F451992
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 479 | 253 | 479 | 304 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10022746|Ga0070658_100227463 |
| Length | 325 |
| Sequence | VSQADDAPALRALVRELALALRERVKPLLGSHAARAHEEALAVGGDVTFAIDAAAEELLASFLAERAPGVAFFSEDKGLVLPSGDADTVLVVDPIDGTRPALAGFESCCVSVAAAPLRDDVTMGEVSVGCVVEIPAGTVFLAERGHGLVEGPPIRLSRNEQIDRMFWVYGFRGRPVRLYMELLGDLIEASSVGGGSFELGSATFDMTRILTGQLDAYIEPGPRLIEELPETRSEFERVGGGAVLNNTPYDIAAAALCLEEGGATVTDAAGRPLADRPLLGSGPEHQMSVLASANACLHARLLEELDAGMERLAFSLPGAQETESR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 93 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 142 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 143 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 144 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 145 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 151 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 154 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 159 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 160 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 161 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 162 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 168 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 169 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 170 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 171 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 172 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 173 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 174 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 175 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 176 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 177 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 178 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 220 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 238 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 239 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 240 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 241 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 253 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.55 |
| Nodule | 0 |
| Rhizoplane | 8.14 |
| Rhizosphere | 85.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000763 | 3300000549 | Bacteria | 5103 |
| 2 | JGI25407J50210_10014949 | 3300003373 | Bacteria | 2004 |
| 3 | Ga0070658_10022746 | 3300005327 | Bacteria | 5031 |
| 4 | Ga0070683_100003147 | 3300005329 | Bacteria | 13297 |
| 5 | Ga0070683_100007131 | 3300005329 | Bacteria | 9420 |
| 6 | Ga0070683_100023952 | 3300005329 | Bacteria | 5464 |
| 7 | Ga0070680_100000746 | 3300005336 | Bacteria | 22718 |
| 8 | Ga0070682_100005793 | 3300005337 | Bacteria | 6898 |
| 9 | Ga0070682_100018093 | 3300005337 | Bacteria | 4114 |
| 10 | Ga0070682_100036480 | 3300005337 | Bacteria | 3006 |
| 11 | Ga0068868_100017477 | 3300005338 | Bacteria | 5346 |
| 12 | Ga0070660_100003054 | 3300005339 | Bacteria | 11522 |
| 13 | Ga0070660_100029345 | 3300005339 | Bacteria | 4122 |
| 14 | Ga0070689_100047314 | 3300005340 | Bacteria | 3317 |
| 15 | Ga0070691_10094760 | 3300005341 | Bacteria | 1476 |
| 16 | Ga0070687_100175449 | 3300005343 | Bacteria | 1279 |
| 17 | Ga0070661_100002426 | 3300005344 | Bacteria | 12801 |
| 18 | Ga0070692_10010178 | 3300005345 | Bacteria | 4271 |
| 19 | Ga0070668_100076596 | 3300005347 | Bacteria | 2613 |
| 20 | Ga0070669_100036162 | 3300005353 | Bacteria | 3577 |
| 21 | Ga0070675_100007308 | 3300005354 | Bacteria | 8524 |
| 22 | Ga0070674_100007998 | 3300005356 | Bacteria | 6266 |
| 23 | Ga0070674_100117809 | 3300005356 | Bacteria | 1961 |
| 24 | Ga0070673_100082743 | 3300005364 | Bacteria | 2606 |
| 25 | Ga0070659_100001090 | 3300005366 | Bacteria | 19781 |
| 26 | Ga0070659_100002893 | 3300005366 | Bacteria | 12221 |
| 27 | Ga0070709_10055483 | 3300005434 | Bacteria | 2502 |
| 28 | Ga0070714_100128800 | 3300005435 | Bacteria | 2260 |
| 29 | Ga0070714_100229396 | 3300005435 | Bacteria | 1710 |
| 30 | Ga0070714_100451365 | 3300005435 | Unclassified | 1221 |
| 31 | Ga0070710_10021825 | 3300005437 | Bacteria | 3341 |
| 32 | Ga0070711_100189224 | 3300005439 | Bacteria | 1581 |
| 33 | Ga0070700_100023899 | 3300005441 | Bacteria | 3581 |
| 34 | Ga0070694_100140040 | 3300005444 | Bacteria | 1756 |
| 35 | Ga0070694_100366487 | 3300005444 | Bacteria | 1120 |
| 36 | Ga0070663_100004596 | 3300005455 | Bacteria | 8130 |
| 37 | Ga0070663_100045019 | 3300005455 | Bacteria | 3116 |
| 38 | Ga0070678_100019173 | 3300005456 | Bacteria | 4453 |
| 39 | Ga0070678_100050724 | 3300005456 | Bacteria | 3004 |
| 40 | Ga0070662_100023799 | 3300005457 | Bacteria | 4212 |
| 41 | Ga0070662_100045263 | 3300005457 | Bacteria | 3156 |
| 42 | Ga0070681_10006683 | 3300005458 | Bacteria | 11222 |
| 43 | Ga0068867_100053837 | 3300005459 | Bacteria | 2972 |
| 44 | Ga0070685_10007278 | 3300005466 | Bacteria | 5660 |
| 45 | Ga0070685_10110662 | 3300005466 | Bacteria | 1691 |
| 46 | Ga0070679_100137325 | 3300005530 | Bacteria | 2426 |
| 47 | Ga0070684_100002911 | 3300005535 | Bacteria | 12720 |
| 48 | Ga0070684_100074784 | 3300005535 | Bacteria | 2986 |
| 49 | Ga0068853_100027027 | 3300005539 | Bacteria | 4822 |
| 50 | Ga0070672_100031367 | 3300005543 | Bacteria | 3999 |
| 51 | Ga0070686_100003109 | 3300005544 | Bacteria | 9102 |
| 52 | Ga0070686_100015940 | 3300005544 | Bacteria | 4364 |
| 53 | Ga0070695_100244222 | 3300005545 | Bacteria | 1304 |
| 54 | Ga0070696_100154857 | 3300005546 | Bacteria | 1685 |
| 55 | Ga0070693_100267408 | 3300005547 | Bacteria | 1140 |
| 56 | Ga0070665_100040848 | 3300005548 | Bacteria | 4662 |
| 57 | Ga0070665_100046252 | 3300005548 | Bacteria | 4372 |
| 58 | Ga0070704_100422515 | 3300005549 | Unclassified | 1142 |
| 59 | Ga0068855_100325820 | 3300005563 | Bacteria | 1697 |
| 60 | Ga0070664_100046551 | 3300005564 | Bacteria | 3663 |
| 61 | Ga0068857_100046736 | 3300005577 | Bacteria | 3842 |
| 62 | Ga0068857_100349386 | 3300005577 | Bacteria | 1369 |
| 63 | Ga0068854_100011272 | 3300005578 | Bacteria | 5813 |
| 64 | Ga0068856_100011634 | 3300005614 | Bacteria | 8534 |
| 65 | Ga0068856_100022543 | 3300005614 | Bacteria | 6123 |
| 66 | Ga0070702_100060790 | 3300005615 | Bacteria | 2198 |
| 67 | Ga0068852_100007252 | 3300005616 | Bacteria | 8086 |
| 68 | Ga0068852_100021655 | 3300005616 | Bacteria | 5139 |
| 69 | Ga0068864_100021815 | 3300005618 | Bacteria | 5366 |
| 70 | Ga0068866_10098978 | 3300005718 | Bacteria | 1605 |
| 71 | Ga0068866_10129249 | 3300005718 | Bacteria | 1434 |
| 72 | Ga0068861_100082651 | 3300005719 | Bacteria | 2517 |
| 73 | Ga0068851_10016271 | 3300005834 | Bacteria | 3557 |
| 74 | Ga0068858_100113316 | 3300005842 | Bacteria | 2533 |
| 75 | Ga0068862_100140895 | 3300005844 | Bacteria | 2140 |
| 76 | Ga0068862_100159159 | 3300005844 | Bacteria | 2015 |
| 77 | Ga0068862_100625153 | 3300005844 | Bacteria | 1036 |
| 78 | Ga0081455_10019231 | 3300005937 | Bacteria | 6470 |
| 79 | Ga0081455_10021221 | 3300005937 | Bacteria | 6097 |
| 80 | Ga0081455_10030297 | 3300005937 | Bacteria | 4917 |
| 81 | Ga0081538_10000032 | 3300005981 | Bacteria | 122398 |
| 82 | Ga0081538_10000328 | 3300005981 | Bacteria | 54328 |
| 83 | Ga0081538_10014065 | 3300005981 | Bacteria | 6289 |
| 84 | Ga0081540_1003253 | 3300005983 | Bacteria | 12913 |
| 85 | Ga0081539_10024221 | 3300005985 | Bacteria | 3946 |
| 86 | Ga0081539_10039540 | 3300005985 | Bacteria | 2781 |
| 87 | Ga0081539_10063210 | 3300005985 | Bacteria | 2021 |
| 88 | Ga0070717_10413641 | 3300006028 | Unclassified | 1212 |
| 89 | Ga0075365_10000195 | 3300006038 | Bacteria | 20046 |
| 90 | Ga0075365_10000715 | 3300006038 | Bacteria | 13408 |
| 91 | Ga0075365_10102365 | 3300006038 | Bacteria | 1962 |
| 92 | Ga0075365_10144947 | 3300006038 | Bacteria | 1650 |
| 93 | Ga0075363_100030262 | 3300006048 | Bacteria | 2801 |
| 94 | Ga0075363_100031896 | 3300006048 | Bacteria | 2734 |
| 95 | Ga0075364_10038632 | 3300006051 | Bacteria | 3092 |
| 96 | Ga0075432_10012798 | 3300006058 | Bacteria | 2851 |
| 97 | Ga0070715_10022938 | 3300006163 | Bacteria | 2439 |
| 98 | Ga0070712_100000965 | 3300006175 | Bacteria | 17314 |
| 99 | Ga0070712_100183582 | 3300006175 | Bacteria | 1632 |
| 100 | Ga0075367_10038159 | 3300006178 | Bacteria | 2795 |
| 101 | Ga0075430_100022950 | 3300006846 | Bacteria | 5307 |
| 102 | Ga0075430_100184258 | 3300006846 | Bacteria | 1736 |
| 103 | Ga0075431_100000134 | 3300006847 | Bacteria | 49630 |
| 104 | Ga0075431_100029164 | 3300006847 | Bacteria | 5676 |
| 105 | Ga0075431_100473894 | 3300006847 | Bacteria | 1245 |
| 106 | Ga0075431_100551338 | 3300006847 | Bacteria | 1140 |
| 107 | Ga0075433_10014385 | 3300006852 | Bacteria | 6462 |
| 108 | Ga0075433_10016522 | 3300006852 | Bacteria | 6086 |
| 109 | Ga0075433_10268044 | 3300006852 | Bacteria | 1514 |
| 110 | Ga0075433_10503494 | 3300006852 | Bacteria | 1066 |
| 111 | Ga0075434_100020844 | 3300006871 | Bacteria | 6364 |
| 112 | Ga0075434_100029805 | 3300006871 | Bacteria | 5371 |
| 113 | Ga0075434_100131565 | 3300006871 | Bacteria | 2521 |
| 114 | Ga0075429_100047513 | 3300006880 | Bacteria | 3734 |
| 115 | Ga0068865_100071520 | 3300006881 | Bacteria | 2461 |
| 116 | Ga0068865_100158116 | 3300006881 | Bacteria | 1726 |
| 117 | Ga0075436_100241070 | 3300006914 | Unclassified | 1286 |
| 118 | Ga0075435_100079288 | 3300007076 | Bacteria | 2694 |
| 119 | Ga0105240_10007232 | 3300009093 | Bacteria | 16160 |
| 120 | Ga0111539_10006052 | 3300009094 | Bacteria | 15618 |
| 121 | Ga0111539_10018405 | 3300009094 | Bacteria | 8653 |
| 122 | Ga0111539_10022248 | 3300009094 | Bacteria | 7792 |
| 123 | Ga0111539_10121198 | 3300009094 | Bacteria | 3065 |
| 124 | Ga0111539_10180512 | 3300009094 | Bacteria | 2465 |
| 125 | Ga0111539_10318926 | 3300009094 | Unclassified | 1809 |
| 126 | Ga0105245_10000568 | 3300009098 | Bacteria | 33618 |
| 127 | Ga0105245_10004565 | 3300009098 | Bacteria | 12223 |
| 128 | Ga0105245_10023300 | 3300009098 | Bacteria | 5433 |
| 129 | Ga0105245_10083666 | 3300009098 | Bacteria | 2921 |
| 130 | Ga0105245_10389318 | 3300009098 | Unclassified | 1390 |
| 131 | Ga0105245_10443690 | 3300009098 | Unclassified | 1305 |
| 132 | Ga0114129_10008915 | 3300009147 | Bacteria | 14302 |
| 133 | Ga0114129_10016660 | 3300009147 | Bacteria | 10466 |
| 134 | Ga0114129_10028828 | 3300009147 | Bacteria | 7865 |
| 135 | Ga0114129_10090132 | 3300009147 | Bacteria | 4251 |
| 136 | Ga0114129_10219282 | 3300009147 | Bacteria | 2567 |
| 137 | Ga0114129_10224782 | 3300009147 | Bacteria | 2531 |
| 138 | Ga0114129_10235616 | 3300009147 | Bacteria | 2463 |
| 139 | Ga0114129_10403204 | 3300009147 | Bacteria | 1802 |
| 140 | Ga0114129_10548223 | 3300009147 | Bacteria | 1504 |
| 141 | Ga0114129_10559828 | 3300009147 | Bacteria | 1486 |
| 142 | Ga0105243_10030151 | 3300009148 | Bacteria | 4174 |
| 143 | Ga0105243_10048548 | 3300009148 | Bacteria | 3346 |
| 144 | Ga0105243_10058925 | 3300009148 | Bacteria | 3062 |
| 145 | Ga0105248_10182749 | 3300009177 | Bacteria | 2363 |
| 146 | Ga0105238_10510390 | 3300009551 | Bacteria | 1204 |
| 147 | Ga0105249_10114451 | 3300009553 | Bacteria | 2554 |
| 148 | Ga0105239_10011169 | 3300010375 | Bacteria | 10020 |
| 149 | Ga0105239_10035393 | 3300010375 | Bacteria | 5484 |
| 150 | Ga0105246_10080375 | 3300011119 | Bacteria | 2321 |
| 151 | Ga0105246_10085183 | 3300011119 | Bacteria | 2263 |
| 152 | Ga0157369_10006254 | 3300013105 | Bacteria | 13819 |
| 153 | Ga0157372_10055368 | 3300013307 | Bacteria | 4429 |
| 154 | Ga0157372_10282866 | 3300013307 | Bacteria | 1929 |
| 155 | Ga0157380_10029133 | 3300014326 | Bacteria | 4218 |
| 156 | Ga0157377_10002386 | 3300014745 | Bacteria | 8285 |
| 157 | Ga0157379_10111633 | 3300014968 | Bacteria | 2456 |
| 158 | Ga0206356_11699020 | 3300020070 | Bacteria | 2814 |
| 159 | Ga0206353_10005236 | 3300020082 | Bacteria | 4971 |
| 160 | Ga0213873_10019725 | 3300021358 | Bacteria | 1567 |
| 161 | Ga0213874_10000028 | 3300021377 | Bacteria | 18779 |
| 162 | Ga0213876_10046527 | 3300021384 | Bacteria | 2294 |
| 163 | Ga0213876_10123472 | 3300021384 | Bacteria | 1375 |
| 164 | Ga0213875_10010469 | 3300021388 | Bacteria | 4638 |
| 165 | Ga0213875_10014052 | 3300021388 | Bacteria | 3915 |
| 166 | Ga0207656_10039377 | 3300025321 | Bacteria | 1999 |
| 167 | Ga0207688_10000324 | 3300025901 | Bacteria | 22108 |
| 168 | Ga0207685_10016091 | 3300025905 | Bacteria | 2385 |
| 169 | Ga0207699_10009612 | 3300025906 | Bacteria | 4823 |
| 170 | Ga0207707_10006326 | 3300025912 | Bacteria | 10343 |
| 171 | Ga0207695_10108674 | 3300025913 | Bacteria | 2757 |
| 172 | Ga0207671_10053017 | 3300025914 | Bacteria | 3006 |
| 173 | Ga0207693_10002542 | 3300025915 | Bacteria | 15862 |
| 174 | Ga0207693_10033390 | 3300025915 | Bacteria | 4061 |
| 175 | Ga0207663_10015832 | 3300025916 | Bacteria | 4170 |
| 176 | Ga0207660_10056411 | 3300025917 | Bacteria | 2810 |
| 177 | Ga0207660_10092712 | 3300025917 | Bacteria | 2242 |
| 178 | Ga0207657_10007520 | 3300025919 | Bacteria | 11165 |
| 179 | Ga0207657_10017263 | 3300025919 | Bacteria | 6928 |
| 180 | Ga0207649_10031425 | 3300025920 | Bacteria | 3155 |
| 181 | Ga0207659_10037620 | 3300025926 | Bacteria | 3361 |
| 182 | Ga0207687_10012462 | 3300025927 | Bacteria | 5554 |
| 183 | Ga0207687_10026290 | 3300025927 | Bacteria | 3896 |
| 184 | Ga0207687_10262095 | 3300025927 | Unclassified | 1378 |
| 185 | Ga0207664_10018369 | 3300025929 | Bacteria | 5146 |
| 186 | Ga0207664_10044217 | 3300025929 | Bacteria | 3487 |
| 187 | Ga0207664_10227280 | 3300025929 | Bacteria | 1621 |
| 188 | Ga0207690_10023007 | 3300025932 | Bacteria | 3884 |
| 189 | Ga0207706_10004968 | 3300025933 | Bacteria | 12429 |
| 190 | Ga0207706_10020079 | 3300025933 | Bacteria | 6003 |
| 191 | Ga0207686_10265934 | 3300025934 | Bacteria | 1259 |
| 192 | Ga0207709_10019569 | 3300025935 | Bacteria | 3810 |
| 193 | Ga0207709_10032663 | 3300025935 | Bacteria | 3049 |
| 194 | Ga0207670_10292307 | 3300025936 | Bacteria | 1273 |
| 195 | Ga0207669_10036597 | 3300025937 | Bacteria | 2807 |
| 196 | Ga0207669_10046796 | 3300025937 | Bacteria | 2559 |
| 197 | Ga0207669_10152628 | 3300025937 | Bacteria | 1620 |
| 198 | Ga0207704_10013520 | 3300025938 | Bacteria | 4087 |
| 199 | Ga0207704_10054295 | 3300025938 | Bacteria | 2442 |
| 200 | Ga0207704_10083400 | 3300025938 | Bacteria | 2074 |
| 201 | Ga0207665_10045124 | 3300025939 | Bacteria | 2951 |
| 202 | Ga0207665_10333509 | 3300025939 | Bacteria | 1141 |
| 203 | Ga0207691_10005161 | 3300025940 | Bacteria | 12610 |
| 204 | Ga0207689_10418040 | 3300025942 | Bacteria | 1118 |
| 205 | Ga0207661_10000599 | 3300025944 | Bacteria | 22999 |
| 206 | Ga0207661_10018558 | 3300025944 | Bacteria | 5169 |
| 207 | Ga0207661_10090583 | 3300025944 | Bacteria | 2546 |
| 208 | Ga0207661_10240681 | 3300025944 | Bacteria | 1606 |
| 209 | Ga0207667_10490407 | 3300025949 | Bacteria | 1247 |
| 210 | Ga0207712_10045539 | 3300025961 | Bacteria | 3038 |
| 211 | Ga0207668_10015795 | 3300025972 | Bacteria | 4699 |
| 212 | Ga0207668_10069372 | 3300025972 | Bacteria | 2510 |
| 213 | Ga0207668_10183935 | 3300025972 | Unclassified | 1651 |
| 214 | Ga0207668_10185390 | 3300025972 | Bacteria | 1645 |
| 215 | Ga0207640_10119692 | 3300025981 | Bacteria | 1883 |
| 216 | Ga0207640_10382703 | 3300025981 | Bacteria | 1140 |
| 217 | Ga0207677_10040769 | 3300026023 | Bacteria | 3064 |
| 218 | Ga0207639_10108784 | 3300026041 | Bacteria | 2254 |
| 219 | Ga0207678_10281740 | 3300026067 | Bacteria | 1427 |
| 220 | Ga0207708_10001190 | 3300026075 | Bacteria | 19592 |
| 221 | Ga0207708_10008095 | 3300026075 | Bacteria | 7790 |
| 222 | Ga0207708_10091077 | 3300026075 | Bacteria | 2351 |
| 223 | Ga0207708_10226348 | 3300026075 | Bacteria | 1500 |
| 224 | Ga0207702_10011747 | 3300026078 | Bacteria | 7294 |
| 225 | Ga0207702_10232242 | 3300026078 | Bacteria | 1724 |
| 226 | Ga0207648_10019050 | 3300026089 | Bacteria | 6196 |
| 227 | Ga0207648_10175360 | 3300026089 | Bacteria | 1896 |
| 228 | Ga0207676_10056867 | 3300026095 | Bacteria | 3078 |
| 229 | Ga0207674_10019972 | 3300026116 | Bacteria | 7250 |
| 230 | Ga0207675_100011049 | 3300026118 | Bacteria | 8457 |
| 231 | Ga0207683_10065771 | 3300026121 | Bacteria | 3196 |
| 232 | Ga0207683_10076626 | 3300026121 | Bacteria | 2961 |
| 233 | Ga0207698_10006744 | 3300026142 | Bacteria | 7174 |
| 234 | Ga0209813_10054201 | 3300027866 | Bacteria | 1263 |
| 235 | Ga0207428_10025079 | 3300027907 | Bacteria | 4994 |
| 236 | Ga0207428_10037179 | 3300027907 | Bacteria | 3963 |
| 237 | Ga0268266_10008906 | 3300028379 | Bacteria | 8883 |
| 238 | Ga0268265_10042771 | 3300028380 | Bacteria | 3364 |
| 239 | Ga0268265_10129032 | 3300028380 | Bacteria | 2098 |
| 240 | Ga0307408_100028879 | 3300031548 | Bacteria | 3837 |
| 241 | Ga0307413_10010947 | 3300031824 | Bacteria | 4431 |
| 242 | Ga0307410_10028588 | 3300031852 | Bacteria | 3539 |
| 243 | Ga0307410_10032424 | 3300031852 | Bacteria | 3362 |
| 244 | Ga0307410_10133270 | 3300031852 | Bacteria | 1828 |
| 245 | Ga0307406_10074725 | 3300031901 | Bacteria | 2233 |
| 246 | Ga0307407_10011376 | 3300031903 | Bacteria | 4234 |
| 247 | Ga0307409_100001709 | 3300031995 | Bacteria | 11063 |
| 248 | Ga0307409_100037506 | 3300031995 | Bacteria | 3574 |
| 249 | Ga0307409_100089011 | 3300031995 | Bacteria | 2522 |
| 250 | Ga0307409_100173147 | 3300031995 | Bacteria | 1902 |
| 251 | Ga0307409_100186175 | 3300031995 | Bacteria | 1843 |
| 252 | Ga0307409_100194127 | 3300031995 | Bacteria | 1810 |
| 253 | Ga0307416_100001189 | 3300032002 | Bacteria | 13989 |
| 254 | Ga0307416_100030131 | 3300032002 | Bacteria | 4067 |
| 255 | Ga0307416_100049733 | 3300032002 | Bacteria | 3336 |
| 256 | Ga0307416_100051892 | 3300032002 | Bacteria | 3280 |
| 257 | Ga0307416_100108008 | 3300032002 | Bacteria | 2444 |
| 258 | Ga0307416_100205720 | 3300032002 | Bacteria | 1872 |
| 259 | Ga0307416_100214911 | 3300032002 | Bacteria | 1838 |
| 260 | Ga0307416_100719971 | 3300032002 | Bacteria | 1088 |
| 261 | Ga0307414_10472814 | 3300032004 | Unclassified | 1104 |
| 262 | Ga0307411_10044303 | 3300032005 | Bacteria | 2853 |
| 263 | Ga0307415_100000762 | 3300032126 | Bacteria | 14540 |
| 264 | Ga0373944_0062896 | 3300035089 | Unclassified | 1194 |
| 265 | Ga0373941_0070209 | 3300035115 | Bacteria | 1161 |
| 266 | Ga0373953_0006334 | 3300035117 | Bacteria | 3896 |
| 267 | Ga0373943_0115042 | 3300035170 | Unclassified | 1423 |
| 268 | Ga0373935_0240557 | 3300035692 | Bacteria | 1264 |
| 269 | Ga0373933_0032116 | 3300035724 | Bacteria | 3050 |
| 270 | Ga0373937_0203235 | 3300036401 | Bacteria | 1862 |
| 271 | Ga0316582_0068980 | 3300036647 | Bacteria | 2285 |
| 272 | Ga0316584_0165169 | 3300036712 | Bacteria | 1644 |
| 273 | Ga0395899_0224525 | 3300037312 | Bacteria | 1300 |
| 274 | Ga0395900_0003110 | 3300037418 | Bacteria | 18023 |
| 275 | Ga0395900_0017887 | 3300037418 | Bacteria | 7234 |
| 276 | Ga0395900_0137379 | 3300037418 | Bacteria | 2504 |
| 277 | Ga0395900_0161398 | 3300037418 | Bacteria | 2286 |
| 278 | Ga0395898_0000333 | 3300037466 | Bacteria | 106932 |
| 279 | Ga0395898_0006309 | 3300037466 | Bacteria | 12670 |
| 280 | Ga0395898_0008821 | 3300037466 | Bacteria | 10624 |
| 281 | Ga0395898_0067020 | 3300037466 | Bacteria | 3477 |
| 282 | Ga0395898_0092458 | 3300037466 | Bacteria | 2909 |
| 283 | Ga0395898_0098958 | 3300037466 | Bacteria | 2800 |
| 284 | Ga0395898_0217949 | 3300037466 | Bacteria | 1820 |
| 285 | Ga0395898_0254662 | 3300037466 | Bacteria | 1674 |
| 286 | Ga0395898_0499737 | 3300037466 | Bacteria | 1157 |
| 287 | Ga0395905_0012790 | 3300037471 | Bacteria | 8072 |
| 288 | Ga0395905_0013085 | 3300037471 | Bacteria | 7965 |
| 289 | Ga0436364_0026519 | 3300037853 | Bacteria | 11482 |
| 290 | Ga0436364_0296398 | 3300037853 | Bacteria | 4560 |
| 291 | Ga0395901_0001875 | 3300038443 | Bacteria | 21673 |
| 292 | Ga0395901_0014926 | 3300038443 | Bacteria | 7893 |
| 293 | Ga0395901_0025808 | 3300038443 | Bacteria | 6033 |
| 294 | Ga0395901_0044481 | 3300038443 | Bacteria | 4606 |
| 295 | Ga0395901_0177226 | 3300038443 | Bacteria | 2236 |
| 296 | Ga0395901_0208573 | 3300038443 | Bacteria | 2046 |
| 297 | Ga0395901_0215949 | 3300038443 | Bacteria | 2006 |
| 298 | Ga0395901_0445878 | 3300038443 | Bacteria | 1324 |
| 299 | Ga0436365_0001544 | 3300039437 | Bacteria | 2538 |
| 300 | Ga0436365_0202901 | 3300039437 | Bacteria | 32522 |
| 301 | Ga0436365_0835713 | 3300039437 | Bacteria | 4800 |
| 302 | Ga0436365_1054951 | 3300039437 | Bacteria | 1042 |
| 303 | Ga0436365_1170100 | 3300039437 | Bacteria | 5589 |
| 304 | Ga0436363_0174915 | 3300039450 | Bacteria | 34957 |
| 305 | Ga0436363_0879407 | 3300039450 | Bacteria | 2193 |
| 306 | Ga0436362_0127759 | 3300039453 | Bacteria | 1724 |
| 307 | Ga0436362_0629257 | 3300039453 | Bacteria | 3325 |
| 308 | Ga0436362_0893815 | 3300039453 | Bacteria | 1945 |
| 309 | Ga0451853_2971813 | 3300041512 | Bacteria | 1701 |
| 310 | Ga0466969_0015689 | 3300044656 | Bacteria | 3969 |
| 311 | Ga0466969_0045911 | 3300044656 | Bacteria | 2167 |
| 312 | Ga0466969_0109304 | 3300044656 | Bacteria | 1296 |
| 313 | Ga0466966_0029296 | 3300044684 | Bacteria | 3583 |
| 314 | Ga0466966_0032474 | 3300044684 | Bacteria | 3383 |
| 315 | Ga0466966_0096191 | 3300044684 | Bacteria | 1834 |
| 316 | Ga0466961_0010987 | 3300044693 | Bacteria | 5784 |
| 317 | Ga0466961_0057378 | 3300044693 | Bacteria | 2479 |
| 318 | Ga0466961_0112703 | 3300044693 | Bacteria | 1710 |
| 319 | Ga0466961_0207553 | 3300044693 | Unclassified | 1210 |
| 320 | Ga0466963_0002027 | 3300044694 | Bacteria | 11135 |
| 321 | Ga0466963_0018303 | 3300044694 | Bacteria | 4377 |
| 322 | Ga0466963_0065451 | 3300044694 | Bacteria | 2437 |
| 323 | Ga0466963_0065899 | 3300044694 | Bacteria | 2429 |
| 324 | Ga0466963_0085800 | 3300044694 | Bacteria | 2138 |
| 325 | Ga0466963_0159774 | 3300044694 | Bacteria | 1568 |
| 326 | Ga0466971_0003879 | 3300044719 | Bacteria | 6410 |
| 327 | Ga0466971_0053992 | 3300044719 | Bacteria | 1811 |
| 328 | Ga0466968_0003224 | 3300044735 | Bacteria | 6018 |
| 329 | Ga0466968_0084239 | 3300044735 | Bacteria | 1401 |
| 330 | Ga0466957_0060023 | 3300044842 | Bacteria | 2332 |
| 331 | Ga0466957_0109844 | 3300044842 | Bacteria | 1748 |
| 332 | Ga0466959_0007413 | 3300045049 | Bacteria | 7697 |
| 333 | Ga0466959_0035092 | 3300045049 | Bacteria | 3711 |
| 334 | Ga0466959_0035185 | 3300045049 | Bacteria | 3706 |
| 335 | Ga0466959_0114311 | 3300045049 | Bacteria | 1923 |
| 336 | Ga0466959_0321148 | 3300045049 | Bacteria | 1058 |
| 337 | Ga0466958_0017843 | 3300045836 | Bacteria | 4111 |
| 338 | Ga0466958_0019762 | 3300045836 | Bacteria | 3922 |
| 339 | Ga0466958_0024387 | 3300045836 | Bacteria | 3559 |
| 340 | Ga0466958_0064993 | 3300045836 | Bacteria | 2226 |
| 341 | Ga0466958_0072687 | 3300045836 | Bacteria | 2106 |
| 342 | Ga0466958_0169102 | 3300045836 | Bacteria | 1384 |
| 343 | Ga0466967_0082269 | 3300045976 | Bacteria | 2909 |
| 344 | Ga0466967_0132062 | 3300045976 | Bacteria | 2319 |
| 345 | Ga0466967_0135502 | 3300045976 | Bacteria | 2290 |
| 346 | Ga0466967_0162016 | 3300045976 | Bacteria | 2100 |
| 347 | Ga0495592_0040180 | 3300046454 | Bacteria | 3511 |
| 348 | Ga0495641_0015311 | 3300046461 | Bacteria | 4102 |
| 349 | Ga0495651_0190689 | 3300046462 | Bacteria | 1443 |
| 350 | Ga0495653_0033954 | 3300046463 | Bacteria | 4038 |
| 351 | Ga0495605_0074479 | 3300046474 | Unclassified | 1598 |
| 352 | Ga0495596_0086110 | 3300046500 | Bacteria | 1220 |
| 353 | Ga0495630_0107516 | 3300046517 | Bacteria | 2113 |
| 354 | Ga0495652_0042428 | 3300046529 | Bacteria | 3922 |
| 355 | Ga0495640_0091325 | 3300046533 | Bacteria | 2009 |
| 356 | Ga0495587_0065356 | 3300046536 | Bacteria | 2124 |
| 357 | Ga0495667_0017231 | 3300046559 | Bacteria | 4879 |
| 358 | Ga0495667_0062412 | 3300046559 | Bacteria | 2442 |
| 359 | Ga0495667_0376950 | 3300046559 | Bacteria | 895 |
| 360 | Ga0495656_0064585 | 3300046615 | Bacteria | 1608 |
| 361 | Ga0495634_0009790 | 3300046642 | Bacteria | 7054 |
| 362 | Ga0495635_0005114 | 3300046663 | Bacteria | 9123 |
| 363 | Ga0495657_0001401 | 3300046675 | Bacteria | 20878 |
| 364 | Ga0495623_0218456 | 3300046679 | Unclassified | 1087 |
| 365 | Ga0495647_0045199 | 3300046681 | Bacteria | 1691 |
| 366 | Ga0495658_0220604 | 3300046683 | Unclassified | 1187 |
| 367 | Ga0495589_0105489 | 3300046794 | Unclassified | 1362 |
| 368 | Ga0495600_0046112 | 3300046809 | Bacteria | 2844 |
| 369 | Ga0495581_0086101 | 3300047315 | Bacteria | 1822 |
| 370 | Ga0495604_0006700 | 3300047317 | Bacteria | 9131 |
| 371 | Ga0495674_0013820 | 3300047319 | Bacteria | 7578 |
| 372 | Ga0495676_0036082 | 3300047321 | Bacteria | 4131 |
| 373 | Ga0495680_0023484 | 3300047322 | Bacteria | 5126 |
| 374 | Ga0495684_0031992 | 3300047471 | Bacteria | 4038 |
| 375 | Ga0495602_0032804 | 3300048088 | Bacteria | 4884 |
| 376 | Ga0496101_0001347 | 3300048904 | Bacteria | 14717 |
| 377 | Ga0496101_0223819 | 3300048904 | Unclassified | 1461 |
| 378 | Ga0496103_0002108 | 3300048906 | Bacteria | 12676 |
| 379 | Ga0496104_0022477 | 3300048907 | Bacteria | 5794 |
| 380 | Ga0496104_0179840 | 3300048907 | Unclassified | 2025 |
| 381 | Ga0496105_0053235 | 3300048908 | Bacteria | 3342 |
| 382 | Ga0496105_0223099 | 3300048908 | Unclassified | 1534 |
| 383 | Ga0496105_0317033 | 3300048908 | Bacteria | 1250 |
| 384 | Ga0496106_0003436 | 3300048909 | Bacteria | 11798 |
| 385 | Ga0496106_0026793 | 3300048909 | Bacteria | 4293 |
| 386 | Ga0496106_0059586 | 3300048909 | Unclassified | 2892 |
| 387 | Ga0496106_0154342 | 3300048909 | Bacteria | 1812 |
| 388 | Ga0496107_0031582 | 3300048910 | Bacteria | 3781 |
| 389 | Ga0496108_0002794 | 3300048911 | Bacteria | 13992 |
| 390 | Ga0496108_0048673 | 3300048911 | Bacteria | 3544 |
| 391 | Ga0496108_0517030 | 3300048911 | Unclassified | 1042 |
| 392 | Ga0496109_0081661 | 3300048912 | Bacteria | 2979 |
| 393 | Ga0496109_0090369 | 3300048912 | Bacteria | 2832 |
| 394 | Ga0496109_0091050 | 3300048912 | Bacteria | 2821 |
| 395 | Ga0496109_0138710 | 3300048912 | Bacteria | 2273 |
| 396 | Ga0496109_0293337 | 3300048912 | Bacteria | 1533 |
| 397 | Ga0496109_0300438 | 3300048912 | Bacteria | 1514 |
| 398 | Ga0496110_0039954 | 3300048913 | Bacteria | 4088 |
| 399 | Ga0496110_0047489 | 3300048913 | Bacteria | 3760 |
| 400 | Ga0496110_0110556 | 3300048913 | Bacteria | 2469 |
| 401 | Ga0496110_0119319 | 3300048913 | Bacteria | 2375 |
| 402 | Ga0496110_0298756 | 3300048913 | Bacteria | 1467 |
| 403 | Ga0496110_0371459 | 3300048913 | Unclassified | 1303 |
| 404 | Ga0496111_0010125 | 3300048914 | Bacteria | 6312 |
| 405 | Ga0496111_0067335 | 3300048914 | Bacteria | 2601 |
| 406 | Ga0496111_0274310 | 3300048914 | Unclassified | 1251 |
| 407 | Ga0496112_0000621 | 3300048915 | Bacteria | 24571 |
| 408 | Ga0496112_0013035 | 3300048915 | Bacteria | 7667 |
| 409 | Ga0496113_0027464 | 3300048916 | Bacteria | 4081 |
| 410 | Ga0496113_0055917 | 3300048916 | Bacteria | 2960 |
| 411 | Ga0496114_0010013 | 3300048917 | Bacteria | 7537 |
| 412 | Ga0496114_0070279 | 3300048917 | Bacteria | 2940 |
| 413 | Ga0496115_0022578 | 3300048918 | Bacteria | 4877 |
| 414 | Ga0496115_0211152 | 3300048918 | Bacteria | 1603 |
| 415 | Ga0501033_0382540 | 3300049570 | Bacteria | 983 |
| 416 | Ga0501036_0205600 | 3300049572 | Bacteria | 1655 |
| 417 | Ga0501039_0011390 | 3300049575 | Bacteria | 6772 |
| 418 | Ga0501041_0106943 | 3300049577 | Bacteria | 1734 |
| 419 | Ga0501048_0188371 | 3300049582 | Bacteria | 1462 |
| 420 | Ga0501067_0036526 | 3300049583 | Bacteria | 2728 |
| 421 | Ga0501068_0180582 | 3300049584 | Bacteria | 1334 |
| 422 | Ga0501069_0065498 | 3300049585 | Bacteria | 2032 |
| 423 | Ga0501070_0029251 | 3300049586 | Bacteria | 4621 |
| 424 | Ga0501070_0051769 | 3300049586 | Bacteria | 3407 |
| 425 | Ga0501071_0132296 | 3300049587 | Bacteria | 1854 |
| 426 | Ga0501071_0133903 | 3300049587 | Bacteria | 1843 |
| 427 | Ga0501071_0233141 | 3300049587 | Bacteria | 1387 |
| 428 | Ga0501072_0001858 | 3300049588 | Bacteria | 15729 |
| 429 | Ga0501072_0202586 | 3300049588 | Bacteria | 1582 |
| 430 | Ga0501073_0224328 | 3300049589 | Bacteria | 1298 |
| 431 | Ga0501076_0019619 | 3300049592 | Bacteria | 5169 |
| 432 | Ga0501076_0102659 | 3300049592 | Bacteria | 2306 |
| 433 | Ga0501076_0454915 | 3300049592 | Bacteria | 1054 |
| 434 | Ga0501079_0069424 | 3300049741 | Bacteria | 2720 |
| 435 | Ga0501079_0180322 | 3300049741 | Bacteria | 1648 |
| 436 | Ga0501079_0232041 | 3300049741 | Bacteria | 1441 |
| 437 | Ga0501081_0031012 | 3300049743 | Bacteria | 3622 |
| 438 | Ga0501081_0219387 | 3300049743 | Bacteria | 1383 |
| 439 | Ga0501045_0015114 | 3300049824 | Bacteria | 5480 |
| 440 | nmdc:mga03n38_38422_c1 | 3300050490 | Bacteria | 2070 |
| 441 | nmdc:mga00v17_11539_c1 | 3300050491 | Bacteria | 4858 |
| 442 | nmdc:mga00v17_77470_c1 | 3300050491 | Bacteria | 2070 |
| 443 | nmdc:mga0yw44_11124_c1 | 3300050492 | Bacteria | 4627 |
| 444 | nmdc:mga0yw44_164927_c1 | 3300050492 | Bacteria | 1452 |
| 445 | nmdc:mga0yw44_1754_c1 | 3300050492 | Bacteria | 8835 |
| 446 | nmdc:mga0yw44_54170_c1 | 3300050492 | Bacteria | 2437 |
| 447 | nmdc:mga06z11_119695_c1 | 3300050494 | Bacteria | 1467 |
| 448 | nmdc:mga05p37_15267_c1 | 3300050507 | Bacteria | 9225 |
| 449 | nmdc:mga05p37_235166_c1 | 3300050507 | Bacteria | 2206 |
| 450 | nmdc:mga05p37_250336_c1 | 3300050507 | Bacteria | 2125 |
| 451 | nmdc:mga05p37_36443_c1 | 3300050507 | Bacteria | 6035 |
| 452 | nmdc:mga05p37_393404_c1 | 3300050507 | Bacteria | 1620 |
| 453 | nmdc:mga05p37_48821_c1 | 3300050507 | Bacteria | 5204 |
| 454 | nmdc:mga05p37_535739_c1 | 3300050507 | Bacteria | 1336 |
| 455 | nmdc:mga09592_18783_c1 | 3300050508 | Bacteria | 5671 |
| 456 | nmdc:mga0qj67_62035_c1 | 3300050509 | Bacteria | 2970 |
| 457 | nmdc:mga06r32_207098_c1 | 3300050510 | Bacteria | 1949 |
| 458 | nmdc:mga06r32_7879_c1 | 3300050510 | Bacteria | 9574 |
| 459 | nmdc:mga08y16_31389_c1 | 3300050511 | Bacteria | 5587 |
| 460 | nmdc:mga08y16_355554_c1 | 3300050511 | Bacteria | 1504 |
| 461 | nmdc:mga08y16_35990_c1 | 3300050511 | Bacteria | 5199 |
| 462 | nmdc:mga08y16_36428_c1 | 3300050511 | Bacteria | 5167 |
| 463 | nmdc:mga08y16_425750_c1 | 3300050511 | Unclassified | 1356 |
| 464 | nmdc:mga08y16_58989_c1 | 3300050511 | Bacteria | 4010 |
| 465 | nmdc:mga08y16_595257_c1 | 3300050511 | Unclassified | 1115 |
| 466 | nmdc:mga0n895_27595_c1 | 3300050512 | Bacteria | 5396 |
| 467 | nmdc:mga0n895_358061_c1 | 3300050512 | Bacteria | 1478 |
| 468 | nmdc:mga0a205_242805_c1 | 3300050515 | Bacteria | 1682 |
| 469 | nmdc:mga0a205_71664_c1 | 3300050515 | Bacteria | 3347 |
| 470 | Ga0495601_0080809 | 3300053077 | Bacteria | 2086 |
| 471 | Ga0495595_0012429 | 3300053084 | Bacteria | 3579 |
| 472 | Ga0501084_0014174 | 3300054114 | Bacteria | 6600 |
| 473 | Ga0501084_0108751 | 3300054114 | Bacteria | 2329 |
| 474 | Ga0501084_0213286 | 3300054114 | Bacteria | 1629 |
| 475 | Ga0501082_0313680 | 3300060353 | Bacteria | 1366 |
| 476 | Ga0466962_0138202 | 3300061719 | Bacteria | 1179 |
| 477 | Ga0530510_0005939 | 3300061734 | Bacteria | 8466 |
| 478 | Ga0530510_0132443 | 3300061734 | Bacteria | 1835 |
| 479 | Ga0530510_0167919 | 3300061734 | Bacteria | 1625 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045836 | Ga0466958_0072687 | Ga0466958_0072687_38_742 | 226 |
| 2 | 3300061734 | Ga0530510_0167919 | Ga0530510_0167919_826_1608 | 244 |
| 3 | 3300021388 | Ga0213875_10014052 | Ga0213875_100140523 | 252 |
| 4 | 3300006038 | Ga0075365_10144947 | Ga0075365_101449472 | 254 |
| 5 | 3300021358 | Ga0213873_10019725 | Ga0213873_100197252 | 255 |
| 6 | 3300044693 | Ga0466961_0207553 | Ga0466961_0207553_352_1167 | 256 |
| 7 | 3300045836 | Ga0466958_0019762 | Ga0466958_0019762_3053_3898 | 256 |
| 8 | 3300039453 | Ga0436362_0893815 | Ga0436362_0893815_128_1087 | 258 |
| 9 | 3300045049 | Ga0466959_0321148 | Ga0466959_0321148_228_1031 | 260 |
| 10 | 3300027866 | Ga0209813_10054201 | Ga0209813_100542012 | 263 |
| 11 | 3300035089 | Ga0373944_0062896 | Ga0373944_0062896_63_875 | 264 |
| 12 | 3300049577 | Ga0501041_0106943 | Ga0501041_0106943_61_888 | 266 |
| 13 | 3300049592 | Ga0501076_0454915 | Ga0501076_0454915_190_1017 | 266 |
| 14 | 3300005435 | Ga0070714_100229396 | Ga0070714_1002293962 | 268 |
| 15 | 3300025929 | Ga0207664_10044217 | Ga0207664_100442173 | 268 |
| 16 | 3300039450 | Ga0436363_0879407 | Ga0436363_0879407_551_1495 | 268 |
| 17 | 3300048913 | Ga0496110_0371459 | Ga0496110_0371459_14_856 | 268 |
| 18 | 3300037418 | Ga0395900_0017887 | Ga0395900_0017887_3443_4393 | 272 |
| 19 | 3300037466 | Ga0395898_0006309 | Ga0395898_0006309_3313_4263 | 272 |
| 20 | 3300037471 | Ga0395905_0012790 | Ga0395905_0012790_3920_4870 | 272 |
| 21 | 3300038443 | Ga0395901_0001875 | Ga0395901_0001875_3937_4887 | 272 |
| 22 | 3300044656 | Ga0466969_0045911 | Ga0466969_0045911_515_1441 | 274 |
| 23 | 3300044693 | Ga0466961_0112703 | Ga0466961_0112703_488_1414 | 274 |
| 24 | 3300044694 | Ga0466963_0002027 | Ga0466963_0002027_302_1228 | 274 |
| 25 | 3300044719 | Ga0466971_0053992 | Ga0466971_0053992_178_1104 | 274 |
| 26 | 3300044842 | Ga0466957_0109844 | Ga0466957_0109844_334_1260 | 274 |
| 27 | 3300039437 | Ga0436365_1170100 | Ga0436365_1170100_589_1425 | 275 |
| 28 | 3300044693 | Ga0466961_0057378 | Ga0466961_0057378_521_1474 | 275 |
| 29 | 3300045976 | Ga0466967_0135502 | Ga0466967_0135502_573_1520 | 275 |
| 30 | 3300046462 | Ga0495651_0190689 | Ga0495651_0190689_435_1346 | 275 |
| 31 | 3300046559 | Ga0495667_0062412 | Ga0495667_0062412_1057_1968 | 275 |
| 32 | 3300046559 | Ga0495667_0376950 | Ga0495667_0376950_43_882 | 275 |
| 33 | 3300046683 | Ga0495658_0220604 | Ga0495658_0220604_156_1067 | 275 |
| 34 | 3300044735 | Ga0466968_0084239 | Ga0466968_0084239_301_1239 | 276 |
| 35 | 3300025916 | Ga0207663_10015832 | Ga0207663_100158324 | 277 |
| 36 | 3300025939 | Ga0207665_10045124 | Ga0207665_100451242 | 277 |
| 37 | 3300048904 | Ga0496101_0223819 | Ga0496101_0223819_407_1360 | 277 |
| 38 | 3300048907 | Ga0496104_0179840 | Ga0496104_0179840_16_969 | 277 |
| 39 | 3300048908 | Ga0496105_0223099 | Ga0496105_0223099_523_1476 | 277 |
| 40 | 3300048911 | Ga0496108_0048673 | Ga0496108_0048673_2489_3442 | 277 |
| 41 | 3300048913 | Ga0496110_0039954 | Ga0496110_0039954_3195_4061 | 277 |
| 42 | 3300048913 | Ga0496110_0110556 | Ga0496110_0110556_913_1866 | 277 |
| 43 | 3300050494 | nmdc:mga06z11_119695_c1 | nmdc:mga06z11_119695_c1_257_1234 | 277 |
| 44 | 3300025939 | Ga0207665_10333509 | Ga0207665_103335092 | 278 |
| 45 | 3300037853 | Ga0436364_0026519 | Ga0436364_0026519_4497_5423 | 278 |
| 46 | 3300045049 | Ga0466959_0114311 | Ga0466959_0114311_748_1662 | 278 |
| 47 | 3300054114 | Ga0501084_0213286 | Ga0501084_0213286_291_1229 | 278 |
| 48 | 3300048907 | Ga0496104_0022477 | Ga0496104_0022477_459_1412 | 279 |
| 49 | 3300048918 | Ga0496115_0211152 | Ga0496115_0211152_492_1445 | 279 |
| 50 | 3300049586 | Ga0501070_0051769 | Ga0501070_0051769_677_1624 | 279 |
| 51 | 3300049588 | Ga0501072_0202586 | Ga0501072_0202586_94_1041 | 279 |
| 52 | 3300025929 | Ga0207664_10018369 | Ga0207664_100183693 | 280 |
| 53 | 3300039437 | Ga0436365_0202901 | Ga0436365_0202901_27497_28435 | 280 |
| 54 | 3300049583 | Ga0501067_0036526 | Ga0501067_0036526_576_1520 | 280 |
| 55 | 3300049584 | Ga0501068_0180582 | Ga0501068_0180582_302_1246 | 280 |
| 56 | 3300049585 | Ga0501069_0065498 | Ga0501069_0065498_285_1226 | 280 |
| 57 | 3300049586 | Ga0501070_0029251 | Ga0501070_0029251_274_1218 | 280 |
| 58 | 3300049589 | Ga0501073_0224328 | Ga0501073_0224328_316_1257 | 280 |
| 59 | 3300005434 | Ga0070709_10055483 | Ga0070709_100554833 | 281 |
| 60 | 3300005435 | Ga0070714_100451365 | Ga0070714_1004513651 | 281 |
| 61 | 3300005437 | Ga0070710_10021825 | Ga0070710_100218252 | 281 |
| 62 | 3300005439 | Ga0070711_100189224 | Ga0070711_1001892242 | 281 |
| 63 | 3300035117 | Ga0373953_0006334 | Ga0373953_0006334_368_1321 | 281 |
| 64 | 3300035692 | Ga0373935_0240557 | Ga0373935_0240557_33_986 | 281 |
| 65 | 3300035724 | Ga0373933_0032116 | Ga0373933_0032116_1819_2772 | 281 |
| 66 | 3300036401 | Ga0373937_0203235 | Ga0373937_0203235_709_1662 | 281 |
| 67 | 3300044735 | Ga0466968_0003224 | Ga0466968_0003224_5033_5947 | 281 |
| 68 | 3300046454 | Ga0495592_0040180 | Ga0495592_0040180_288_1241 | 281 |
| 69 | 3300046463 | Ga0495653_0033954 | Ga0495653_0033954_249_1202 | 281 |
| 70 | 3300046529 | Ga0495652_0042428 | Ga0495652_0042428_2782_3735 | 281 |
| 71 | 3300046533 | Ga0495640_0091325 | Ga0495640_0091325_156_1109 | 281 |
| 72 | 3300046536 | Ga0495587_0065356 | Ga0495587_0065356_40_993 | 281 |
| 73 | 3300046559 | Ga0495667_0017231 | Ga0495667_0017231_2458_3411 | 281 |
| 74 | 3300046642 | Ga0495634_0009790 | Ga0495634_0009790_2912_3865 | 281 |
| 75 | 3300046663 | Ga0495635_0005114 | Ga0495635_0005114_2872_3825 | 281 |
| 76 | 3300046675 | Ga0495657_0001401 | Ga0495657_0001401_3215_4168 | 281 |
| 77 | 3300046679 | Ga0495623_0218456 | Ga0495623_0218456_24_977 | 281 |
| 78 | 3300046809 | Ga0495600_0046112 | Ga0495600_0046112_215_1168 | 281 |
| 79 | 3300047317 | Ga0495604_0006700 | Ga0495604_0006700_2830_3783 | 281 |
| 80 | 3300047319 | Ga0495674_0013820 | Ga0495674_0013820_3389_4342 | 281 |
| 81 | 3300047322 | Ga0495680_0023484 | Ga0495680_0023484_1678_2631 | 281 |
| 82 | 3300047471 | Ga0495684_0031992 | Ga0495684_0031992_2983_3936 | 281 |
| 83 | 3300048088 | Ga0495602_0032804 | Ga0495602_0032804_2464_3417 | 281 |
| 84 | 3300048909 | Ga0496106_0154342 | Ga0496106_0154342_104_1033 | 281 |
| 85 | 3300048911 | Ga0496108_0517030 | Ga0496108_0517030_50_1003 | 281 |
| 86 | 3300048912 | Ga0496109_0090369 | Ga0496109_0090369_935_1864 | 281 |
| 87 | 3300048912 | Ga0496109_0293337 | Ga0496109_0293337_376_1329 | 281 |
| 88 | 3300048914 | Ga0496111_0010125 | Ga0496111_0010125_892_1821 | 281 |
| 89 | 3300048915 | Ga0496112_0000621 | Ga0496112_0000621_23225_24178 | 281 |
| 90 | 3300048916 | Ga0496113_0027464 | Ga0496113_0027464_1423_2376 | 281 |
| 91 | 3300053077 | Ga0495601_0080809 | Ga0495601_0080809_1048_2001 | 281 |
| 92 | 3300053084 | Ga0495595_0012429 | Ga0495595_0012429_185_1138 | 281 |
| 93 | 3300005435 | Ga0070714_100128800 | Ga0070714_1001288003 | 282 |
| 94 | 3300006028 | Ga0070717_10413641 | Ga0070717_104136412 | 282 |
| 95 | 3300025929 | Ga0207664_10227280 | Ga0207664_102272802 | 282 |
| 96 | 3300039437 | Ga0436365_1054951 | Ga0436365_1054951_115_1032 | 282 |
| 97 | 3300045049 | Ga0466959_0035092 | Ga0466959_0035092_1118_2056 | 282 |
| 98 | 3300026089 | Ga0207648_10175360 | Ga0207648_101753601 | 283 |
| 99 | 3300039453 | Ga0436362_0127759 | Ga0436362_0127759_278_1198 | 283 |
| 100 | 3300039453 | Ga0436362_0629257 | Ga0436362_0629257_1882_2778 | 283 |
| 101 | 3300005981 | Ga0081538_10000328 | Ga0081538_1000032818 | 284 |
| 102 | 3300037466 | Ga0395898_0092458 | Ga0395898_0092458_1040_1990 | 284 |
| 103 | 3300038443 | Ga0395901_0445878 | Ga0395901_0445878_54_1004 | 284 |
| 104 | 3300044656 | Ga0466969_0015689 | Ga0466969_0015689_1545_2498 | 284 |
| 105 | 3300045049 | Ga0466959_0035185 | Ga0466959_0035185_2087_3040 | 284 |
| 106 | 3300050507 | nmdc:mga05p37_393404_c1 | nmdc:mga05p37_393404_c1_488_1480 | 284 |
| 107 | 3300006175 | Ga0070712_100000965 | Ga0070712_10000096514 | 286 |
| 108 | 3300025906 | Ga0207699_10009612 | Ga0207699_100096125 | 286 |
| 109 | 3300025915 | Ga0207693_10002542 | Ga0207693_100025423 | 286 |
| 110 | 3300036647 | Ga0316582_0068980 | Ga0316582_0068980_1398_2273 | 287 |
| 111 | 3300036712 | Ga0316584_0165169 | Ga0316584_0165169_120_995 | 287 |
| 112 | 3300049587 | Ga0501071_0133903 | Ga0501071_0133903_19_936 | 287 |
| 113 | 3300049741 | Ga0501079_0069424 | Ga0501079_0069424_730_1620 | 287 |
| 114 | 3300061734 | Ga0530510_0132443 | Ga0530510_0132443_854_1771 | 287 |
| 115 | 3300025981 | Ga0207640_10382703 | Ga0207640_103827031 | 289 |
| 116 | 3300005356 | Ga0070674_100117809 | Ga0070674_1001178091 | 290 |
| 117 | 3300044684 | Ga0466966_0032474 | Ga0466966_0032474_1974_2921 | 290 |
| 118 | 3300044694 | Ga0466963_0085800 | Ga0466963_0085800_1030_1977 | 290 |
| 119 | 3300044719 | Ga0466971_0003879 | Ga0466971_0003879_5434_6381 | 290 |
| 120 | 3300048912 | Ga0496109_0081661 | Ga0496109_0081661_892_1830 | 290 |
| 121 | 3300005329 | Ga0070683_100023952 | Ga0070683_1000239522 | 291 |
| 122 | 3300005337 | Ga0070682_100005793 | Ga0070682_1000057933 | 291 |
| 123 | 3300005338 | Ga0068868_100017477 | Ga0068868_1000174777 | 291 |
| 124 | 3300005339 | Ga0070660_100003054 | Ga0070660_10000305412 | 291 |
| 125 | 3300005340 | Ga0070689_100047314 | Ga0070689_1000473142 | 291 |
| 126 | 3300005345 | Ga0070692_10010178 | Ga0070692_100101783 | 291 |
| 127 | 3300005353 | Ga0070669_100036162 | Ga0070669_1000361622 | 291 |
| 128 | 3300005354 | Ga0070675_100007308 | Ga0070675_1000073089 | 291 |
| 129 | 3300005364 | Ga0070673_100082743 | Ga0070673_1000827432 | 291 |
| 130 | 3300005366 | Ga0070659_100002893 | Ga0070659_1000028932 | 291 |
| 131 | 3300005441 | Ga0070700_100023899 | Ga0070700_1000238992 | 291 |
| 132 | 3300005455 | Ga0070663_100004596 | Ga0070663_1000045962 | 291 |
| 133 | 3300005457 | Ga0070662_100023799 | Ga0070662_1000237993 | 291 |
| 134 | 3300005459 | Ga0068867_100053837 | Ga0068867_1000538372 | 291 |
| 135 | 3300005466 | Ga0070685_10007278 | Ga0070685_100072785 | 291 |
| 136 | 3300005539 | Ga0068853_100027027 | Ga0068853_1000270272 | 291 |
| 137 | 3300005543 | Ga0070672_100031367 | Ga0070672_1000313672 | 291 |
| 138 | 3300005544 | Ga0070686_100003109 | Ga0070686_1000031094 | 291 |
| 139 | 3300005564 | Ga0070664_100046551 | Ga0070664_1000465513 | 291 |
| 140 | 3300005578 | Ga0068854_100011272 | Ga0068854_1000112723 | 291 |
| 141 | 3300005616 | Ga0068852_100021655 | Ga0068852_1000216552 | 291 |
| 142 | 3300005718 | Ga0068866_10129249 | Ga0068866_101292492 | 291 |
| 143 | 3300005719 | Ga0068861_100082651 | Ga0068861_1000826512 | 291 |
| 144 | 3300005834 | Ga0068851_10016271 | Ga0068851_100162711 | 291 |
| 145 | 3300005842 | Ga0068858_100113316 | Ga0068858_1001133162 | 291 |
| 146 | 3300005844 | Ga0068862_100159159 | Ga0068862_1001591592 | 291 |
| 147 | 3300006048 | Ga0075363_100031896 | Ga0075363_1000318962 | 291 |
| 148 | 3300006852 | Ga0075433_10016522 | Ga0075433_100165223 | 291 |
| 149 | 3300009094 | Ga0111539_10121198 | Ga0111539_101211982 | 291 |
| 150 | 3300009098 | Ga0105245_10004565 | Ga0105245_100045657 | 291 |
| 151 | 3300009148 | Ga0105243_10030151 | Ga0105243_100301513 | 291 |
| 152 | 3300010375 | Ga0105239_10011169 | Ga0105239_100111696 | 291 |
| 153 | 3300013307 | Ga0157372_10282866 | Ga0157372_102828662 | 291 |
| 154 | 3300014326 | Ga0157380_10029133 | Ga0157380_100291333 | 291 |
| 155 | 3300014968 | Ga0157379_10111633 | Ga0157379_101116332 | 291 |
| 156 | 3300025321 | Ga0207656_10039377 | Ga0207656_100393772 | 291 |
| 157 | 3300025919 | Ga0207657_10017263 | Ga0207657_100172635 | 291 |
| 158 | 3300025920 | Ga0207649_10031425 | Ga0207649_100314252 | 291 |
| 159 | 3300025926 | Ga0207659_10037620 | Ga0207659_100376202 | 291 |
| 160 | 3300025927 | Ga0207687_10026290 | Ga0207687_100262902 | 291 |
| 161 | 3300025932 | Ga0207690_10023007 | Ga0207690_100230072 | 291 |
| 162 | 3300025933 | Ga0207706_10004968 | Ga0207706_1000496812 | 291 |
| 163 | 3300025935 | Ga0207709_10019569 | Ga0207709_100195693 | 291 |
| 164 | 3300025936 | Ga0207670_10292307 | Ga0207670_102923071 | 291 |
| 165 | 3300025937 | Ga0207669_10152628 | Ga0207669_101526282 | 291 |
| 166 | 3300025938 | Ga0207704_10013520 | Ga0207704_100135202 | 291 |
| 167 | 3300025940 | Ga0207691_10005161 | Ga0207691_1000516111 | 291 |
| 168 | 3300025944 | Ga0207661_10090583 | Ga0207661_100905831 | 291 |
| 169 | 3300025981 | Ga0207640_10119692 | Ga0207640_101196922 | 291 |
| 170 | 3300026023 | Ga0207677_10040769 | Ga0207677_100407692 | 291 |
| 171 | 3300026041 | Ga0207639_10108784 | Ga0207639_101087842 | 291 |
| 172 | 3300026075 | Ga0207708_10008095 | Ga0207708_100080956 | 291 |
| 173 | 3300026089 | Ga0207648_10019050 | Ga0207648_100190501 | 291 |
| 174 | 3300026118 | Ga0207675_100011049 | Ga0207675_1000110492 | 291 |
| 175 | 3300026142 | Ga0207698_10006744 | Ga0207698_100067442 | 291 |
| 176 | 3300028380 | Ga0268265_10042771 | Ga0268265_100427712 | 291 |
| 177 | 3300048909 | Ga0496106_0026793 | Ga0496106_0026793_634_1572 | 291 |
| 178 | 3300048909 | Ga0496106_0059586 | Ga0496106_0059586_166_1113 | 291 |
| 179 | 3300048910 | Ga0496107_0031582 | Ga0496107_0031582_1213_2151 | 291 |
| 180 | 3300048911 | Ga0496108_0002794 | Ga0496108_0002794_9371_10309 | 291 |
| 181 | 3300048913 | Ga0496110_0047489 | Ga0496110_0047489_1902_2840 | 291 |
| 182 | 3300050490 | nmdc:mga03n38_38422_c1 | nmdc:mga03n38_38422_c1_756_1694 | 291 |
| 183 | 3300050492 | nmdc:mga0yw44_54170_c1 | nmdc:mga0yw44_54170_c1_1303_2241 | 291 |
| 184 | 3300050511 | nmdc:mga08y16_36428_c1 | nmdc:mga08y16_36428_c1_2616_3554 | 291 |
| 185 | 3300050515 | nmdc:mga0a205_71664_c1 | nmdc:mga0a205_71664_c1_56_1003 | 291 |
| 186 | 3300049587 | Ga0501071_0132296 | Ga0501071_0132296_128_1072 | 292 |
| 187 | 3300054114 | Ga0501084_0108751 | Ga0501084_0108751_298_1242 | 292 |
| 188 | 3300006058 | Ga0075432_10012798 | Ga0075432_100127982 | 293 |
| 189 | 3300009094 | Ga0111539_10006052 | Ga0111539_100060524 | 293 |
| 190 | 3300027907 | Ga0207428_10025079 | Ga0207428_100250793 | 293 |
| 191 | 3300035115 | Ga0373941_0070209 | Ga0373941_0070209_180_1097 | 293 |
| 192 | 3300037466 | Ga0395898_0098958 | Ga0395898_0098958_553_1473 | 293 |
| 193 | 3300038443 | Ga0395901_0215949 | Ga0395901_0215949_571_1491 | 293 |
| 194 | 3300050511 | nmdc:mga08y16_31389_c1 | nmdc:mga08y16_31389_c1_2409_3326 | 293 |
| 195 | 3300031995 | Ga0307409_100194127 | Ga0307409_1001941272 | 294 |
| 196 | 3300032002 | Ga0307416_100108008 | Ga0307416_1001080083 | 294 |
| 197 | 3300005455 | Ga0070663_100045019 | Ga0070663_1000450193 | 295 |
| 198 | 3300005457 | Ga0070662_100045263 | Ga0070662_1000452632 | 295 |
| 199 | 3300005466 | Ga0070685_10110662 | Ga0070685_101106622 | 295 |
| 200 | 3300005535 | Ga0070684_100002911 | Ga0070684_1000029113 | 295 |
| 201 | 3300005548 | Ga0070665_100046252 | Ga0070665_1000462522 | 295 |
| 202 | 3300005563 | Ga0068855_100325820 | Ga0068855_1003258202 | 295 |
| 203 | 3300005577 | Ga0068857_100349386 | Ga0068857_1003493862 | 295 |
| 204 | 3300005615 | Ga0070702_100060790 | Ga0070702_1000607902 | 295 |
| 205 | 3300005618 | Ga0068864_100021815 | Ga0068864_1000218155 | 295 |
| 206 | 3300005844 | Ga0068862_100140895 | Ga0068862_1001408952 | 295 |
| 207 | 3300006175 | Ga0070712_100183582 | Ga0070712_1001835822 | 295 |
| 208 | 3300006881 | Ga0068865_100158116 | Ga0068865_1001581162 | 295 |
| 209 | 3300025901 | Ga0207688_10000324 | Ga0207688_1000032413 | 295 |
| 210 | 3300025915 | Ga0207693_10033390 | Ga0207693_100333903 | 295 |
| 211 | 3300025933 | Ga0207706_10020079 | Ga0207706_100200795 | 295 |
| 212 | 3300025938 | Ga0207704_10083400 | Ga0207704_100834002 | 295 |
| 213 | 3300025942 | Ga0207689_10418040 | Ga0207689_104180402 | 295 |
| 214 | 3300025949 | Ga0207667_10490407 | Ga0207667_104904071 | 295 |
| 215 | 3300026075 | Ga0207708_10001190 | Ga0207708_1000119020 | 295 |
| 216 | 3300026078 | Ga0207702_10232242 | Ga0207702_102322422 | 295 |
| 217 | 3300026095 | Ga0207676_10056867 | Ga0207676_100568672 | 295 |
| 218 | 3300028380 | Ga0268265_10129032 | Ga0268265_101290322 | 295 |
| 219 | 3300048908 | Ga0496105_0317033 | Ga0496105_0317033_261_1202 | 295 |
| 220 | 3300048915 | Ga0496112_0013035 | Ga0496112_0013035_5865_6806 | 295 |
| 221 | 3300048917 | Ga0496114_0070279 | Ga0496114_0070279_1356_2297 | 295 |
| 222 | 3300005545 | Ga0070695_100244222 | Ga0070695_1002442221 | 296 |
| 223 | 3300005549 | Ga0070704_100422515 | Ga0070704_1004225151 | 296 |
| 224 | 3300006847 | Ga0075431_100029164 | Ga0075431_1000291645 | 296 |
| 225 | 3300006852 | Ga0075433_10503494 | Ga0075433_105034942 | 296 |
| 226 | 3300006871 | Ga0075434_100131565 | Ga0075434_1001315652 | 296 |
| 227 | 3300009094 | Ga0111539_10018405 | Ga0111539_100184056 | 296 |
| 228 | 3300009094 | Ga0111539_10022248 | Ga0111539_100222484 | 296 |
| 229 | 3300009147 | Ga0114129_10008915 | Ga0114129_1000891515 | 296 |
| 230 | 3300009147 | Ga0114129_10090132 | Ga0114129_100901324 | 296 |
| 231 | 3300009147 | Ga0114129_10219282 | Ga0114129_102192822 | 296 |
| 232 | 3300027907 | Ga0207428_10037179 | Ga0207428_100371794 | 296 |
| 233 | 3300031852 | Ga0307410_10028588 | Ga0307410_100285882 | 296 |
| 234 | 3300031995 | Ga0307409_100001709 | Ga0307409_10000170911 | 296 |
| 235 | 3300032002 | Ga0307416_100001189 | Ga0307416_1000011899 | 296 |
| 236 | 3300032005 | Ga0307411_10044303 | Ga0307411_100443032 | 296 |
| 237 | 3300032126 | Ga0307415_100000762 | Ga0307415_1000007629 | 296 |
| 238 | 3300050507 | nmdc:mga05p37_250336_c1 | nmdc:mga05p37_250336_c1_779_1720 | 296 |
| 239 | 3300050507 | nmdc:mga05p37_36443_c1 | nmdc:mga05p37_36443_c1_1049_1948 | 296 |
| 240 | 3300050507 | nmdc:mga05p37_48821_c1 | nmdc:mga05p37_48821_c1_3080_4018 | 296 |
| 241 | 3300050511 | nmdc:mga08y16_35990_c1 | nmdc:mga08y16_35990_c1_1137_2036 | 296 |
| 242 | 3300050511 | nmdc:mga08y16_425750_c1 | nmdc:mga08y16_425750_c1_374_1273 | 296 |
| 243 | 3300050511 | nmdc:mga08y16_58989_c1 | nmdc:mga08y16_58989_c1_696_1637 | 296 |
| 244 | 3300050512 | nmdc:mga0n895_358061_c1 | nmdc:mga0n895_358061_c1_301_1242 | 296 |
| 245 | 3300049570 | Ga0501033_0382540 | Ga0501033_0382540_44_955 | 297 |
| 246 | 3300049575 | Ga0501039_0011390 | Ga0501039_0011390_29_940 | 297 |
| 247 | 3300025961 | Ga0207712_10045539 | Ga0207712_100455393 | 298 |
| 248 | 3300025972 | Ga0207668_10183935 | Ga0207668_101839352 | 298 |
| 249 | 3300046517 | Ga0495630_0107516 | Ga0495630_0107516_963_1883 | 298 |
| 250 | 3300035170 | Ga0373943_0115042 | Ga0373943_0115042_119_1042 | 300 |
| 251 | 3300005937 | Ga0081455_10030297 | Ga0081455_100302974 | 301 |
| 252 | 3300005985 | Ga0081539_10039540 | Ga0081539_100395403 | 301 |
| 253 | 3300005985 | Ga0081539_10063210 | Ga0081539_100632102 | 301 |
| 254 | 3300006846 | Ga0075430_100022950 | Ga0075430_1000229503 | 301 |
| 255 | 3300006847 | Ga0075431_100473894 | Ga0075431_1004738942 | 301 |
| 256 | 3300006847 | Ga0075431_100551338 | Ga0075431_1005513382 | 301 |
| 257 | 3300006880 | Ga0075429_100047513 | Ga0075429_1000475131 | 301 |
| 258 | 3300021384 | Ga0213876_10123472 | Ga0213876_101234722 | 301 |
| 259 | 3300050508 | nmdc:mga09592_18783_c1 | nmdc:mga09592_18783_c1_1453_2397 | 301 |
| 260 | 3300050509 | nmdc:mga0qj67_62035_c1 | nmdc:mga0qj67_62035_c1_226_1170 | 301 |
| 261 | 3300003373 | JGI25407J50210_10014949 | JGI25407J50210_100149492 | 302 |
| 262 | 3300005337 | Ga0070682_100036480 | Ga0070682_1000364803 | 302 |
| 263 | 3300005341 | Ga0070691_10094760 | Ga0070691_100947602 | 302 |
| 264 | 3300005343 | Ga0070687_100175449 | Ga0070687_1001754492 | 302 |
| 265 | 3300005347 | Ga0070668_100076596 | Ga0070668_1000765962 | 302 |
| 266 | 3300005444 | Ga0070694_100140040 | Ga0070694_1001400402 | 302 |
| 267 | 3300005456 | Ga0070678_100019173 | Ga0070678_1000191732 | 302 |
| 268 | 3300005456 | Ga0070678_100050724 | Ga0070678_1000507242 | 302 |
| 269 | 3300005544 | Ga0070686_100015940 | Ga0070686_1000159402 | 302 |
| 270 | 3300005546 | Ga0070696_100154857 | Ga0070696_1001548572 | 302 |
| 271 | 3300005937 | Ga0081455_10019231 | Ga0081455_100192312 | 302 |
| 272 | 3300005981 | Ga0081538_10000032 | Ga0081538_10000032117 | 302 |
| 273 | 3300005981 | Ga0081538_10014065 | Ga0081538_100140655 | 302 |
| 274 | 3300006038 | Ga0075365_10000195 | Ga0075365_1000019510 | 302 |
| 275 | 3300006038 | Ga0075365_10000715 | Ga0075365_100007155 | 302 |
| 276 | 3300006051 | Ga0075364_10038632 | Ga0075364_100386322 | 302 |
| 277 | 3300006163 | Ga0070715_10022938 | Ga0070715_100229382 | 302 |
| 278 | 3300006847 | Ga0075431_100000134 | Ga0075431_10000013452 | 302 |
| 279 | 3300006852 | Ga0075433_10268044 | Ga0075433_102680442 | 302 |
| 280 | 3300006871 | Ga0075434_100029805 | Ga0075434_1000298052 | 302 |
| 281 | 3300006881 | Ga0068865_100071520 | Ga0068865_1000715202 | 302 |
| 282 | 3300009094 | Ga0111539_10318926 | Ga0111539_103189262 | 302 |
| 283 | 3300009098 | Ga0105245_10023300 | Ga0105245_100233005 | 302 |
| 284 | 3300009147 | Ga0114129_10016660 | Ga0114129_100166606 | 302 |
| 285 | 3300009147 | Ga0114129_10028828 | Ga0114129_100288284 | 302 |
| 286 | 3300009147 | Ga0114129_10403204 | Ga0114129_104032042 | 302 |
| 287 | 3300009148 | Ga0105243_10058925 | Ga0105243_100589253 | 302 |
| 288 | 3300009177 | Ga0105248_10182749 | Ga0105248_101827493 | 302 |
| 289 | 3300009553 | Ga0105249_10114451 | Ga0105249_101144512 | 302 |
| 290 | 3300010375 | Ga0105239_10035393 | Ga0105239_100353936 | 302 |
| 291 | 3300011119 | Ga0105246_10080375 | Ga0105246_100803752 | 302 |
| 292 | 3300011119 | Ga0105246_10085183 | Ga0105246_100851832 | 302 |
| 293 | 3300014745 | Ga0157377_10002386 | Ga0157377_100023862 | 302 |
| 294 | 3300025905 | Ga0207685_10016091 | Ga0207685_100160912 | 302 |
| 295 | 3300025917 | Ga0207660_10056411 | Ga0207660_100564112 | 302 |
| 296 | 3300025927 | Ga0207687_10012462 | Ga0207687_100124625 | 302 |
| 297 | 3300025935 | Ga0207709_10032663 | Ga0207709_100326633 | 302 |
| 298 | 3300025937 | Ga0207669_10046796 | Ga0207669_100467962 | 302 |
| 299 | 3300025938 | Ga0207704_10054295 | Ga0207704_100542952 | 302 |
| 300 | 3300025972 | Ga0207668_10185390 | Ga0207668_101853902 | 302 |
| 301 | 3300026121 | Ga0207683_10065771 | Ga0207683_100657712 | 302 |
| 302 | 3300026121 | Ga0207683_10076626 | Ga0207683_100766262 | 302 |
| 303 | 3300031852 | Ga0307410_10032424 | Ga0307410_100324242 | 302 |
| 304 | 3300031995 | Ga0307409_100089011 | Ga0307409_1000890111 | 302 |
| 305 | 3300032002 | Ga0307416_100051892 | Ga0307416_1000518922 | 302 |
| 306 | 3300037418 | Ga0395900_0137379 | Ga0395900_0137379_1184_2131 | 302 |
| 307 | 3300037418 | Ga0395900_0161398 | Ga0395900_0161398_1336_2271 | 302 |
| 308 | 3300037466 | Ga0395898_0008821 | Ga0395898_0008821_3893_4840 | 302 |
| 309 | 3300037466 | Ga0395898_0499737 | Ga0395898_0499737_18_953 | 302 |
| 310 | 3300037471 | Ga0395905_0013085 | Ga0395905_0013085_4118_5065 | 302 |
| 311 | 3300038443 | Ga0395901_0014926 | Ga0395901_0014926_4380_5327 | 302 |
| 312 | 3300038443 | Ga0395901_0044481 | Ga0395901_0044481_2586_3515 | 302 |
| 313 | 3300038443 | Ga0395901_0208573 | Ga0395901_0208573_558_1493 | 302 |
| 314 | 3300044684 | Ga0466966_0029296 | Ga0466966_0029296_800_1729 | 302 |
| 315 | 3300044694 | Ga0466963_0018303 | Ga0466963_0018303_2735_3667 | 302 |
| 316 | 3300044694 | Ga0466963_0065899 | Ga0466963_0065899_1153_2085 | 302 |
| 317 | 3300044694 | Ga0466963_0159774 | Ga0466963_0159774_137_1069 | 302 |
| 318 | 3300044842 | Ga0466957_0060023 | Ga0466957_0060023_1044_1973 | 302 |
| 319 | 3300045836 | Ga0466958_0024387 | Ga0466958_0024387_663_1595 | 302 |
| 320 | 3300045836 | Ga0466958_0064993 | Ga0466958_0064993_316_1254 | 302 |
| 321 | 3300045836 | Ga0466958_0169102 | Ga0466958_0169102_41_973 | 302 |
| 322 | 3300045976 | Ga0466967_0082269 | Ga0466967_0082269_822_1754 | 302 |
| 323 | 3300045976 | Ga0466967_0132062 | Ga0466967_0132062_256_1176 | 302 |
| 324 | 3300045976 | Ga0466967_0162016 | Ga0466967_0162016_176_1108 | 302 |
| 325 | 3300046461 | Ga0495641_0015311 | Ga0495641_0015311_1695_2624 | 302 |
| 326 | 3300046681 | Ga0495647_0045199 | Ga0495647_0045199_727_1656 | 302 |
| 327 | 3300047315 | Ga0495581_0086101 | Ga0495581_0086101_758_1687 | 302 |
| 328 | 3300047321 | Ga0495676_0036082 | Ga0495676_0036082_695_1624 | 302 |
| 329 | 3300048904 | Ga0496101_0001347 | Ga0496101_0001347_8742_9671 | 302 |
| 330 | 3300048906 | Ga0496103_0002108 | Ga0496103_0002108_3122_4051 | 302 |
| 331 | 3300048908 | Ga0496105_0053235 | Ga0496105_0053235_185_1114 | 302 |
| 332 | 3300048909 | Ga0496106_0003436 | Ga0496106_0003436_8614_9543 | 302 |
| 333 | 3300048912 | Ga0496109_0138710 | Ga0496109_0138710_1332_2261 | 302 |
| 334 | 3300048913 | Ga0496110_0119319 | Ga0496110_0119319_548_1477 | 302 |
| 335 | 3300048914 | Ga0496111_0067335 | Ga0496111_0067335_1253_2182 | 302 |
| 336 | 3300048917 | Ga0496114_0010013 | Ga0496114_0010013_1761_2690 | 302 |
| 337 | 3300048918 | Ga0496115_0022578 | Ga0496115_0022578_1186_2115 | 302 |
| 338 | 3300049572 | Ga0501036_0205600 | Ga0501036_0205600_155_1099 | 302 |
| 339 | 3300049582 | Ga0501048_0188371 | Ga0501048_0188371_225_1169 | 302 |
| 340 | 3300049588 | Ga0501072_0001858 | Ga0501072_0001858_12141_13085 | 302 |
| 341 | 3300049592 | Ga0501076_0019619 | Ga0501076_0019619_187_1131 | 302 |
| 342 | 3300049741 | Ga0501079_0180322 | Ga0501079_0180322_139_1092 | 302 |
| 343 | 3300049741 | Ga0501079_0232041 | Ga0501079_0232041_264_1208 | 302 |
| 344 | 3300049743 | Ga0501081_0031012 | Ga0501081_0031012_602_1546 | 302 |
| 345 | 3300050491 | nmdc:mga00v17_11539_c1 | nmdc:mga00v17_11539_c1_1713_2660 | 302 |
| 346 | 3300050491 | nmdc:mga00v17_77470_c1 | nmdc:mga00v17_77470_c1_356_1276 | 302 |
| 347 | 3300050492 | nmdc:mga0yw44_11124_c1 | nmdc:mga0yw44_11124_c1_964_1884 | 302 |
| 348 | 3300050492 | nmdc:mga0yw44_164927_c1 | nmdc:mga0yw44_164927_c1_432_1379 | 302 |
| 349 | 3300050492 | nmdc:mga0yw44_1754_c1 | nmdc:mga0yw44_1754_c1_3583_4503 | 302 |
| 350 | 3300050507 | nmdc:mga05p37_15267_c1 | nmdc:mga05p37_15267_c1_5460_6404 | 302 |
| 351 | 3300050510 | nmdc:mga06r32_207098_c1 | nmdc:mga06r32_207098_c1_233_1162 | 302 |
| 352 | 3300050510 | nmdc:mga06r32_7879_c1 | nmdc:mga06r32_7879_c1_6551_7489 | 302 |
| 353 | 3300050512 | nmdc:mga0n895_27595_c1 | nmdc:mga0n895_27595_c1_704_1642 | 302 |
| 354 | 3300050515 | nmdc:mga0a205_242805_c1 | nmdc:mga0a205_242805_c1_267_1205 | 302 |
| 355 | 3300054114 | Ga0501084_0014174 | Ga0501084_0014174_2165_3109 | 302 |
| 356 | 3300061719 | Ga0466962_0138202 | Ga0466962_0138202_99_1043 | 302 |
| 357 | 3300061734 | Ga0530510_0005939 | Ga0530510_0005939_4120_5064 | 302 |
| 358 | 3300005444 | Ga0070694_100366487 | Ga0070694_1003664872 | 303 |
| 359 | 3300005535 | Ga0070684_100074784 | Ga0070684_1000747843 | 303 |
| 360 | 3300005548 | Ga0070665_100040848 | Ga0070665_1000408482 | 303 |
| 361 | 3300005844 | Ga0068862_100625153 | Ga0068862_1006251531 | 303 |
| 362 | 3300005937 | Ga0081455_10021221 | Ga0081455_100212212 | 303 |
| 363 | 3300005983 | Ga0081540_1003253 | Ga0081540_10032535 | 303 |
| 364 | 3300005985 | Ga0081539_10024221 | Ga0081539_100242212 | 303 |
| 365 | 3300006038 | Ga0075365_10102365 | Ga0075365_101023651 | 303 |
| 366 | 3300006048 | Ga0075363_100030262 | Ga0075363_1000302622 | 303 |
| 367 | 3300006178 | Ga0075367_10038159 | Ga0075367_100381592 | 303 |
| 368 | 3300009094 | Ga0111539_10180512 | Ga0111539_101805121 | 303 |
| 369 | 3300009098 | Ga0105245_10000568 | Ga0105245_1000056835 | 303 |
| 370 | 3300009098 | Ga0105245_10083666 | Ga0105245_100836662 | 303 |
| 371 | 3300009098 | Ga0105245_10443690 | Ga0105245_104436902 | 303 |
| 372 | 3300009147 | Ga0114129_10235616 | Ga0114129_102356163 | 303 |
| 373 | 3300021377 | Ga0213874_10000028 | Ga0213874_1000002813 | 303 |
| 374 | 3300021384 | Ga0213876_10046527 | Ga0213876_100465272 | 303 |
| 375 | 3300021388 | Ga0213875_10010469 | Ga0213875_100104693 | 303 |
| 376 | 3300025927 | Ga0207687_10262095 | Ga0207687_102620952 | 303 |
| 377 | 3300025934 | Ga0207686_10265934 | Ga0207686_102659341 | 303 |
| 378 | 3300025944 | Ga0207661_10240681 | Ga0207661_102406812 | 303 |
| 379 | 3300025972 | Ga0207668_10069372 | Ga0207668_100693722 | 303 |
| 380 | 3300026075 | Ga0207708_10091077 | Ga0207708_100910772 | 303 |
| 381 | 3300028379 | Ga0268266_10008906 | Ga0268266_100089063 | 303 |
| 382 | 3300031548 | Ga0307408_100028879 | Ga0307408_1000288794 | 303 |
| 383 | 3300031824 | Ga0307413_10010947 | Ga0307413_100109472 | 303 |
| 384 | 3300031852 | Ga0307410_10133270 | Ga0307410_101332702 | 303 |
| 385 | 3300031901 | Ga0307406_10074725 | Ga0307406_100747252 | 303 |
| 386 | 3300031903 | Ga0307407_10011376 | Ga0307407_100113762 | 303 |
| 387 | 3300032002 | Ga0307416_100030131 | Ga0307416_1000301312 | 303 |
| 388 | 3300032002 | Ga0307416_100049733 | Ga0307416_1000497333 | 303 |
| 389 | 3300037312 | Ga0395899_0224525 | Ga0395899_0224525_88_1014 | 303 |
| 390 | 3300037466 | Ga0395898_0067020 | Ga0395898_0067020_174_1115 | 303 |
| 391 | 3300037853 | Ga0436364_0296398 | Ga0436364_0296398_1897_2838 | 303 |
| 392 | 3300038443 | Ga0395901_0025808 | Ga0395901_0025808_2995_3924 | 303 |
| 393 | 3300039437 | Ga0436365_0001544 | Ga0436365_0001544_231_1178 | 303 |
| 394 | 3300039437 | Ga0436365_0835713 | Ga0436365_0835713_3532_4485 | 303 |
| 395 | 3300039450 | Ga0436363_0174915 | Ga0436363_0174915_17442_18389 | 303 |
| 396 | 3300041512 | Ga0451853_2971813 | Ga0451853_2971813_601_1533 | 303 |
| 397 | 3300044656 | Ga0466969_0109304 | Ga0466969_0109304_257_1198 | 303 |
| 398 | 3300044684 | Ga0466966_0096191 | Ga0466966_0096191_864_1811 | 303 |
| 399 | 3300044693 | Ga0466961_0010987 | Ga0466961_0010987_1657_2604 | 303 |
| 400 | 3300045049 | Ga0466959_0007413 | Ga0466959_0007413_5607_6548 | 303 |
| 401 | 3300045836 | Ga0466958_0017843 | Ga0466958_0017843_2862_3809 | 303 |
| 402 | 3300046474 | Ga0495605_0074479 | Ga0495605_0074479_609_1541 | 303 |
| 403 | 3300046500 | Ga0495596_0086110 | Ga0495596_0086110_256_1188 | 303 |
| 404 | 3300046615 | Ga0495656_0064585 | Ga0495656_0064585_118_1050 | 303 |
| 405 | 3300048913 | Ga0496110_0298756 | Ga0496110_0298756_454_1398 | 303 |
| 406 | 3300050511 | nmdc:mga08y16_355554_c1 | nmdc:mga08y16_355554_c1_509_1453 | 303 |
| 407 | 3300005327 | Ga0070658_10022746 | Ga0070658_100227463 | 304 |
| 408 | 3300005329 | Ga0070683_100007131 | Ga0070683_1000071318 | 304 |
| 409 | 3300005336 | Ga0070680_100000746 | Ga0070680_10000074619 | 304 |
| 410 | 3300005337 | Ga0070682_100018093 | Ga0070682_1000180933 | 304 |
| 411 | 3300005339 | Ga0070660_100029345 | Ga0070660_1000293454 | 304 |
| 412 | 3300005344 | Ga0070661_100002426 | Ga0070661_1000024268 | 304 |
| 413 | 3300005366 | Ga0070659_100001090 | Ga0070659_10000109016 | 304 |
| 414 | 3300005458 | Ga0070681_10006683 | Ga0070681_100066837 | 304 |
| 415 | 3300005530 | Ga0070679_100137325 | Ga0070679_1001373253 | 304 |
| 416 | 3300005577 | Ga0068857_100046736 | Ga0068857_1000467363 | 304 |
| 417 | 3300005614 | Ga0068856_100011634 | Ga0068856_1000116344 | 304 |
| 418 | 3300005614 | Ga0068856_100022543 | Ga0068856_1000225433 | 304 |
| 419 | 3300005616 | Ga0068852_100007252 | Ga0068852_1000072527 | 304 |
| 420 | 3300006846 | Ga0075430_100184258 | Ga0075430_1001842583 | 304 |
| 421 | 3300006852 | Ga0075433_10014385 | Ga0075433_100143855 | 304 |
| 422 | 3300006871 | Ga0075434_100020844 | Ga0075434_1000208443 | 304 |
| 423 | 3300006914 | Ga0075436_100241070 | Ga0075436_1002410701 | 304 |
| 424 | 3300007076 | Ga0075435_100079288 | Ga0075435_1000792882 | 304 |
| 425 | 3300009093 | Ga0105240_10007232 | Ga0105240_1000723212 | 304 |
| 426 | 3300009098 | Ga0105245_10389318 | Ga0105245_103893181 | 304 |
| 427 | 3300009147 | Ga0114129_10224782 | Ga0114129_102247823 | 304 |
| 428 | 3300009147 | Ga0114129_10548223 | Ga0114129_105482232 | 304 |
| 429 | 3300009147 | Ga0114129_10559828 | Ga0114129_105598282 | 304 |
| 430 | 3300009551 | Ga0105238_10510390 | Ga0105238_105103902 | 304 |
| 431 | 3300013105 | Ga0157369_10006254 | Ga0157369_100062545 | 304 |
| 432 | 3300013307 | Ga0157372_10055368 | Ga0157372_100553683 | 304 |
| 433 | 3300020070 | Ga0206356_11699020 | Ga0206356_116990202 | 304 |
| 434 | 3300020082 | Ga0206353_10005236 | Ga0206353_100052363 | 304 |
| 435 | 3300025912 | Ga0207707_10006326 | Ga0207707_100063267 | 304 |
| 436 | 3300025913 | Ga0207695_10108674 | Ga0207695_101086742 | 304 |
| 437 | 3300025914 | Ga0207671_10053017 | Ga0207671_100530172 | 304 |
| 438 | 3300025917 | Ga0207660_10092712 | Ga0207660_100927123 | 304 |
| 439 | 3300025919 | Ga0207657_10007520 | Ga0207657_100075205 | 304 |
| 440 | 3300025944 | Ga0207661_10000599 | Ga0207661_1000059911 | 304 |
| 441 | 3300026067 | Ga0207678_10281740 | Ga0207678_102817402 | 304 |
| 442 | 3300026075 | Ga0207708_10226348 | Ga0207708_102263482 | 304 |
| 443 | 3300026078 | Ga0207702_10011747 | Ga0207702_100117473 | 304 |
| 444 | 3300026116 | Ga0207674_10019972 | Ga0207674_100199727 | 304 |
| 445 | 3300031995 | Ga0307409_100037506 | Ga0307409_1000375063 | 304 |
| 446 | 3300031995 | Ga0307409_100173147 | Ga0307409_1001731472 | 304 |
| 447 | 3300032002 | Ga0307416_100205720 | Ga0307416_1002057203 | 304 |
| 448 | 3300032002 | Ga0307416_100719971 | Ga0307416_1007199712 | 304 |
| 449 | 3300032004 | Ga0307414_10472814 | Ga0307414_104728142 | 304 |
| 450 | 3300037418 | Ga0395900_0003110 | Ga0395900_0003110_2874_3815 | 304 |
| 451 | 3300037466 | Ga0395898_0000333 | Ga0395898_0000333_95501_96442 | 304 |
| 452 | 3300037466 | Ga0395898_0254662 | Ga0395898_0254662_29_973 | 304 |
| 453 | 3300038443 | Ga0395901_0177226 | Ga0395901_0177226_276_1220 | 304 |
| 454 | 3300044694 | Ga0466963_0065451 | Ga0466963_0065451_317_1267 | 304 |
| 455 | 3300046794 | Ga0495589_0105489 | Ga0495589_0105489_139_1053 | 304 |
| 456 | 3300048912 | Ga0496109_0091050 | Ga0496109_0091050_1382_2332 | 304 |
| 457 | 3300048912 | Ga0496109_0300438 | Ga0496109_0300438_20_967 | 304 |
| 458 | 3300048914 | Ga0496111_0274310 | Ga0496111_0274310_24_968 | 304 |
| 459 | 3300048916 | Ga0496113_0055917 | Ga0496113_0055917_435_1385 | 304 |
| 460 | 3300049587 | Ga0501071_0233141 | Ga0501071_0233141_117_1031 | 304 |
| 461 | 3300049743 | Ga0501081_0219387 | Ga0501081_0219387_25_939 | 304 |
| 462 | 3300050507 | nmdc:mga05p37_235166_c1 | nmdc:mga05p37_235166_c1_1257_2171 | 304 |
| 463 | 3300050507 | nmdc:mga05p37_535739_c1 | nmdc:mga05p37_535739_c1_328_1242 | 304 |
| 464 | 3300050511 | nmdc:mga08y16_595257_c1 | nmdc:mga08y16_595257_c1_78_1028 | 304 |
| 465 | 3300005329 | Ga0070683_100003147 | Ga0070683_1000031478 | 305 |
| 466 | 3300005356 | Ga0070674_100007998 | Ga0070674_1000079983 | 305 |
| 467 | 3300005547 | Ga0070693_100267408 | Ga0070693_1002674082 | 305 |
| 468 | 3300005718 | Ga0068866_10098978 | Ga0068866_100989781 | 305 |
| 469 | 3300009148 | Ga0105243_10048548 | Ga0105243_100485483 | 305 |
| 470 | 3300025937 | Ga0207669_10036597 | Ga0207669_100365973 | 305 |
| 471 | 3300025944 | Ga0207661_10018558 | Ga0207661_100185584 | 305 |
| 472 | 3300025972 | Ga0207668_10015795 | Ga0207668_100157953 | 305 |
| 473 | 3300031995 | Ga0307409_100186175 | Ga0307409_1001861751 | 305 |
| 474 | 3300032002 | Ga0307416_100214911 | Ga0307416_1002149113 | 305 |
| 475 | 3300037466 | Ga0395898_0217949 | Ga0395898_0217949_439_1356 | 305 |
| 476 | 3300049592 | Ga0501076_0102659 | Ga0501076_0102659_602_1519 | 305 |
| 477 | 3300049824 | Ga0501045_0015114 | Ga0501045_0015114_247_1164 | 305 |
| 478 | 3300060353 | Ga0501082_0313680 | Ga0501082_0313680_69_992 | 305 |
| 479 | 3300000549 | LJQas_1000763 | LJQas_10007632 | 315 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b66-assembly1.cif.gz_B | impase (af2372) r92q/k164e with 400 mm glutamate | 0.8936 | 3 | 304 |
| 6b64-assembly1.cif.gz_B | impase (af2372) with 25 mm asp | 0.8901 | 3 | 304 |
| 3luz-assembly1.cif.gz_A | crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement | 0.8743 | 3 | 307 |
| 6b5z-assembly1.cif.gz_A | impase (af2372) with 25 mm asp | 0.8678 | 3 | 304 |
| 6tqo-assembly1.cif.gz_T | rrn anti-termination complex | 0.8598 | 42 | 309 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lbvA01 | Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 | 0.8883 | 3 | 149 | 3.30.540.10 |
| af_A4HWI6_353_462_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.8768 | 177 | 308 | 3.40.190.80 |
| af_Q58327_174_293_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.8558 | 155 | 305 | 3.40.190.80 |
| af_Q8CIN7_160_290_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.8558 | 156 | 305 | 3.40.190.80 |
| 4n81A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.8551 | 156 | 307 | 3.40.190.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538F9N3-F1-model_v4 | Inositol monophosphatase | 0.99 | 1 | 313 |
GO:0006020
GO:0007165 GO:0008934 GO:0046872 |
| AF-A0A7W0APG9-F1-model_v4 | Inositol monophosphatase | 0.9879 | 135 | 315 |
GO:0006020
GO:0007165 GO:0008934 GO:0046854 GO:0046872 |
| AF-A0A7V8ZDN2-F1-model_v4 | Inositol monophosphatase | 0.984 | 202 | 314 |
GO:0046872
|
| AF-A0A538EBL0-F1-model_v4 | Uncharacterized protein | 0.98 | 182 | 313 |
|
| AF-A0A7W0APG9-F1-model_v4 | Inositol monophosphatase | 0.9772 | 135 | 315 |
GO:0006020
GO:0007165 GO:0008934 GO:0046854 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar