F452026

General Info

Members Datasets Scaffolds Average Seq Length
479 196 958 149

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10003680|Ga0081539_1000368018
Length 167
Sequence MGTLASELGSHAERISGHPRVYIDANVPAGLVAFMRTQLQWDVLFVMEHDDLRRARDGEHYRLARQLRRTLITFDRDYLDDRKFPLAESGGVLVLTAPQEDGYITLLRRLDKELFQPDPAALPLECRKLHAHVDWTSMPGATLASGNAARAFPQSGRKAVKAFREIP

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
141 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.63
Rhizosphere 99.37
Stem 0
Stem Tuber 0
Unclassified 21.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10003680 3300005985 Bacteria 18367
2 JGI25406J46586_10000195 3300003203 Bacteria 26897
3 JGI25406J46586_10004794 3300003203 Bacteria 6291
4 Ga0065704_10256931 3300005289 Unclassified 975
5 Ga0065712_10002679 3300005290 Bacteria 9203
6 Ga0065715_10245267 3300005293 Bacteria 1177
7 Ga0065707_10175687 3300005295 Bacteria 1407
8 Ga0065707_10210758 3300005295 Unclassified 1266
9 Ga0070676_10258228 3300005328 Bacteria 1166
10 Ga0070690_100045702 3300005330 Bacteria 2782
11 Ga0070690_100150215 3300005330 Bacteria 1589
12 Ga0070677_10027358 3300005333 Bacteria 2146
13 Ga0068869_100006947 3300005334 Bacteria 7203
14 Ga0068869_100079439 3300005334 Bacteria 2445
15 Ga0068869_100152635 3300005334 Bacteria 1792
16 Ga0070680_100064512 3300005336 Bacteria 3002
17 Ga0070680_100726109 3300005336 Unclassified 855
18 Ga0070680_101342917 3300005336 Unclassified 619
19 Ga0068868_100608527 3300005338 Unclassified 969
20 Ga0068868_101025902 3300005338 Unclassified 756
21 Ga0070689_100195214 3300005340 Bacteria 1650
22 Ga0070687_100006548 3300005343 Bacteria 4781
23 Ga0070687_100545381 3300005343 Unclassified 788
24 Ga0070661_100021631 3300005344 Bacteria 4596
25 Ga0070692_10049530 3300005345 Bacteria 2179
26 Ga0070692_10445990 3300005345 Unclassified 827
27 Ga0070668_100057144 3300005347 Bacteria 3015
28 Ga0070669_100014791 3300005353 Bacteria 5556
29 Ga0070669_100336306 3300005353 Bacteria 1222
30 Ga0070669_100901963 3300005353 Bacteria 755
31 Ga0070675_100015303 3300005354 Bacteria 6062
32 Ga0070675_100059645 3300005354 Unclassified 3148
33 Ga0070675_100094044 3300005354 Bacteria 2515
34 Ga0070675_100346681 3300005354 Bacteria 1316
35 Ga0070675_100572297 3300005354 Unclassified 1023
36 Ga0070674_100000507 3300005356 Bacteria 19580
37 Ga0070674_100047832 3300005356 Bacteria 2933
38 Ga0070673_100150219 3300005364 Bacteria 1972
39 Ga0070673_100407070 3300005364 Unclassified 1217
40 Ga0070673_100481276 3300005364 Bacteria 1120
41 Ga0070688_100224142 3300005365 Bacteria 1326
42 Ga0070688_100770794 3300005365 Bacteria 750
43 Ga0070659_100531986 3300005366 Bacteria 1005
44 Ga0070659_101344017 3300005366 Bacteria 634
45 Ga0070667_100269325 3300005367 Bacteria 1527
46 Ga0070667_100371432 3300005367 Bacteria 1298
47 Ga0070701_10022653 3300005438 Bacteria 3013
48 Ga0070701_10100576 3300005438 Bacteria 1601
49 Ga0070700_100086602 3300005441 Bacteria 2034
50 Ga0070700_100244393 3300005441 Unclassified 1284
51 Ga0070700_100386798 3300005441 Bacteria 1048
52 Ga0070700_100487313 3300005441 Unclassified 946
53 Ga0070700_100719435 3300005441 Unclassified 796
54 Ga0070694_100235634 3300005444 Bacteria 1379
55 Ga0070694_100463304 3300005444 Bacteria 1003
56 Ga0070708_100617692 3300005445 Bacteria 1022
57 Ga0070663_100185384 3300005455 Bacteria 1617
58 Ga0070663_101090951 3300005455 Unclassified 698
59 Ga0070678_100033222 3300005456 Bacteria 3579
60 Ga0070678_100105846 3300005456 Bacteria 2191
61 Ga0070678_101042569 3300005456 Bacteria 753
62 Ga0070662_100110624 3300005457 Bacteria 2092
63 Ga0070662_100265396 3300005457 Bacteria 1384
64 Ga0070662_100522774 3300005457 Unclassified 992
65 Ga0068867_100009567 3300005459 Bacteria 6834
66 Ga0068867_100071016 3300005459 Bacteria 2604
67 Ga0068867_100342576 3300005459 Bacteria 1245
68 Ga0070685_10005325 3300005466 Bacteria 6525
69 Ga0070707_100245311 3300005468 Bacteria 1743
70 Ga0070698_100097575 3300005471 Unclassified 2914
71 Ga0070698_100630492 3300005471 Bacteria 1013
72 Ga0070698_101231538 3300005471 Bacteria 698
73 Ga0070698_101735097 3300005471 Unclassified 577
74 Ga0070699_100027470 3300005518 Bacteria 4908
75 Ga0070684_100381115 3300005535 Bacteria 1299
76 Ga0070672_100003238 3300005543 Bacteria 10539
77 Ga0070672_100048699 3300005543 Bacteria 3294
78 Ga0070686_100098154 3300005544 Bacteria 1973
79 Ga0070686_100856032 3300005544 Bacteria 737
80 Ga0070695_100538954 3300005545 Unclassified 908
81 Ga0070695_100618591 3300005545 Unclassified 852
82 Ga0070665_100039681 3300005548 Bacteria 4734
83 Ga0070665_101284577 3300005548 Unclassified 742
84 Ga0070704_100412505 3300005549 Bacteria 1155
85 Ga0070704_100579400 3300005549 Unclassified 984
86 Ga0070664_100014724 3300005564 Bacteria 6387
87 Ga0070664_100223383 3300005564 Bacteria 1686
88 Ga0070664_101387738 3300005564 Bacteria 664
89 Ga0068857_101239831 3300005577 Unclassified 723
90 Ga0068852_100360004 3300005616 Bacteria 1423
91 Ga0068859_100021479 3300005617 Bacteria 6480
92 Ga0068859_100096747 3300005617 Bacteria 3005
93 Ga0068859_100283485 3300005617 Bacteria 1749
94 Ga0068859_100852948 3300005617 Bacteria 997
95 Ga0068864_100233516 3300005618 Bacteria 1702
96 Ga0068864_100285902 3300005618 Bacteria 1540
97 Ga0068864_100652808 3300005618 Unclassified 1024
98 Ga0068864_101380691 3300005618 Bacteria 706
99 Ga0068866_10300155 3300005718 Unclassified 1003
100 Ga0068866_10367651 3300005718 Bacteria 919
101 Ga0068861_100001696 3300005719 Bacteria 14142
102 Ga0068861_101805734 3300005719 Unclassified 607
103 Ga0068870_10000982 3300005840 Bacteria 11253
104 Ga0068870_10018374 3300005840 Bacteria 3375
105 Ga0068870_10107598 3300005840 Bacteria 1586
106 Ga0068863_100008373 3300005841 Bacteria 10098
107 Ga0068858_100004450 3300005842 Bacteria 13737
108 Ga0068860_100163929 3300005843 Bacteria 2144
109 Ga0068860_101197842 3300005843 Bacteria 780
110 Ga0068860_102425655 3300005843 Bacteria 544
111 Ga0068862_100013478 3300005844 Bacteria 6768
112 Ga0068862_100098776 3300005844 Bacteria 2551
113 Ga0081539_10000024 3300005985 Bacteria 354702
114 Ga0081539_10000096 3300005985 Bacteria 204059
115 Ga0081539_10005511 3300005985 Bacteria 12854
116 Ga0097621_100073282 3300006237 Bacteria 2835
117 Ga0068871_100819948 3300006358 Bacteria 859
118 Ga0068871_100869340 3300006358 Bacteria 834
119 Ga0075428_100001181 3300006844 Bacteria 27942
120 Ga0075428_100003208 3300006844 Bacteria 17888
121 Ga0075428_100009166 3300006844 Bacteria 10979
122 Ga0075428_100048883 3300006844 Unclassified 4641
123 Ga0075428_100336643 3300006844 Unclassified 1621
124 Ga0075428_100564700 3300006844 Bacteria 1216
125 Ga0075430_100001472 3300006846 Bacteria 19177
126 Ga0075430_100041309 3300006846 Bacteria 3902
127 Ga0075430_100047787 3300006846 Bacteria 3614
128 Ga0075430_100055708 3300006846 Bacteria 3325
129 Ga0075430_100058844 3300006846 Bacteria 3230
130 Ga0075430_100142689 3300006846 Bacteria 1994
131 Ga0075430_100859125 3300006846 Unclassified 748
132 Ga0075430_101008568 3300006846 Unclassified 686
133 Ga0075431_100000025 3300006847 Bacteria 79014
134 Ga0075431_100008858 3300006847 Bacteria 10082
135 Ga0075431_100016073 3300006847 Bacteria 7595
136 Ga0075431_100058608 3300006847 Bacteria 3974
137 Ga0075431_100116048 3300006847 Bacteria 2764
138 Ga0075431_100304275 3300006847 Bacteria 1610
139 Ga0075431_100735677 3300006847 Bacteria 962
140 Ga0075431_101171274 3300006847 Unclassified 732
141 Ga0075433_10000366 3300006852 Bacteria 28421
142 Ga0075433_10002310 3300006852 Bacteria 14523
143 Ga0075433_10030257 3300006852 Bacteria 4619
144 Ga0075434_100000296 3300006871 Bacteria 35351
145 Ga0075434_100005175 3300006871 Bacteria 11841
146 Ga0075434_100064660 3300006871 Unclassified 3643
147 Ga0075429_100005680 3300006880 Bacteria 10757
148 Ga0075429_100051933 3300006880 Bacteria 3566
149 Ga0075429_100124845 3300006880 Bacteria 2251
150 Ga0075429_100333482 3300006880 Unclassified 1328
151 Ga0075429_100817736 3300006880 Bacteria 816
152 Ga0068865_100097243 3300006881 Bacteria 2148
153 Ga0068865_101640472 3300006881 Unclassified 579
154 Ga0097620_100021478 3300006931 Bacteria 6480
155 Ga0097620_100096747 3300006931 Bacteria 3005
156 Ga0097620_100283472 3300006931 Bacteria 1749
157 Ga0097620_100853029 3300006931 Bacteria 997
158 Ga0097620_100966405 3300006931 Unclassified 935
159 Ga0075435_100147566 3300007076 Bacteria 1976
160 Ga0111539_10003361 3300009094 Bacteria 21115
161 Ga0111539_10004354 3300009094 Bacteria 18543
162 Ga0111539_10009038 3300009094 Bacteria 12610
163 Ga0111539_10009686 3300009094 Bacteria 12159
164 Ga0111539_10015788 3300009094 Bacteria 9381
165 Ga0111539_10024410 3300009094 Bacteria 7420
166 Ga0111539_10038906 3300009094 Bacteria 5736
167 Ga0111539_10082004 3300009094 Unclassified 3793
168 Ga0111539_10253309 3300009094 Bacteria 2050
169 Ga0111539_10890550 3300009094 Unclassified 1035
170 Ga0111539_12087381 3300009094 Unclassified 657
171 Ga0114129_10025118 3300009147 Bacteria 8445
172 Ga0114129_10066953 3300009147 Bacteria 5009
173 Ga0114129_10078283 3300009147 Bacteria 4599
174 Ga0114129_10111712 3300009147 Bacteria 3770
175 Ga0114129_10149053 3300009147 Bacteria 3202
176 Ga0114129_10153704 3300009147 Unclassified 3148
177 Ga0105242_10547260 3300009176 Unclassified 1109
178 Ga0105237_10613104 3300009545 Unclassified 1095
179 Ga0105249_10003450 3300009553 Bacteria 13696
180 Ga0105249_10429254 3300009553 Unclassified 1357
181 Ga0105249_11354210 3300009553 Bacteria 783
182 Ga0105249_11385393 3300009553 Bacteria 775
183 Ga0105246_10017635 3300011119 Bacteria 4541
184 Ga0157371_10133427 3300013102 Bacteria 1767
185 Ga0157370_10345362 3300013104 Unclassified 1372
186 Ga0163162_10037307 3300013306 Bacteria 4849
187 Ga0163162_10150019 3300013306 Bacteria 2448
188 Ga0157375_10076252 3300013308 Archaea 3379
189 Ga0157375_10084074 3300013308 Bacteria 3230
190 Ga0157375_10401377 3300013308 Unclassified 1537
191 Ga0163163_10139152 3300014325 Bacteria 2469
192 Ga0157380_10014931 3300014326 Bacteria 5695
193 Ga0157380_10026368 3300014326 Bacteria 4412
194 Ga0157380_10216870 3300014326 Bacteria 1709
195 Ga0157380_10521527 3300014326 Unclassified 1159
196 Ga0157380_10764610 3300014326 Bacteria 979
197 Ga0157380_10908255 3300014326 Unclassified 907
198 Ga0157377_10017764 3300014745 Bacteria 3686
199 Ga0157379_10003949 3300014968 Bacteria 12646
200 Ga0163161_10064642 3300017792 Bacteria 2669
201 Ga0207673_1009761 3300025290 Bacteria 1229
202 Ga0207697_10059591 3300025315 Bacteria 1587
203 Ga0207682_10000114 3300025893 Bacteria 37193
204 Ga0207682_10004533 3300025893 Bacteria 5790
205 Ga0207682_10070305 3300025893 Bacteria 1482
206 Ga0207642_10047075 3300025899 Bacteria 1926
207 Ga0207688_10000023 3300025901 Bacteria 49264
208 Ga0207688_10128281 3300025901 Bacteria 1485
209 Ga0207680_10389023 3300025903 Bacteria 984
210 Ga0207647_10059414 3300025904 Bacteria 2340
211 Ga0207645_10001465 3300025907 Bacteria 19281
212 Ga0207645_10089782 3300025907 Bacteria 1976
213 Ga0207643_10000592 3300025908 Bacteria 22990
214 Ga0207643_10023064 3300025908 Bacteria 3431
215 Ga0207643_10119004 3300025908 Bacteria 1563
216 Ga0207660_10512385 3300025917 Unclassified 974
217 Ga0207660_10584269 3300025917 Unclassified 909
218 Ga0207662_10003205 3300025918 Bacteria 8372
219 Ga0207662_10504910 3300025918 Unclassified 833
220 Ga0207649_10017453 3300025920 Bacteria 4067
221 Ga0207649_10709984 3300025920 Unclassified 780
222 Ga0207646_10497551 3300025922 Bacteria 1098
223 Ga0207681_10424593 3300025923 Bacteria 1078
224 Ga0207681_10564866 3300025923 Unclassified 937
225 Ga0207681_11017265 3300025923 Unclassified 695
226 Ga0207650_10022193 3300025925 Bacteria 4493
227 Ga0207659_10003303 3300025926 Bacteria 9661
228 Ga0207659_10037176 3300025926 Bacteria 3378
229 Ga0207659_10076139 3300025926 Bacteria 2465
230 Ga0207659_10136560 3300025926 Bacteria 1899
231 Ga0207659_10343007 3300025926 Bacteria 1237
232 Ga0207690_10351266 3300025932 Bacteria 1166
233 Ga0207690_10489293 3300025932 Bacteria 994
234 Ga0207706_10001356 3300025933 Bacteria 24456
235 Ga0207706_10025547 3300025933 Bacteria 5291
236 Ga0207706_10285072 3300025933 Bacteria 1440
237 Ga0207670_10096559 3300025936 Bacteria 2102
238 Ga0207669_10000302 3300025937 Bacteria 22684
239 Ga0207669_10977313 3300025937 Unclassified 710
240 Ga0207704_10074110 3300025938 Bacteria 2171
241 Ga0207704_10461268 3300025938 Unclassified 1016
242 Ga0207704_10508970 3300025938 Unclassified 972
243 Ga0207691_10001105 3300025940 Bacteria 26841
244 Ga0207691_10006272 3300025940 Bacteria 11478
245 Ga0207691_10030540 3300025940 Bacteria 5035
246 Ga0207689_10000546 3300025942 Bacteria 35815
247 Ga0207689_10018669 3300025942 Bacteria 5851
248 Ga0207689_10074825 3300025942 Bacteria 2783
249 Ga0207689_10120920 3300025942 Bacteria 2154
250 Ga0207651_10039141 3300025960 Bacteria 3123
251 Ga0207651_10514561 3300025960 Bacteria 1036
252 Ga0207651_10630712 3300025960 Unclassified 939
253 Ga0207651_10651666 3300025960 Unclassified 924
254 Ga0207712_10073316 3300025961 Archaea 2469
255 Ga0207712_11915002 3300025961 Unclassified 531
256 Ga0207668_10095661 3300025972 Unclassified 2193
257 Ga0207658_10046408 3300025986 Bacteria 3173
258 Ga0207677_10823499 3300026023 Unclassified 832
259 Ga0207677_11740968 3300026023 Unclassified 578
260 Ga0207703_10140090 3300026035 Bacteria 2098
261 Ga0207678_10221172 3300026067 Bacteria 1621
262 Ga0207678_10305283 3300026067 Bacteria 1368
263 Ga0207708_10159155 3300026075 Bacteria 1783
264 Ga0207708_11019541 3300026075 Unclassified 720
265 Ga0207648_10017355 3300026089 Bacteria 6554
266 Ga0207648_10101240 3300026089 Bacteria 2525
267 Ga0207648_10165550 3300026089 Bacteria 1953
268 Ga0207648_10500894 3300026089 Bacteria 1111
269 Ga0207676_10065942 3300026095 Bacteria 2885
270 Ga0207676_10136278 3300026095 Unclassified 2095
271 Ga0207674_10161414 3300026116 Bacteria 2195
272 Ga0207674_10211806 3300026116 Bacteria 1887
273 Ga0207674_10296013 3300026116 Bacteria 1567
274 Ga0207675_100008677 3300026118 Bacteria 9555
275 Ga0207675_100026542 3300026118 Bacteria 5392
276 Ga0207675_100130457 3300026118 Unclassified 2383
277 Ga0207683_10012629 3300026121 Bacteria 7206
278 Ga0207683_10065426 3300026121 Bacteria 3206
279 Ga0207683_10265405 3300026121 Unclassified 1568
280 Ga0207698_10372104 3300026142 Unclassified 1357
281 Ga0209981_1042299 3300027378 Bacteria 682
282 Ga0209982_1053859 3300027552 Unclassified 650
283 Ga0209970_1035231 3300027614 Unclassified 879
284 Ga0209998_10149759 3300027717 Unclassified 599
285 Ga0209974_10289882 3300027876 Bacteria 624
286 Ga0207428_10000494 3300027907 Bacteria 47124
287 Ga0207428_10005684 3300027907 Bacteria 11588
288 Ga0207428_10006726 3300027907 Bacteria 10555
289 Ga0207428_10016594 3300027907 Bacteria 6331
290 Ga0207428_10019951 3300027907 Bacteria 5708
291 Ga0268266_10249091 3300028379 Bacteria 1643
292 Ga0268266_10991836 3300028379 Unclassified 813
293 Ga0268265_10174933 3300028380 Bacteria 1839
294 Ga0268265_11082078 3300028380 Unclassified 795
295 Ga0268265_11148769 3300028380 Unclassified 772
296 Ga0268265_11635814 3300028380 Unclassified 649
297 Ga0268264_10134811 3300028381 Bacteria 2194
298 Ga0268264_10198575 3300028381 Bacteria 1833
299 Ga0307408_100107665 3300031548 Bacteria 2135
300 Ga0307408_100266936 3300031548 Bacteria 1419
301 Ga0307408_100420850 3300031548 Bacteria 1152
302 Ga0307408_100684177 3300031548 Bacteria 920
303 Ga0307408_100835615 3300031548 Unclassified 838
304 Ga0307405_10046149 3300031731 Unclassified 2675
305 Ga0307405_10089216 3300031731 Bacteria 2036
306 Ga0307405_10206495 3300031731 Bacteria 1431
307 Ga0307405_10289160 3300031731 Bacteria 1238
308 Ga0307405_10582465 3300031731 Unclassified 910
309 Ga0307405_10806830 3300031731 Unclassified 787
310 Ga0307413_10044298 3300031824 Bacteria 2629
311 Ga0307413_10197187 3300031824 Bacteria 1451
312 Ga0307413_10564887 3300031824 Bacteria 925
313 Ga0307410_10040939 3300031852 Bacteria 3052
314 Ga0307410_10063160 3300031852 Unclassified 2539
315 Ga0307410_10202822 3300031852 Bacteria 1515
316 Ga0307410_10378062 3300031852 Bacteria 1139
317 Ga0307406_10246449 3300031901 Bacteria 1343
318 Ga0307406_11789399 3300031901 Bacteria 546
319 Ga0307407_10034039 3300031903 Unclassified 2785
320 Ga0307407_10075939 3300031903 Bacteria 2016
321 Ga0307407_10294244 3300031903 Bacteria 1129
322 Ga0307407_10432545 3300031903 Bacteria 951
323 Ga0307412_10021653 3300031911 Bacteria 3930
324 Ga0307412_10034122 3300031911 Bacteria 3241
325 Ga0307412_10372766 3300031911 Bacteria 1153
326 Ga0307412_10399972 3300031911 Bacteria 1118
327 Ga0307412_10921224 3300031911 Unclassified 767
328 Ga0307409_100050111 3300031995 Bacteria 3187
329 Ga0307409_100073318 3300031995 Bacteria 2730
330 Ga0307409_100084984 3300031995 Bacteria 2571
331 Ga0307409_100377332 3300031995 Bacteria 1347
332 Ga0307409_102051523 3300031995 Bacteria 601
333 Ga0307416_100007738 3300032002 Bacteria 6867
334 Ga0307416_100024050 3300032002 Bacteria 4436
335 Ga0307416_100819888 3300032002 Bacteria 1027
336 Ga0307416_100952657 3300032002 Bacteria 960
337 Ga0307416_101056725 3300032002 Bacteria 916
338 Ga0307416_101486226 3300032002 Unclassified 783
339 Ga0307416_101652941 3300032002 Bacteria 745
340 Ga0307414_10024483 3300032004 Bacteria 3851
341 Ga0307414_10046460 3300032004 Bacteria 2981
342 Ga0307414_10061170 3300032004 Unclassified 2666
343 Ga0307414_10155653 3300032004 Bacteria 1809
344 Ga0307411_10071711 3300032005 Bacteria 2349
345 Ga0307411_10094204 3300032005 Bacteria 2099
346 Ga0307411_10262659 3300032005 Bacteria 1364
347 Ga0307411_10523025 3300032005 Bacteria 1007
348 Ga0307411_10853590 3300032005 Bacteria 806
349 Ga0307415_100001807 3300032126 Bacteria 10477
350 Ga0307415_100119084 3300032126 Unclassified 1976
351 Ga0307415_101615600 3300032126 Bacteria 623
352 Ga0373960_0228728 3300035121 Bacteria 668
353 Ga0439453_0038978 3300041408 Bacteria 926
354 Ga0450923_017470 3300042125 Bacteria 1362
355 Ga0439446_0158507 3300042156 Unclassified 747
356 Ga0450908_016882 3300042184 Unclassified 1299
357 Ga0439435_0029720 3300042436 Bacteria 1477
358 Ga0450916_031128 3300042530 Bacteria 777
359 Ga0453683_0064379 3300044673 Bacteria 2292
360 Ga0451576_0162026 3300045051 Bacteria 2335
361 Ga0451576_0327454 3300045051 Bacteria 1603
362 Ga0451576_0613010 3300045051 Bacteria 1144
363 Ga0495598_0074315 3300046537 Unclassified 1077
364 Ga0495598_0139541 3300046537 Unclassified 838
365 Ga0495633_0162678 3300046558 Bacteria 1030
366 Ga0495656_0128847 3300046615 Bacteria 1202
367 Ga0495670_0348315 3300046691 Unclassified 797
368 Ga0495636_0137906 3300047318 Bacteria 1088
369 Ga0496109_0119720 3300048912 Unclassified 2452
370 Ga0496110_0810079 3300048913 Bacteria 841
371 Ga0496110_0922614 3300048913 Unclassified 780
372 Ga0501291_116336 3300049514 Bacteria 575
373 Ga0501031_0109558 3300049568 Bacteria 1803
374 Ga0501031_0239718 3300049568 Unclassified 1179
375 Ga0501032_0615946 3300049569 Unclassified 690
376 Ga0501033_0108966 3300049570 Bacteria 2017
377 Ga0501033_0175479 3300049570 Bacteria 1538
378 Ga0501036_0061489 3300049572 Bacteria 3181
379 Ga0501039_0037141 3300049575 Bacteria 3760
380 Ga0501039_0188405 3300049575 Bacteria 1622
381 Ga0501040_0019251 3300049576 Bacteria 4541
382 Ga0501040_0059534 3300049576 Bacteria 2624
383 Ga0501041_0019574 3300049577 Bacteria 4043
384 Ga0501041_0033428 3300049577 Bacteria 3111
385 Ga0501041_0809494 3300049577 Unclassified 601
386 Ga0501042_0002722 3300049578 Bacteria 10899
387 Ga0501042_0003000 3300049578 Bacteria 10502
388 Ga0501042_0090367 3300049578 Bacteria 2198
389 Ga0501043_0197330 3300049579 Bacteria 1563
390 Ga0501046_0039955 3300049580 Bacteria 3753
391 Ga0501046_0111099 3300049580 Bacteria 2094
392 Ga0501048_0060791 3300049582 Bacteria 2677
393 Ga0501048_0084011 3300049582 Bacteria 2245
394 Ga0501068_0060676 3300049584 Bacteria 2297
395 Ga0501071_0042467 3300049587 Bacteria 3258
396 Ga0501071_0192552 3300049587 Bacteria 1530
397 Ga0501071_0318335 3300049587 Bacteria 1181
398 Ga0501071_0575320 3300049587 Bacteria 865
399 Ga0501072_0271741 3300049588 Bacteria 1348
400 Ga0501072_0420537 3300049588 Bacteria 1059
401 Ga0501073_0125148 3300049589 Unclassified 1782
402 Ga0501075_0015862 3300049591 Bacteria 5419
403 Ga0501075_0056361 3300049591 Unclassified 2958
404 Ga0501075_0407866 3300049591 Bacteria 1036
405 Ga0501075_1255530 3300049591 Unclassified 562
406 Ga0501076_0024896 3300049592 Bacteria 4630
407 Ga0501076_0029812 3300049592 Bacteria 4245
408 Ga0501077_0023663 3300049593 Bacteria 3895
409 Ga0501077_0661179 3300049593 Unclassified 671
410 Ga0501225_0121334 3300049705 Bacteria 777
411 Ga0501079_0019380 3300049741 Bacteria 5195
412 Ga0501079_0029726 3300049741 Bacteria 4197
413 Ga0501079_0291116 3300049741 Bacteria 1277
414 Ga0501079_0522512 3300049741 Unclassified 933
415 Ga0501080_0102081 3300049742 Bacteria 2661
416 Ga0501080_0361772 3300049742 Bacteria 1309
417 Ga0501080_0606213 3300049742 Bacteria 972
418 Ga0501081_0028418 3300049743 Bacteria 3774
419 Ga0501081_0033985 3300049743 Bacteria 3467
420 Ga0501083_0082114 3300049744 Bacteria 2136
421 Ga0501283_008922 3300049779 Bacteria 1455
422 Ga0501035_0778740 3300049822 Unclassified 766
423 Ga0501045_0063547 3300049824 Bacteria 2709
424 Ga0501045_0096179 3300049824 Bacteria 2191
425 Ga0501045_0426934 3300049824 Bacteria 986
426 nmdc:mga05p37_111938_c1 3300050507 Bacteria 3357
427 nmdc:mga05p37_147727_c1 3300050507 Unclassified 2877
428 nmdc:mga05p37_3607_c1 3300050507 Bacteria 18082
429 nmdc:mga05p37_63429_c1 3300050507 Bacteria 4547
430 nmdc:mga05p37_94919_c1 3300050507 Unclassified 3674
431 nmdc:mga05p37_989193_c1 3300050507 Bacteria 895
432 nmdc:mga09592_19584_c1 3300050508 Bacteria 5556
433 nmdc:mga09592_25220_c1 3300050508 Bacteria 4919
434 nmdc:mga09592_87206_c1 3300050508 Bacteria 2664
435 nmdc:mga0qj67_10392_c1 3300050509 Bacteria 6954
436 nmdc:mga0qj67_133703_c1 3300050509 Unclassified 2009
437 nmdc:mga0qj67_14982_c1 3300050509 Bacteria 5866
438 nmdc:mga0qj67_288666_c1 3300050509 Bacteria 1330
439 nmdc:mga0qj67_39106_c1 3300050509 Bacteria 3724
440 nmdc:mga0qj67_63403_c1 3300050509 Bacteria 2938
441 nmdc:mga0qj67_82829_c1 3300050509 Bacteria 2572
442 nmdc:mga06r32_175401_c1 3300050510 Bacteria 2128
443 nmdc:mga06r32_23748_c1 3300050510 Bacteria 5679
444 nmdc:mga06r32_403847_c1 3300050510 Bacteria 1348
445 nmdc:mga06r32_68318_c1 3300050510 Bacteria 3433
446 nmdc:mga06r32_79464_c1 3300050510 Bacteria 3191
447 nmdc:mga06r32_84836_c1 3300050510 Bacteria 3088
448 nmdc:mga08y16_15347_c1 3300050511 Bacteria 8056
449 nmdc:mga08y16_196142_c1 3300050511 Bacteria 2093
450 nmdc:mga08y16_2212_c1 3300050511 Bacteria 19948
451 nmdc:mga08y16_30759_c1 3300050511 Bacteria 5646
452 nmdc:mga08y16_47346_c1 3300050511 Bacteria 4500
453 nmdc:mga08y16_5476_c1 3300050511 Bacteria 13274
454 nmdc:mga08y16_565952_c1 3300050511 Unclassified 1149
455 nmdc:mga08y16_8750_c1 3300050511 Bacteria 10621
456 nmdc:mga0n895_10804_c1 3300050512 Bacteria 8102
457 nmdc:mga0n895_3573_c1 3300050512 Bacteria 12573
458 nmdc:mga0n895_4404_c1 3300050512 Bacteria 11565
459 nmdc:mga0rr50_15466_c1 3300050513 Bacteria 5038
460 nmdc:mga0rr50_236165_c1 3300050513 Bacteria 1514
461 nmdc:mga0a205_1038_c1 3300050515 Bacteria 23124
462 nmdc:mga0a205_11312_c1 3300050515 Bacteria 8215
463 nmdc:mga0a205_7487_c1 3300050515 Bacteria 9886
464 Ga0501084_0013406 3300054114 Bacteria 6784
465 Ga0501084_0180196 3300054114 Bacteria 1783
466 Ga0590071_000541 3300059421 Bacteria 11028
467 Ga0590071_009233 3300059421 Bacteria 2316
468 Ga0590074_003131 3300059423 Bacteria 2727
469 Ga0590074_038068 3300059423 Unclassified 861
470 Ga0590075_000240 3300059424 Bacteria 15413
471 Ga0590075_036291 3300059424 Unclassified 1256
472 Ga0590077_000250 3300059426 Bacteria 15361
473 Ga0590077_000964 3300059426 Bacteria 7337
474 Ga0590077_012644 3300059426 Bacteria 1752
475 Ga0501082_0013728 3300060353 Bacteria 6963
476 Ga0501082_0039106 3300060353 Bacteria 4092
477 Ga0501082_0505094 3300060353 Bacteria 1057
478 Ga0530510_0005346 3300061734 Bacteria 8881
479 Ga0530510_0163522 3300061734 Bacteria 1647
480 Ga0081539_10003680
481 JGI25406J46586_10000195
482 JGI25406J46586_10004794
483 Ga0065704_10256931
484 Ga0065712_10002679
485 Ga0065715_10245267
486 Ga0065707_10175687
487 Ga0065707_10210758
488 Ga0070676_10258228
489 Ga0070690_100045702
490 Ga0070690_100150215
491 Ga0070677_10027358
492 Ga0068869_100006947
493 Ga0068869_100079439
494 Ga0068869_100152635
495 Ga0070680_100064512
496 Ga0070680_100726109
497 Ga0070680_101342917
498 Ga0068868_100608527
499 Ga0068868_101025902
500 Ga0070689_100195214
501 Ga0070687_100006548
502 Ga0070687_100545381
503 Ga0070661_100021631
504 Ga0070692_10049530
505 Ga0070692_10445990
506 Ga0070668_100057144
507 Ga0070669_100014791
508 Ga0070669_100336306
509 Ga0070669_100901963
510 Ga0070675_100015303
511 Ga0070675_100059645
512 Ga0070675_100094044
513 Ga0070675_100346681
514 Ga0070675_100572297
515 Ga0070674_100000507
516 Ga0070674_100047832
517 Ga0070673_100150219
518 Ga0070673_100407070
519 Ga0070673_100481276
520 Ga0070688_100224142
521 Ga0070688_100770794
522 Ga0070659_100531986
523 Ga0070659_101344017
524 Ga0070667_100269325
525 Ga0070667_100371432
526 Ga0070701_10022653
527 Ga0070701_10100576
528 Ga0070700_100086602
529 Ga0070700_100244393
530 Ga0070700_100386798
531 Ga0070700_100487313
532 Ga0070700_100719435
533 Ga0070694_100235634
534 Ga0070694_100463304
535 Ga0070708_100617692
536 Ga0070663_100185384
537 Ga0070663_101090951
538 Ga0070678_100033222
539 Ga0070678_100105846
540 Ga0070678_101042569
541 Ga0070662_100110624
542 Ga0070662_100265396
543 Ga0070662_100522774
544 Ga0068867_100009567
545 Ga0068867_100071016
546 Ga0068867_100342576
547 Ga0070685_10005325
548 Ga0070707_100245311
549 Ga0070698_100097575
550 Ga0070698_100630492
551 Ga0070698_101231538
552 Ga0070698_101735097
553 Ga0070699_100027470
554 Ga0070684_100381115
555 Ga0070672_100003238
556 Ga0070672_100048699
557 Ga0070686_100098154
558 Ga0070686_100856032
559 Ga0070695_100538954
560 Ga0070695_100618591
561 Ga0070665_100039681
562 Ga0070665_101284577
563 Ga0070704_100412505
564 Ga0070704_100579400
565 Ga0070664_100014724
566 Ga0070664_100223383
567 Ga0070664_101387738
568 Ga0068857_101239831
569 Ga0068852_100360004
570 Ga0068859_100021479
571 Ga0068859_100096747
572 Ga0068859_100283485
573 Ga0068859_100852948
574 Ga0068864_100233516
575 Ga0068864_100285902
576 Ga0068864_100652808
577 Ga0068864_101380691
578 Ga0068866_10300155
579 Ga0068866_10367651
580 Ga0068861_100001696
581 Ga0068861_101805734
582 Ga0068870_10000982
583 Ga0068870_10018374
584 Ga0068870_10107598
585 Ga0068863_100008373
586 Ga0068858_100004450
587 Ga0068860_100163929
588 Ga0068860_101197842
589 Ga0068860_102425655
590 Ga0068862_100013478
591 Ga0068862_100098776
592 Ga0081539_10000024
593 Ga0081539_10000096
594 Ga0081539_10005511
595 Ga0097621_100073282
596 Ga0068871_100819948
597 Ga0068871_100869340
598 Ga0075428_100001181
599 Ga0075428_100003208
600 Ga0075428_100009166
601 Ga0075428_100048883
602 Ga0075428_100336643
603 Ga0075428_100564700
604 Ga0075430_100001472
605 Ga0075430_100041309
606 Ga0075430_100047787
607 Ga0075430_100055708
608 Ga0075430_100058844
609 Ga0075430_100142689
610 Ga0075430_100859125
611 Ga0075430_101008568
612 Ga0075431_100000025
613 Ga0075431_100008858
614 Ga0075431_100016073
615 Ga0075431_100058608
616 Ga0075431_100116048
617 Ga0075431_100304275
618 Ga0075431_100735677
619 Ga0075431_101171274
620 Ga0075433_10000366
621 Ga0075433_10002310
622 Ga0075433_10030257
623 Ga0075434_100000296
624 Ga0075434_100005175
625 Ga0075434_100064660
626 Ga0075429_100005680
627 Ga0075429_100051933
628 Ga0075429_100124845
629 Ga0075429_100333482
630 Ga0075429_100817736
631 Ga0068865_100097243
632 Ga0068865_101640472
633 Ga0097620_100021478
634 Ga0097620_100096747
635 Ga0097620_100283472
636 Ga0097620_100853029
637 Ga0097620_100966405
638 Ga0075435_100147566
639 Ga0111539_10003361
640 Ga0111539_10004354
641 Ga0111539_10009038
642 Ga0111539_10009686
643 Ga0111539_10015788
644 Ga0111539_10024410
645 Ga0111539_10038906
646 Ga0111539_10082004
647 Ga0111539_10253309
648 Ga0111539_10890550
649 Ga0111539_12087381
650 Ga0114129_10025118
651 Ga0114129_10066953
652 Ga0114129_10078283
653 Ga0114129_10111712
654 Ga0114129_10149053
655 Ga0114129_10153704
656 Ga0105242_10547260
657 Ga0105237_10613104
658 Ga0105249_10003450
659 Ga0105249_10429254
660 Ga0105249_11354210
661 Ga0105249_11385393
662 Ga0105246_10017635
663 Ga0157371_10133427
664 Ga0157370_10345362
665 Ga0163162_10037307
666 Ga0163162_10150019
667 Ga0157375_10076252
668 Ga0157375_10084074
669 Ga0157375_10401377
670 Ga0163163_10139152
671 Ga0157380_10014931
672 Ga0157380_10026368
673 Ga0157380_10216870
674 Ga0157380_10521527
675 Ga0157380_10764610
676 Ga0157380_10908255
677 Ga0157377_10017764
678 Ga0157379_10003949
679 Ga0163161_10064642
680 Ga0207673_1009761
681 Ga0207697_10059591
682 Ga0207682_10000114
683 Ga0207682_10004533
684 Ga0207682_10070305
685 Ga0207642_10047075
686 Ga0207688_10000023
687 Ga0207688_10128281
688 Ga0207680_10389023
689 Ga0207647_10059414
690 Ga0207645_10001465
691 Ga0207645_10089782
692 Ga0207643_10000592
693 Ga0207643_10023064
694 Ga0207643_10119004
695 Ga0207660_10512385
696 Ga0207660_10584269
697 Ga0207662_10003205
698 Ga0207662_10504910
699 Ga0207649_10017453
700 Ga0207649_10709984
701 Ga0207646_10497551
702 Ga0207681_10424593
703 Ga0207681_10564866
704 Ga0207681_11017265
705 Ga0207650_10022193
706 Ga0207659_10003303
707 Ga0207659_10037176
708 Ga0207659_10076139
709 Ga0207659_10136560
710 Ga0207659_10343007
711 Ga0207690_10351266
712 Ga0207690_10489293
713 Ga0207706_10001356
714 Ga0207706_10025547
715 Ga0207706_10285072
716 Ga0207670_10096559
717 Ga0207669_10000302
718 Ga0207669_10977313
719 Ga0207704_10074110
720 Ga0207704_10461268
721 Ga0207704_10508970
722 Ga0207691_10001105
723 Ga0207691_10006272
724 Ga0207691_10030540
725 Ga0207689_10000546
726 Ga0207689_10018669
727 Ga0207689_10074825
728 Ga0207689_10120920
729 Ga0207651_10039141
730 Ga0207651_10514561
731 Ga0207651_10630712
732 Ga0207651_10651666
733 Ga0207712_10073316
734 Ga0207712_11915002
735 Ga0207668_10095661
736 Ga0207658_10046408
737 Ga0207677_10823499
738 Ga0207677_11740968
739 Ga0207703_10140090
740 Ga0207678_10221172
741 Ga0207678_10305283
742 Ga0207708_10159155
743 Ga0207708_11019541
744 Ga0207648_10017355
745 Ga0207648_10101240
746 Ga0207648_10165550
747 Ga0207648_10500894
748 Ga0207676_10065942
749 Ga0207676_10136278
750 Ga0207674_10161414
751 Ga0207674_10211806
752 Ga0207674_10296013
753 Ga0207675_100008677
754 Ga0207675_100026542
755 Ga0207675_100130457
756 Ga0207683_10012629
757 Ga0207683_10065426
758 Ga0207683_10265405
759 Ga0207698_10372104
760 Ga0209981_1042299
761 Ga0209982_1053859
762 Ga0209970_1035231
763 Ga0209998_10149759
764 Ga0209974_10289882
765 Ga0207428_10000494
766 Ga0207428_10005684
767 Ga0207428_10006726
768 Ga0207428_10016594
769 Ga0207428_10019951
770 Ga0268266_10249091
771 Ga0268266_10991836
772 Ga0268265_10174933
773 Ga0268265_11082078
774 Ga0268265_11148769
775 Ga0268265_11635814
776 Ga0268264_10134811
777 Ga0268264_10198575
778 Ga0307408_100107665
779 Ga0307408_100266936
780 Ga0307408_100420850
781 Ga0307408_100684177
782 Ga0307408_100835615
783 Ga0307405_10046149
784 Ga0307405_10089216
785 Ga0307405_10206495
786 Ga0307405_10289160
787 Ga0307405_10582465
788 Ga0307405_10806830
789 Ga0307413_10044298
790 Ga0307413_10197187
791 Ga0307413_10564887
792 Ga0307410_10040939
793 Ga0307410_10063160
794 Ga0307410_10202822
795 Ga0307410_10378062
796 Ga0307406_10246449
797 Ga0307406_11789399
798 Ga0307407_10034039
799 Ga0307407_10075939
800 Ga0307407_10294244
801 Ga0307407_10432545
802 Ga0307412_10021653
803 Ga0307412_10034122
804 Ga0307412_10372766
805 Ga0307412_10399972
806 Ga0307412_10921224
807 Ga0307409_100050111
808 Ga0307409_100073318
809 Ga0307409_100084984
810 Ga0307409_100377332
811 Ga0307409_102051523
812 Ga0307416_100007738
813 Ga0307416_100024050
814 Ga0307416_100819888
815 Ga0307416_100952657
816 Ga0307416_101056725
817 Ga0307416_101486226
818 Ga0307416_101652941
819 Ga0307414_10024483
820 Ga0307414_10046460
821 Ga0307414_10061170
822 Ga0307414_10155653
823 Ga0307411_10071711
824 Ga0307411_10094204
825 Ga0307411_10262659
826 Ga0307411_10523025
827 Ga0307411_10853590
828 Ga0307415_100001807
829 Ga0307415_100119084
830 Ga0307415_101615600
831 Ga0373960_0228728
832 Ga0439453_0038978
833 Ga0450923_017470
834 Ga0439446_0158507
835 Ga0450908_016882
836 Ga0439435_0029720
837 Ga0450916_031128
838 Ga0453683_0064379
839 Ga0451576_0162026
840 Ga0451576_0327454
841 Ga0451576_0613010
842 Ga0495598_0074315
843 Ga0495598_0139541
844 Ga0495633_0162678
845 Ga0495656_0128847
846 Ga0495670_0348315
847 Ga0495636_0137906
848 Ga0496109_0119720
849 Ga0496110_0810079
850 Ga0496110_0922614
851 Ga0501291_116336
852 Ga0501031_0109558
853 Ga0501031_0239718
854 Ga0501032_0615946
855 Ga0501033_0108966
856 Ga0501033_0175479
857 Ga0501036_0061489
858 Ga0501039_0037141
859 Ga0501039_0188405
860 Ga0501040_0019251
861 Ga0501040_0059534
862 Ga0501041_0019574
863 Ga0501041_0033428
864 Ga0501041_0809494
865 Ga0501042_0002722
866 Ga0501042_0003000
867 Ga0501042_0090367
868 Ga0501043_0197330
869 Ga0501046_0039955
870 Ga0501046_0111099
871 Ga0501048_0060791
872 Ga0501048_0084011
873 Ga0501068_0060676
874 Ga0501071_0042467
875 Ga0501071_0192552
876 Ga0501071_0318335
877 Ga0501071_0575320
878 Ga0501072_0271741
879 Ga0501072_0420537
880 Ga0501073_0125148
881 Ga0501075_0015862
882 Ga0501075_0056361
883 Ga0501075_0407866
884 Ga0501075_1255530
885 Ga0501076_0024896
886 Ga0501076_0029812
887 Ga0501077_0023663
888 Ga0501077_0661179
889 Ga0501225_0121334
890 Ga0501079_0019380
891 Ga0501079_0029726
892 Ga0501079_0291116
893 Ga0501079_0522512
894 Ga0501080_0102081
895 Ga0501080_0361772
896 Ga0501080_0606213
897 Ga0501081_0028418
898 Ga0501081_0033985
899 Ga0501083_0082114
900 Ga0501283_008922
901 Ga0501035_0778740
902 Ga0501045_0063547
903 Ga0501045_0096179
904 Ga0501045_0426934
905 nmdc:mga05p37_111938_c1
906 nmdc:mga05p37_147727_c1
907 nmdc:mga05p37_3607_c1
908 nmdc:mga05p37_63429_c1
909 nmdc:mga05p37_94919_c1
910 nmdc:mga05p37_989193_c1
911 nmdc:mga09592_19584_c1
912 nmdc:mga09592_25220_c1
913 nmdc:mga09592_87206_c1
914 nmdc:mga0qj67_10392_c1
915 nmdc:mga0qj67_133703_c1
916 nmdc:mga0qj67_14982_c1
917 nmdc:mga0qj67_288666_c1
918 nmdc:mga0qj67_39106_c1
919 nmdc:mga0qj67_63403_c1
920 nmdc:mga0qj67_82829_c1
921 nmdc:mga06r32_175401_c1
922 nmdc:mga06r32_23748_c1
923 nmdc:mga06r32_403847_c1
924 nmdc:mga06r32_68318_c1
925 nmdc:mga06r32_79464_c1
926 nmdc:mga06r32_84836_c1
927 nmdc:mga08y16_15347_c1
928 nmdc:mga08y16_196142_c1
929 nmdc:mga08y16_2212_c1
930 nmdc:mga08y16_30759_c1
931 nmdc:mga08y16_47346_c1
932 nmdc:mga08y16_5476_c1
933 nmdc:mga08y16_565952_c1
934 nmdc:mga08y16_8750_c1
935 nmdc:mga0n895_10804_c1
936 nmdc:mga0n895_3573_c1
937 nmdc:mga0n895_4404_c1
938 nmdc:mga0rr50_15466_c1
939 nmdc:mga0rr50_236165_c1
940 nmdc:mga0a205_1038_c1
941 nmdc:mga0a205_11312_c1
942 nmdc:mga0a205_7487_c1
943 Ga0501084_0013406
944 Ga0501084_0180196
945 Ga0590071_000541
946 Ga0590071_009233
947 Ga0590074_003131
948 Ga0590074_038068
949 Ga0590075_000240
950 Ga0590075_036291
951 Ga0590077_000250
952 Ga0590077_000964
953 Ga0590077_012644
954 Ga0501082_0013728
955 Ga0501082_0039106
956 Ga0501082_0505094
957 Ga0530510_0005346
958 Ga0530510_0163522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18480

DUF5615

Domain of unknown function (DUF5615)

19

119

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dkd-assembly1.cif.gz_A crystal structure of n-acetylglucosamine-phosphate mutase, a member of the alpha-d-phosphohexomutase superfamily, in the product complex 0.7987 16 45
5o9x-assembly1.cif.gz_A crystal structure of aspergillus fumigatus n-acetylphosphoglucosamine mutate s69a in complex with glucose1,6bisphosphate 0.647 3 45
6em4-assembly1.cif.gz_n state b architectural model (nsa1-tap flag-ytm1) - visualizing the assembly pathway of nucleolar pre-60s ribosomes 0.6002 14 45
5oaw-assembly1.cif.gz_A crystal structure of aspergillus fumigatus n-acetylphosphoglucosamine mutase in complex with glcnac-6p and magnesium 0.5938 7 45
2iyn-assembly4.cif.gz_B the co-factor-induced pre-active conformation in phob 0.5886 19 117
ID Description Score Start End Superfamily
af_O95394_296_374_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.6241 4 45 3.40.120.10
1gc2B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.5776 19 75 3.40.640.10
af_O74539_2205_2336_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.5665 18 116 3.40.50.2300
af_Q9P7Q7_1503_1639_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.5618 16 120 3.40.50.2300
3h1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.5566 19 111 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V8HT40-F1-model_v4 DUF5615 domain-containing protein 0.8091 17 138
AF-A0A7W0R7R1-F1-model_v4 DUF5615 family PIN-like protein 0.8015 18 133
AF-A0A1F7IFW3-F1-model_v4 DUF5615 domain-containing protein 0.7884 19 116
AF-A0A1F2TZV0-F1-model_v4 DUF5615 domain-containing protein 0.778 14 141
AF-A0A6P0RU65-F1-model_v4 DUF5615 domain-containing protein 0.7643 20 99

Map