461
778 Ga0307411_10174726
779 Ga0307415_100334196
780 Ga0373946_0072755
781 Ga0316574_0066160
782 Ga0373935_0184317
783 Ga0373933_0038088
784 Ga0373933_0076971
785 Ga0373937_0005049
786 Ga0373937_0007845
787 Ga0316584_0117525
788 Ga0373925_0256408
789 Ga0395899_0048388
790 Ga0395900_0032074
791 Ga0395905_0005426
792 Ga0395905_0519169
793 Ga0436364_1284239
794 Ga0395901_0006659
795 Ga0436365_0873143
796 Ga0451802_1945057
797 Ga0451853_1472122
798 Ga0450920_009157
799 Ga0450896_003444
800 Ga0451577_0000524
801 Ga0451577_0021108
802 Ga0451577_0029436
803 Ga0453683_0002185
804 Ga0466966_0050837
805 Ga0453684_0014599
806 Ga0453684_0080998
807 Ga0453684_0279910
808 Ga0451576_0000163
809 Ga0451576_0009070
810 Ga0451576_0016231
811 Ga0451576_0049758
812 Ga0451576_0196937
813 Ga0495651_0027447
814 Ga0495580_0002514
815 Ga0495582_0207324
816 Ga0495662_0016644
817 Ga0495664_0052026
818 Ga0495628_0199428
819 Ga0495630_0000399
820 Ga0495630_0014993
821 Ga0495630_0091462
822 Ga0495630_0319035
823 Ga0495666_0072393
824 Ga0495652_0022451
825 Ga0495652_0112589
826 Ga0495652_0138933
827 Ga0495640_0026153
828 Ga0495640_0101713
829 Ga0495586_0000074
830 Ga0495586_0034589
831 Ga0495587_0101111
832 Ga0495645_0195693
833 Ga0495645_0245617
834 Ga0495622_0033327
835 Ga0495667_0015880
836 Ga0495667_0040645
837 Ga0495667_0070656
838 Ga0495634_0002925
839 Ga0495634_0004477
840 Ga0495634_0044015
841 Ga0495634_0151428
842 Ga0495635_0082470
843 Ga0495599_0026728
844 Ga0495623_0054749
845 Ga0495647_0028452
846 Ga0495613_0002192
847 Ga0495613_0051397
848 Ga0495613_0082864
849 Ga0495613_0161447
850 Ga0495600_0215875
851 Ga0495604_0184732
852 Ga0495604_0217169
853 Ga0495674_0000585
854 Ga0495674_0006811
855 Ga0495674_0080534
856 Ga0495676_0094335
857 Ga0495680_0012653
858 Ga0495680_0020792
859 Ga0495675_0048672
860 Ga0495684_0004971
861 Ga0495684_0024798
862 Ga0495684_0107309
863 Ga0495602_0030249
864 Ga0495602_0123007
865 Ga0496102_0112610
866 Ga0496103_0152357
867 Ga0496104_0004106
868 Ga0496105_0006312
869 Ga0496107_0190207
870 Ga0496108_0022291
871 Ga0496109_0003511
872 Ga0496112_0005594
873 Ga0496112_0185161
874 Ga0496115_0061523
875 Ga0501292_006494
876 Ga0501295_013506
877 Ga0501298_011325
878 Ga0501299_005777
879 Ga0501300_016195
880 Ga0501031_0068845
881 Ga0501032_0001367
882 Ga0501034_0016694
883 Ga0501036_0087765
884 Ga0501039_0128409
885 Ga0501041_0115296
886 Ga0501042_0020724
887 Ga0501042_0084702
888 Ga0501046_0148029
889 Ga0501047_0277953
890 Ga0501048_0103836
891 Ga0501070_0243552
892 Ga0501071_0006942
893 Ga0501071_0086277
894 Ga0501072_0142607
895 Ga0501075_0011737
896 Ga0501075_0024152
897 Ga0501075_0180180
898 Ga0501076_0299913
899 Ga0501207_003905
900 Ga0501208_002617
901 Ga0501208_014094
902 Ga0501216_009361
903 Ga0501217_010764
904 Ga0501228_002638
905 Ga0501233_013159
906 Ga0501243_014856
907 Ga0501225_0048834
908 Ga0501245_006523
909 Ga0501079_0031805
910 Ga0501079_0125621
911 Ga0501079_0212605
912 Ga0501080_0180745
913 Ga0501081_0048241
914 Ga0501083_0091835
915 Ga0501035_0006789
916 Ga0501044_0000178
917 Ga0501045_0035959
918 Ga0501212_012817
919 nmdc:mga03683_954_c1
920 nmdc:mga00v17_162721_c1
921 nmdc:mga00v17_26379_c1
922 nmdc:mga00v17_77923_c1
923 nmdc:mga0yw44_77313_c1
924 nmdc:mga0yw44_83340_c1
925 nmdc:mga0k408_18357_c1
926 nmdc:mga0k408_1897_c1
927 nmdc:mga0k408_20427_c1
928 nmdc:mga0k408_30867_c1
929 nmdc:mga06z11_18559_c1
930 nmdc:mga06z11_24286_c1
931 nmdc:mga06z11_54649_c1
932 nmdc:mga06z11_71792_c1
933 nmdc:mga07m45_134293_c1
934 nmdc:mga07m45_40871_c1
935 nmdc:mga07m45_62836_c1
936 nmdc:mga05p37_2487_c1
937 nmdc:mga05p37_426_c1
938 nmdc:mga05p37_6042_c1
939 nmdc:mga09592_23119_c1
940 nmdc:mga09592_90257_c1
941 nmdc:mga0qj67_3700_c1
942 nmdc:mga0qj67_9883_c1
943 nmdc:mga06r32_111566_c1
944 nmdc:mga06r32_500108_c1
945 nmdc:mga06r32_6023_c1
946 nmdc:mga08y16_161951_c1
947 nmdc:mga08y16_396212_c1
948 nmdc:mga08y16_539620_c1
949 nmdc:mga08y16_65382_c1
950 nmdc:mga0n895_196712_c1
951 nmdc:mga0rr50_33300_c1
952 nmdc:mga0a205_110742_c1
953 nmdc:mga0a205_131591_c1
954 Ga0495601_0118382
955 Ga0495619_0116791
956 Ga0501084_0124681
957 Ga0501082_0000180
958 2788434580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

17

357

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ay8-assembly2.cif.gz_B semet-derivative of a methyltransferase from m. mazei 0.8707 7 344
4ay8-assembly2.cif.gz_B semet-derivative of a methyltransferase from m. mazei 0.8444 7 344
1r3w-assembly1.cif.gz_A-2 uroporphyrinogen decarboxylase y164f mutant in complex with coproporphyrinogen-iii 0.8266 8 345
1r3s-assembly1.cif.gz_A uroporphyrinogen decarboxylase single mutant d86g in complex with coproporphyrinogen-i 0.8259 8 345
2q6z-assembly1.cif.gz_A uroporphyrinogen decarboxylase g168r single mutant apo-enzyme 0.8223 8 349
ID Description Score Start End Superfamily
1r3sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8259 8 345 3.20.20.210
4ay8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8228 7 344 3.20.20.210
af_P32347_4_362_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8174 7 346 3.20.20.210
2infD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8113 7 349 3.20.20.210
2infD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8028 7 349 3.20.20.210
ID Description Score Start End GO Terms
AF-B5JER9-F1-model_v4 Uroporphyrinogen decarboxylase superfamily 0.9967 1 347 GO:0004853
GO:0006779
AF-A0A7Y5G028-F1-model_v4 Uroporphyrinogen decarboxylase 0.9965 1 231 GO:0004853
GO:0006779
AF-A0A7Y5G4L6-F1-model_v4 Uroporphyrinogen decarboxylase 0.9937 259 347 GO:0004853
GO:0006779
AF-B5JER9-F1-model_v4 Uroporphyrinogen decarboxylase superfamily 0.991 1 347 GO:0004853
GO:0006779
AF-A0A2N9MF58-F1-model_v4 Uroporphyrinogen decarboxylase (URO-D) 0.9888 196 348 GO:0004853
GO:0006779

Map