F451992

General Info

Members Datasets Scaffolds Average Seq Length
479 253 479 304

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10022746|Ga0070658_100227463
Length 325
Sequence VSQADDAPALRALVRELALALRERVKPLLGSHAARAHEEALAVGGDVTFAIDAAAEELLASFLAERAPGVAFFSEDKGLVLPSGDADTVLVVDPIDGTRPALAGFESCCVSVAAAPLRDDVTMGEVSVGCVVEIPAGTVFLAERGHGLVEGPPIRLSRNEQIDRMFWVYGFRGRPVRLYMELLGDLIEASSVGGGSFELGSATFDMTRILTGQLDAYIEPGPRLIEELPETRSEFERVGGGAVLNNTPYDIAAAALCLEEGGATVTDAAGRPLADRPLLGSGPEHQMSVLASANACLHARLLEELDAGMERLAFSLPGAQETESR

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.55
Nodule 0
Rhizoplane 8.14
Rhizosphere 85.18
Stem 0
Stem Tuber 0
Unclassified 3.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000763 3300000549 Bacteria 5103
2 JGI25407J50210_10014949 3300003373 Bacteria 2004
3 Ga0070658_10022746 3300005327 Bacteria 5031
4 Ga0070683_100003147 3300005329 Bacteria 13297
5 Ga0070683_100007131 3300005329 Bacteria 9420
6 Ga0070683_100023952 3300005329 Bacteria 5464
7 Ga0070680_100000746 3300005336 Bacteria 22718
8 Ga0070682_100005793 3300005337 Bacteria 6898
9 Ga0070682_100018093 3300005337 Bacteria 4114
10 Ga0070682_100036480 3300005337 Bacteria 3006
11 Ga0068868_100017477 3300005338 Bacteria 5346
12 Ga0070660_100003054 3300005339 Bacteria 11522
13 Ga0070660_100029345 3300005339 Bacteria 4122
14 Ga0070689_100047314 3300005340 Bacteria 3317
15 Ga0070691_10094760 3300005341 Bacteria 1476
16 Ga0070687_100175449 3300005343 Bacteria 1279
17 Ga0070661_100002426 3300005344 Bacteria 12801
18 Ga0070692_10010178 3300005345 Bacteria 4271
19 Ga0070668_100076596 3300005347 Bacteria 2613
20 Ga0070669_100036162 3300005353 Bacteria 3577
21 Ga0070675_100007308 3300005354 Bacteria 8524
22 Ga0070674_100007998 3300005356 Bacteria 6266
23 Ga0070674_100117809 3300005356 Bacteria 1961
24 Ga0070673_100082743 3300005364 Bacteria 2606
25 Ga0070659_100001090 3300005366 Bacteria 19781
26 Ga0070659_100002893 3300005366 Bacteria 12221
27 Ga0070709_10055483 3300005434 Bacteria 2502
28 Ga0070714_100128800 3300005435 Bacteria 2260
29 Ga0070714_100229396 3300005435 Bacteria 1710
30 Ga0070714_100451365 3300005435 Unclassified 1221
31 Ga0070710_10021825 3300005437 Bacteria 3341
32 Ga0070711_100189224 3300005439 Bacteria 1581
33 Ga0070700_100023899 3300005441 Bacteria 3581
34 Ga0070694_100140040 3300005444 Bacteria 1756
35 Ga0070694_100366487 3300005444 Bacteria 1120
36 Ga0070663_100004596 3300005455 Bacteria 8130
37 Ga0070663_100045019 3300005455 Bacteria 3116
38 Ga0070678_100019173 3300005456 Bacteria 4453
39 Ga0070678_100050724 3300005456 Bacteria 3004
40 Ga0070662_100023799 3300005457 Bacteria 4212
41 Ga0070662_100045263 3300005457 Bacteria 3156
42 Ga0070681_10006683 3300005458 Bacteria 11222
43 Ga0068867_100053837 3300005459 Bacteria 2972
44 Ga0070685_10007278 3300005466 Bacteria 5660
45 Ga0070685_10110662 3300005466 Bacteria 1691
46 Ga0070679_100137325 3300005530 Bacteria 2426
47 Ga0070684_100002911 3300005535 Bacteria 12720
48 Ga0070684_100074784 3300005535 Bacteria 2986
49 Ga0068853_100027027 3300005539 Bacteria 4822
50 Ga0070672_100031367 3300005543 Bacteria 3999
51 Ga0070686_100003109 3300005544 Bacteria 9102
52 Ga0070686_100015940 3300005544 Bacteria 4364
53 Ga0070695_100244222 3300005545 Bacteria 1304
54 Ga0070696_100154857 3300005546 Bacteria 1685
55 Ga0070693_100267408 3300005547 Bacteria 1140
56 Ga0070665_100040848 3300005548 Bacteria 4662
57 Ga0070665_100046252 3300005548 Bacteria 4372
58 Ga0070704_100422515 3300005549 Unclassified 1142
59 Ga0068855_100325820 3300005563 Bacteria 1697
60 Ga0070664_100046551 3300005564 Bacteria 3663
61 Ga0068857_100046736 3300005577 Bacteria 3842
62 Ga0068857_100349386 3300005577 Bacteria 1369
63 Ga0068854_100011272 3300005578 Bacteria 5813
64 Ga0068856_100011634 3300005614 Bacteria 8534
65 Ga0068856_100022543 3300005614 Bacteria 6123
66 Ga0070702_100060790 3300005615 Bacteria 2198
67 Ga0068852_100007252 3300005616 Bacteria 8086
68 Ga0068852_100021655 3300005616 Bacteria 5139
69 Ga0068864_100021815 3300005618 Bacteria 5366
70 Ga0068866_10098978 3300005718 Bacteria 1605
71 Ga0068866_10129249 3300005718 Bacteria 1434
72 Ga0068861_100082651 3300005719 Bacteria 2517
73 Ga0068851_10016271 3300005834 Bacteria 3557
74 Ga0068858_100113316 3300005842 Bacteria 2533
75 Ga0068862_100140895 3300005844 Bacteria 2140
76 Ga0068862_100159159 3300005844 Bacteria 2015
77 Ga0068862_100625153 3300005844 Bacteria 1036
78 Ga0081455_10019231 3300005937 Bacteria 6470
79 Ga0081455_10021221 3300005937 Bacteria 6097
80 Ga0081455_10030297 3300005937 Bacteria 4917
81 Ga0081538_10000032 3300005981 Bacteria 122398
82 Ga0081538_10000328 3300005981 Bacteria 54328
83 Ga0081538_10014065 3300005981 Bacteria 6289
84 Ga0081540_1003253 3300005983 Bacteria 12913
85 Ga0081539_10024221 3300005985 Bacteria 3946
86 Ga0081539_10039540 3300005985 Bacteria 2781
87 Ga0081539_10063210 3300005985 Bacteria 2021
88 Ga0070717_10413641 3300006028 Unclassified 1212
89 Ga0075365_10000195 3300006038 Bacteria 20046
90 Ga0075365_10000715 3300006038 Bacteria 13408
91 Ga0075365_10102365 3300006038 Bacteria 1962
92 Ga0075365_10144947 3300006038 Bacteria 1650
93 Ga0075363_100030262 3300006048 Bacteria 2801
94 Ga0075363_100031896 3300006048 Bacteria 2734
95 Ga0075364_10038632 3300006051 Bacteria 3092
96 Ga0075432_10012798 3300006058 Bacteria 2851
97 Ga0070715_10022938 3300006163 Bacteria 2439
98 Ga0070712_100000965 3300006175 Bacteria 17314
99 Ga0070712_100183582 3300006175 Bacteria 1632
100 Ga0075367_10038159 3300006178 Bacteria 2795
101 Ga0075430_100022950 3300006846 Bacteria 5307
102 Ga0075430_100184258 3300006846 Bacteria 1736
103 Ga0075431_100000134 3300006847 Bacteria 49630
104 Ga0075431_100029164 3300006847 Bacteria 5676
105 Ga0075431_100473894 3300006847 Bacteria 1245
106 Ga0075431_100551338 3300006847 Bacteria 1140
107 Ga0075433_10014385 3300006852 Bacteria 6462
108 Ga0075433_10016522 3300006852 Bacteria 6086
109 Ga0075433_10268044 3300006852 Bacteria 1514
110 Ga0075433_10503494 3300006852 Bacteria 1066
111 Ga0075434_100020844 3300006871 Bacteria 6364
112 Ga0075434_100029805 3300006871 Bacteria 5371
113 Ga0075434_100131565 3300006871 Bacteria 2521
114 Ga0075429_100047513 3300006880 Bacteria 3734
115 Ga0068865_100071520 3300006881 Bacteria 2461
116 Ga0068865_100158116 3300006881 Bacteria 1726
117 Ga0075436_100241070 3300006914 Unclassified 1286
118 Ga0075435_100079288 3300007076 Bacteria 2694
119 Ga0105240_10007232 3300009093 Bacteria 16160
120 Ga0111539_10006052 3300009094 Bacteria 15618
121 Ga0111539_10018405 3300009094 Bacteria 8653
122 Ga0111539_10022248 3300009094 Bacteria 7792
123 Ga0111539_10121198 3300009094 Bacteria 3065
124 Ga0111539_10180512 3300009094 Bacteria 2465
125 Ga0111539_10318926 3300009094 Unclassified 1809
126 Ga0105245_10000568 3300009098 Bacteria 33618
127 Ga0105245_10004565 3300009098 Bacteria 12223
128 Ga0105245_10023300 3300009098 Bacteria 5433
129 Ga0105245_10083666 3300009098 Bacteria 2921
130 Ga0105245_10389318 3300009098 Unclassified 1390
131 Ga0105245_10443690 3300009098 Unclassified 1305
132 Ga0114129_10008915 3300009147 Bacteria 14302
133 Ga0114129_10016660 3300009147 Bacteria 10466
134 Ga0114129_10028828 3300009147 Bacteria 7865
135 Ga0114129_10090132 3300009147 Bacteria 4251
136 Ga0114129_10219282 3300009147 Bacteria 2567
137 Ga0114129_10224782 3300009147 Bacteria 2531
138 Ga0114129_10235616 3300009147 Bacteria 2463
139 Ga0114129_10403204 3300009147 Bacteria 1802
140 Ga0114129_10548223 3300009147 Bacteria 1504
141 Ga0114129_10559828 3300009147 Bacteria 1486
142 Ga0105243_10030151 3300009148 Bacteria 4174
143 Ga0105243_10048548 3300009148 Bacteria 3346
144 Ga0105243_10058925 3300009148 Bacteria 3062
145 Ga0105248_10182749 3300009177 Bacteria 2363
146 Ga0105238_10510390 3300009551 Bacteria 1204
147 Ga0105249_10114451 3300009553 Bacteria 2554
148 Ga0105239_10011169 3300010375 Bacteria 10020
149 Ga0105239_10035393 3300010375 Bacteria 5484
150 Ga0105246_10080375 3300011119 Bacteria 2321
151 Ga0105246_10085183 3300011119 Bacteria 2263
152 Ga0157369_10006254 3300013105 Bacteria 13819
153 Ga0157372_10055368 3300013307 Bacteria 4429
154 Ga0157372_10282866 3300013307 Bacteria 1929
155 Ga0157380_10029133 3300014326 Bacteria 4218
156 Ga0157377_10002386 3300014745 Bacteria 8285
157 Ga0157379_10111633 3300014968 Bacteria 2456
158 Ga0206356_11699020 3300020070 Bacteria 2814
159 Ga0206353_10005236 3300020082 Bacteria 4971
160 Ga0213873_10019725 3300021358 Bacteria 1567
161 Ga0213874_10000028 3300021377 Bacteria 18779
162 Ga0213876_10046527 3300021384 Bacteria 2294
163 Ga0213876_10123472 3300021384 Bacteria 1375
164 Ga0213875_10010469 3300021388 Bacteria 4638
165 Ga0213875_10014052 3300021388 Bacteria 3915
166 Ga0207656_10039377 3300025321 Bacteria 1999
167 Ga0207688_10000324 3300025901 Bacteria 22108
168 Ga0207685_10016091 3300025905 Bacteria 2385
169 Ga0207699_10009612 3300025906 Bacteria 4823
170 Ga0207707_10006326 3300025912 Bacteria 10343
171 Ga0207695_10108674 3300025913 Bacteria 2757
172 Ga0207671_10053017 3300025914 Bacteria 3006
173 Ga0207693_10002542 3300025915 Bacteria 15862
174 Ga0207693_10033390 3300025915 Bacteria 4061
175 Ga0207663_10015832 3300025916 Bacteria 4170
176 Ga0207660_10056411 3300025917 Bacteria 2810
177 Ga0207660_10092712 3300025917 Bacteria 2242
178 Ga0207657_10007520 3300025919 Bacteria 11165
179 Ga0207657_10017263 3300025919 Bacteria 6928
180 Ga0207649_10031425 3300025920 Bacteria 3155
181 Ga0207659_10037620 3300025926 Bacteria 3361
182 Ga0207687_10012462 3300025927 Bacteria 5554
183 Ga0207687_10026290 3300025927 Bacteria 3896
184 Ga0207687_10262095 3300025927 Unclassified 1378
185 Ga0207664_10018369 3300025929 Bacteria 5146
186 Ga0207664_10044217 3300025929 Bacteria 3487
187 Ga0207664_10227280 3300025929 Bacteria 1621
188 Ga0207690_10023007 3300025932 Bacteria 3884
189 Ga0207706_10004968 3300025933 Bacteria 12429
190 Ga0207706_10020079 3300025933 Bacteria 6003
191 Ga0207686_10265934 3300025934 Bacteria 1259
192 Ga0207709_10019569 3300025935 Bacteria 3810
193 Ga0207709_10032663 3300025935 Bacteria 3049
194 Ga0207670_10292307 3300025936 Bacteria 1273
195 Ga0207669_10036597 3300025937 Bacteria 2807
196 Ga0207669_10046796 3300025937 Bacteria 2559
197 Ga0207669_10152628 3300025937 Bacteria 1620
198 Ga0207704_10013520 3300025938 Bacteria 4087
199 Ga0207704_10054295 3300025938 Bacteria 2442
200 Ga0207704_10083400 3300025938 Bacteria 2074
201 Ga0207665_10045124 3300025939 Bacteria 2951
202 Ga0207665_10333509 3300025939 Bacteria 1141
203 Ga0207691_10005161 3300025940 Bacteria 12610
204 Ga0207689_10418040 3300025942 Bacteria 1118
205 Ga0207661_10000599 3300025944 Bacteria 22999
206 Ga0207661_10018558 3300025944 Bacteria 5169
207 Ga0207661_10090583 3300025944 Bacteria 2546
208 Ga0207661_10240681 3300025944 Bacteria 1606
209 Ga0207667_10490407 3300025949 Bacteria 1247
210 Ga0207712_10045539 3300025961 Bacteria 3038
211 Ga0207668_10015795 3300025972 Bacteria 4699
212 Ga0207668_10069372 3300025972 Bacteria 2510
213 Ga0207668_10183935 3300025972 Unclassified 1651
214 Ga0207668_10185390 3300025972 Bacteria 1645
215 Ga0207640_10119692 3300025981 Bacteria 1883
216 Ga0207640_10382703 3300025981 Bacteria 1140
217 Ga0207677_10040769 3300026023 Bacteria 3064
218 Ga0207639_10108784 3300026041 Bacteria 2254
219 Ga0207678_10281740 3300026067 Bacteria 1427
220 Ga0207708_10001190 3300026075 Bacteria 19592
221 Ga0207708_10008095 3300026075 Bacteria 7790
222 Ga0207708_10091077 3300026075 Bacteria 2351
223 Ga0207708_10226348 3300026075 Bacteria 1500
224 Ga0207702_10011747 3300026078 Bacteria 7294
225 Ga0207702_10232242 3300026078 Bacteria 1724
226 Ga0207648_10019050 3300026089 Bacteria 6196
227 Ga0207648_10175360 3300026089 Bacteria 1896
228 Ga0207676_10056867 3300026095 Bacteria 3078
229 Ga0207674_10019972 3300026116 Bacteria 7250
230 Ga0207675_100011049 3300026118 Bacteria 8457
231 Ga0207683_10065771 3300026121 Bacteria 3196
232 Ga0207683_10076626 3300026121 Bacteria 2961
233 Ga0207698_10006744 3300026142 Bacteria 7174
234 Ga0209813_10054201 3300027866 Bacteria 1263
235 Ga0207428_10025079 3300027907 Bacteria 4994
236 Ga0207428_10037179 3300027907 Bacteria 3963
237 Ga0268266_10008906 3300028379 Bacteria 8883
238 Ga0268265_10042771 3300028380 Bacteria 3364
239 Ga0268265_10129032 3300028380 Bacteria 2098
240 Ga0307408_100028879 3300031548 Bacteria 3837
241 Ga0307413_10010947 3300031824 Bacteria 4431
242 Ga0307410_10028588 3300031852 Bacteria 3539
243 Ga0307410_10032424 3300031852 Bacteria 3362
244 Ga0307410_10133270 3300031852 Bacteria 1828
245 Ga0307406_10074725 3300031901 Bacteria 2233
246 Ga0307407_10011376 3300031903 Bacteria 4234
247 Ga0307409_100001709 3300031995 Bacteria 11063
248 Ga0307409_100037506 3300031995 Bacteria 3574
249 Ga0307409_100089011 3300031995 Bacteria 2522
250 Ga0307409_100173147 3300031995 Bacteria 1902
251 Ga0307409_100186175 3300031995 Bacteria 1843
252 Ga0307409_100194127 3300031995 Bacteria 1810
253 Ga0307416_100001189 3300032002 Bacteria 13989
254 Ga0307416_100030131 3300032002 Bacteria 4067
255 Ga0307416_100049733 3300032002 Bacteria 3336
256 Ga0307416_100051892 3300032002 Bacteria 3280
257 Ga0307416_100108008 3300032002 Bacteria 2444
258 Ga0307416_100205720 3300032002 Bacteria 1872
259 Ga0307416_100214911 3300032002 Bacteria 1838
260 Ga0307416_100719971 3300032002 Bacteria 1088
261 Ga0307414_10472814 3300032004 Unclassified 1104
262 Ga0307411_10044303 3300032005 Bacteria 2853
263 Ga0307415_100000762 3300032126 Bacteria 14540
264 Ga0373944_0062896 3300035089 Unclassified 1194
265 Ga0373941_0070209 3300035115 Bacteria 1161
266 Ga0373953_0006334 3300035117 Bacteria 3896
267 Ga0373943_0115042 3300035170 Unclassified 1423
268 Ga0373935_0240557 3300035692 Bacteria 1264
269 Ga0373933_0032116 3300035724 Bacteria 3050
270 Ga0373937_0203235 3300036401 Bacteria 1862
271 Ga0316582_0068980 3300036647 Bacteria 2285
272 Ga0316584_0165169 3300036712 Bacteria 1644
273 Ga0395899_0224525 3300037312 Bacteria 1300
274 Ga0395900_0003110 3300037418 Bacteria 18023
275 Ga0395900_0017887 3300037418 Bacteria 7234
276 Ga0395900_0137379 3300037418 Bacteria 2504
277 Ga0395900_0161398 3300037418 Bacteria 2286
278 Ga0395898_0000333 3300037466 Bacteria 106932
279 Ga0395898_0006309 3300037466 Bacteria 12670
280 Ga0395898_0008821 3300037466 Bacteria 10624
281 Ga0395898_0067020 3300037466 Bacteria 3477
282 Ga0395898_0092458 3300037466 Bacteria 2909
283 Ga0395898_0098958 3300037466 Bacteria 2800
284 Ga0395898_0217949 3300037466 Bacteria 1820
285 Ga0395898_0254662 3300037466 Bacteria 1674
286 Ga0395898_0499737 3300037466 Bacteria 1157
287 Ga0395905_0012790 3300037471 Bacteria 8072
288 Ga0395905_0013085 3300037471 Bacteria 7965
289 Ga0436364_0026519 3300037853 Bacteria 11482
290 Ga0436364_0296398 3300037853 Bacteria 4560
291 Ga0395901_0001875 3300038443 Bacteria 21673
292 Ga0395901_0014926 3300038443 Bacteria 7893
293 Ga0395901_0025808 3300038443 Bacteria 6033
294 Ga0395901_0044481 3300038443 Bacteria 4606
295 Ga0395901_0177226 3300038443 Bacteria 2236
296 Ga0395901_0208573 3300038443 Bacteria 2046
297 Ga0395901_0215949 3300038443 Bacteria 2006
298 Ga0395901_0445878 3300038443 Bacteria 1324
299 Ga0436365_0001544 3300039437 Bacteria 2538
300 Ga0436365_0202901 3300039437 Bacteria 32522
301 Ga0436365_0835713 3300039437 Bacteria 4800
302 Ga0436365_1054951 3300039437 Bacteria 1042
303 Ga0436365_1170100 3300039437 Bacteria 5589
304 Ga0436363_0174915 3300039450 Bacteria 34957
305 Ga0436363_0879407 3300039450 Bacteria 2193
306 Ga0436362_0127759 3300039453 Bacteria 1724
307 Ga0436362_0629257 3300039453 Bacteria 3325
308 Ga0436362_0893815 3300039453 Bacteria 1945
309 Ga0451853_2971813 3300041512 Bacteria 1701
310 Ga0466969_0015689 3300044656 Bacteria 3969
311 Ga0466969_0045911 3300044656 Bacteria 2167
312 Ga0466969_0109304 3300044656 Bacteria 1296
313 Ga0466966_0029296 3300044684 Bacteria 3583
314 Ga0466966_0032474 3300044684 Bacteria 3383
315 Ga0466966_0096191 3300044684 Bacteria 1834
316 Ga0466961_0010987 3300044693 Bacteria 5784
317 Ga0466961_0057378 3300044693 Bacteria 2479
318 Ga0466961_0112703 3300044693 Bacteria 1710
319 Ga0466961_0207553 3300044693 Unclassified 1210
320 Ga0466963_0002027 3300044694 Bacteria 11135
321 Ga0466963_0018303 3300044694 Bacteria 4377
322 Ga0466963_0065451 3300044694 Bacteria 2437
323 Ga0466963_0065899 3300044694 Bacteria 2429
324 Ga0466963_0085800 3300044694 Bacteria 2138
325 Ga0466963_0159774 3300044694 Bacteria 1568
326 Ga0466971_0003879 3300044719 Bacteria 6410
327 Ga0466971_0053992 3300044719 Bacteria 1811
328 Ga0466968_0003224 3300044735 Bacteria 6018
329 Ga0466968_0084239 3300044735 Bacteria 1401
330 Ga0466957_0060023 3300044842 Bacteria 2332
331 Ga0466957_0109844 3300044842 Bacteria 1748
332 Ga0466959_0007413 3300045049 Bacteria 7697
333 Ga0466959_0035092 3300045049 Bacteria 3711
334 Ga0466959_0035185 3300045049 Bacteria 3706
335 Ga0466959_0114311 3300045049 Bacteria 1923
336 Ga0466959_0321148 3300045049 Bacteria 1058
337 Ga0466958_0017843 3300045836 Bacteria 4111
338 Ga0466958_0019762 3300045836 Bacteria 3922
339 Ga0466958_0024387 3300045836 Bacteria 3559
340 Ga0466958_0064993 3300045836 Bacteria 2226
341 Ga0466958_0072687 3300045836 Bacteria 2106
342 Ga0466958_0169102 3300045836 Bacteria 1384
343 Ga0466967_0082269 3300045976 Bacteria 2909
344 Ga0466967_0132062 3300045976 Bacteria 2319
345 Ga0466967_0135502 3300045976 Bacteria 2290
346 Ga0466967_0162016 3300045976 Bacteria 2100
347 Ga0495592_0040180 3300046454 Bacteria 3511
348 Ga0495641_0015311 3300046461 Bacteria 4102
349 Ga0495651_0190689 3300046462 Bacteria 1443
350 Ga0495653_0033954 3300046463 Bacteria 4038
351 Ga0495605_0074479 3300046474 Unclassified 1598
352 Ga0495596_0086110 3300046500 Bacteria 1220
353 Ga0495630_0107516 3300046517 Bacteria 2113
354 Ga0495652_0042428 3300046529 Bacteria 3922
355 Ga0495640_0091325 3300046533 Bacteria 2009
356 Ga0495587_0065356 3300046536 Bacteria 2124
357 Ga0495667_0017231 3300046559 Bacteria 4879
358 Ga0495667_0062412 3300046559 Bacteria 2442
359 Ga0495667_0376950 3300046559 Bacteria 895
360 Ga0495656_0064585 3300046615 Bacteria 1608
361 Ga0495634_0009790 3300046642 Bacteria 7054
362 Ga0495635_0005114 3300046663 Bacteria 9123
363 Ga0495657_0001401 3300046675 Bacteria 20878
364 Ga0495623_0218456 3300046679 Unclassified 1087
365 Ga0495647_0045199 3300046681 Bacteria 1691
366 Ga0495658_0220604 3300046683 Unclassified 1187
367 Ga0495589_0105489 3300046794 Unclassified 1362
368 Ga0495600_0046112 3300046809 Bacteria 2844
369 Ga0495581_0086101 3300047315 Bacteria 1822
370 Ga0495604_0006700 3300047317 Bacteria 9131
371 Ga0495674_0013820 3300047319 Bacteria 7578
372 Ga0495676_0036082 3300047321 Bacteria 4131
373 Ga0495680_0023484 3300047322 Bacteria 5126
374 Ga0495684_0031992 3300047471 Bacteria 4038
375 Ga0495602_0032804 3300048088 Bacteria 4884
376 Ga0496101_0001347 3300048904 Bacteria 14717
377 Ga0496101_0223819 3300048904 Unclassified 1461
378 Ga0496103_0002108 3300048906 Bacteria 12676
379 Ga0496104_0022477 3300048907 Bacteria 5794
380 Ga0496104_0179840 3300048907 Unclassified 2025
381 Ga0496105_0053235 3300048908 Bacteria 3342
382 Ga0496105_0223099 3300048908 Unclassified 1534
383 Ga0496105_0317033 3300048908 Bacteria 1250
384 Ga0496106_0003436 3300048909 Bacteria 11798
385 Ga0496106_0026793 3300048909 Bacteria 4293
386 Ga0496106_0059586 3300048909 Unclassified 2892
387 Ga0496106_0154342 3300048909 Bacteria 1812
388 Ga0496107_0031582 3300048910 Bacteria 3781
389 Ga0496108_0002794 3300048911 Bacteria 13992
390 Ga0496108_0048673 3300048911 Bacteria 3544
391 Ga0496108_0517030 3300048911 Unclassified 1042
392 Ga0496109_0081661 3300048912 Bacteria 2979
393 Ga0496109_0090369 3300048912 Bacteria 2832
394 Ga0496109_0091050 3300048912 Bacteria 2821
395 Ga0496109_0138710 3300048912 Bacteria 2273
396 Ga0496109_0293337 3300048912 Bacteria 1533
397 Ga0496109_0300438 3300048912 Bacteria 1514
398 Ga0496110_0039954 3300048913 Bacteria 4088
399 Ga0496110_0047489 3300048913 Bacteria 3760
400 Ga0496110_0110556 3300048913 Bacteria 2469
401 Ga0496110_0119319 3300048913 Bacteria 2375
402 Ga0496110_0298756 3300048913 Bacteria 1467
403 Ga0496110_0371459 3300048913 Unclassified 1303
404 Ga0496111_0010125 3300048914 Bacteria 6312
405 Ga0496111_0067335 3300048914 Bacteria 2601
406 Ga0496111_0274310 3300048914 Unclassified 1251
407 Ga0496112_0000621 3300048915 Bacteria 24571
408 Ga0496112_0013035 3300048915 Bacteria 7667
409 Ga0496113_0027464 3300048916 Bacteria 4081
410 Ga0496113_0055917 3300048916 Bacteria 2960
411 Ga0496114_0010013 3300048917 Bacteria 7537
412 Ga0496114_0070279 3300048917 Bacteria 2940
413 Ga0496115_0022578 3300048918 Bacteria 4877
414 Ga0496115_0211152 3300048918 Bacteria 1603
415 Ga0501033_0382540 3300049570 Bacteria 983
416 Ga0501036_0205600 3300049572 Bacteria 1655
417 Ga0501039_0011390 3300049575 Bacteria 6772
418 Ga0501041_0106943 3300049577 Bacteria 1734
419 Ga0501048_0188371 3300049582 Bacteria 1462
420 Ga0501067_0036526 3300049583 Bacteria 2728
421 Ga0501068_0180582 3300049584 Bacteria 1334
422 Ga0501069_0065498 3300049585 Bacteria 2032
423 Ga0501070_0029251 3300049586 Bacteria 4621
424 Ga0501070_0051769 3300049586 Bacteria 3407
425 Ga0501071_0132296 3300049587 Bacteria 1854
426 Ga0501071_0133903 3300049587 Bacteria 1843
427 Ga0501071_0233141 3300049587 Bacteria 1387
428 Ga0501072_0001858 3300049588 Bacteria 15729
429 Ga0501072_0202586 3300049588 Bacteria 1582
430 Ga0501073_0224328 3300049589 Bacteria 1298
431 Ga0501076_0019619 3300049592 Bacteria 5169
432 Ga0501076_0102659 3300049592 Bacteria 2306
433 Ga0501076_0454915 3300049592 Bacteria 1054
434 Ga0501079_0069424 3300049741 Bacteria 2720
435 Ga0501079_0180322 3300049741 Bacteria 1648
436 Ga0501079_0232041 3300049741 Bacteria 1441
437 Ga0501081_0031012 3300049743 Bacteria 3622
438 Ga0501081_0219387 3300049743 Bacteria 1383
439 Ga0501045_0015114 3300049824 Bacteria 5480
440 nmdc:mga03n38_38422_c1 3300050490 Bacteria 2070
441 nmdc:mga00v17_11539_c1 3300050491 Bacteria 4858
442 nmdc:mga00v17_77470_c1 3300050491 Bacteria 2070
443 nmdc:mga0yw44_11124_c1 3300050492 Bacteria 4627
444 nmdc:mga0yw44_164927_c1 3300050492 Bacteria 1452
445 nmdc:mga0yw44_1754_c1 3300050492 Bacteria 8835
446 nmdc:mga0yw44_54170_c1 3300050492 Bacteria 2437
447 nmdc:mga06z11_119695_c1 3300050494 Bacteria 1467
448 nmdc:mga05p37_15267_c1 3300050507 Bacteria 9225
449 nmdc:mga05p37_235166_c1 3300050507 Bacteria 2206
450 nmdc:mga05p37_250336_c1 3300050507 Bacteria 2125
451 nmdc:mga05p37_36443_c1 3300050507 Bacteria 6035
452 nmdc:mga05p37_393404_c1 3300050507 Bacteria 1620
453 nmdc:mga05p37_48821_c1 3300050507 Bacteria 5204
454 nmdc:mga05p37_535739_c1 3300050507 Bacteria 1336
455 nmdc:mga09592_18783_c1 3300050508 Bacteria 5671
456 nmdc:mga0qj67_62035_c1 3300050509 Bacteria 2970
457 nmdc:mga06r32_207098_c1 3300050510 Bacteria 1949
458 nmdc:mga06r32_7879_c1 3300050510 Bacteria 9574
459 nmdc:mga08y16_31389_c1 3300050511 Bacteria 5587
460 nmdc:mga08y16_355554_c1 3300050511 Bacteria 1504
461 nmdc:mga08y16_35990_c1 3300050511 Bacteria 5199
462 nmdc:mga08y16_36428_c1 3300050511 Bacteria 5167
463 nmdc:mga08y16_425750_c1 3300050511 Unclassified 1356
464 nmdc:mga08y16_58989_c1 3300050511 Bacteria 4010
465 nmdc:mga08y16_595257_c1 3300050511 Unclassified 1115
466 nmdc:mga0n895_27595_c1 3300050512 Bacteria 5396
467 nmdc:mga0n895_358061_c1 3300050512 Bacteria 1478
468 nmdc:mga0a205_242805_c1 3300050515 Bacteria 1682
469 nmdc:mga0a205_71664_c1 3300050515 Bacteria 3347
470 Ga0495601_0080809 3300053077 Bacteria 2086
471 Ga0495595_0012429 3300053084 Bacteria 3579
472 Ga0501084_0014174 3300054114 Bacteria 6600
473 Ga0501084_0108751 3300054114 Bacteria 2329
474 Ga0501084_0213286 3300054114 Bacteria 1629
475 Ga0501082_0313680 3300060353 Bacteria 1366
476 Ga0466962_0138202 3300061719 Bacteria 1179
477 Ga0530510_0005939 3300061734 Bacteria 8466
478 Ga0530510_0132443 3300061734 Bacteria 1835
479 Ga0530510_0167919 3300061734 Bacteria 1625

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0072687 Ga0466958_0072687_38_742 226
2 3300061734 Ga0530510_0167919 Ga0530510_0167919_826_1608 244
3 3300021388 Ga0213875_10014052 Ga0213875_100140523 252
4 3300006038 Ga0075365_10144947 Ga0075365_101449472 254
5 3300021358 Ga0213873_10019725 Ga0213873_100197252 255
6 3300044693 Ga0466961_0207553 Ga0466961_0207553_352_1167 256
7 3300045836 Ga0466958_0019762 Ga0466958_0019762_3053_3898 256
8 3300039453 Ga0436362_0893815 Ga0436362_0893815_128_1087 258
9 3300045049 Ga0466959_0321148 Ga0466959_0321148_228_1031 260
10 3300027866 Ga0209813_10054201 Ga0209813_100542012 263
11 3300035089 Ga0373944_0062896 Ga0373944_0062896_63_875 264
12 3300049577 Ga0501041_0106943 Ga0501041_0106943_61_888 266
13 3300049592 Ga0501076_0454915 Ga0501076_0454915_190_1017 266
14 3300005435 Ga0070714_100229396 Ga0070714_1002293962 268
15 3300025929 Ga0207664_10044217 Ga0207664_100442173 268
16 3300039450 Ga0436363_0879407 Ga0436363_0879407_551_1495 268
17 3300048913 Ga0496110_0371459 Ga0496110_0371459_14_856 268
18 3300037418 Ga0395900_0017887 Ga0395900_0017887_3443_4393 272
19 3300037466 Ga0395898_0006309 Ga0395898_0006309_3313_4263 272
20 3300037471 Ga0395905_0012790 Ga0395905_0012790_3920_4870 272
21 3300038443 Ga0395901_0001875 Ga0395901_0001875_3937_4887 272
22 3300044656 Ga0466969_0045911 Ga0466969_0045911_515_1441 274
23 3300044693 Ga0466961_0112703 Ga0466961_0112703_488_1414 274
24 3300044694 Ga0466963_0002027 Ga0466963_0002027_302_1228 274
25 3300044719 Ga0466971_0053992 Ga0466971_0053992_178_1104 274
26 3300044842 Ga0466957_0109844 Ga0466957_0109844_334_1260 274
27 3300039437 Ga0436365_1170100 Ga0436365_1170100_589_1425 275
28 3300044693 Ga0466961_0057378 Ga0466961_0057378_521_1474 275
29 3300045976 Ga0466967_0135502 Ga0466967_0135502_573_1520 275
30 3300046462 Ga0495651_0190689 Ga0495651_0190689_435_1346 275
31 3300046559 Ga0495667_0062412 Ga0495667_0062412_1057_1968 275
32 3300046559 Ga0495667_0376950 Ga0495667_0376950_43_882 275
33 3300046683 Ga0495658_0220604 Ga0495658_0220604_156_1067 275
34 3300044735 Ga0466968_0084239 Ga0466968_0084239_301_1239 276
35 3300025916 Ga0207663_10015832 Ga0207663_100158324 277
36 3300025939 Ga0207665_10045124 Ga0207665_100451242 277
37 3300048904 Ga0496101_0223819 Ga0496101_0223819_407_1360 277
38 3300048907 Ga0496104_0179840 Ga0496104_0179840_16_969 277
39 3300048908 Ga0496105_0223099 Ga0496105_0223099_523_1476 277
40 3300048911 Ga0496108_0048673 Ga0496108_0048673_2489_3442 277
41 3300048913 Ga0496110_0039954 Ga0496110_0039954_3195_4061 277
42 3300048913 Ga0496110_0110556 Ga0496110_0110556_913_1866 277
43 3300050494 nmdc:mga06z11_119695_c1 nmdc:mga06z11_119695_c1_257_1234 277
44 3300025939 Ga0207665_10333509 Ga0207665_103335092 278
45 3300037853 Ga0436364_0026519 Ga0436364_0026519_4497_5423 278
46 3300045049 Ga0466959_0114311 Ga0466959_0114311_748_1662 278
47 3300054114 Ga0501084_0213286 Ga0501084_0213286_291_1229 278
48 3300048907 Ga0496104_0022477 Ga0496104_0022477_459_1412 279
49 3300048918 Ga0496115_0211152 Ga0496115_0211152_492_1445 279
50 3300049586 Ga0501070_0051769 Ga0501070_0051769_677_1624 279
51 3300049588 Ga0501072_0202586 Ga0501072_0202586_94_1041 279
52 3300025929 Ga0207664_10018369 Ga0207664_100183693 280
53 3300039437 Ga0436365_0202901 Ga0436365_0202901_27497_28435 280
54 3300049583 Ga0501067_0036526 Ga0501067_0036526_576_1520 280
55 3300049584 Ga0501068_0180582 Ga0501068_0180582_302_1246 280
56 3300049585 Ga0501069_0065498 Ga0501069_0065498_285_1226 280
57 3300049586 Ga0501070_0029251 Ga0501070_0029251_274_1218 280
58 3300049589 Ga0501073_0224328 Ga0501073_0224328_316_1257 280
59 3300005434 Ga0070709_10055483 Ga0070709_100554833 281
60 3300005435 Ga0070714_100451365 Ga0070714_1004513651 281
61 3300005437 Ga0070710_10021825 Ga0070710_100218252 281
62 3300005439 Ga0070711_100189224 Ga0070711_1001892242 281
63 3300035117 Ga0373953_0006334 Ga0373953_0006334_368_1321 281
64 3300035692 Ga0373935_0240557 Ga0373935_0240557_33_986 281
65 3300035724 Ga0373933_0032116 Ga0373933_0032116_1819_2772 281
66 3300036401 Ga0373937_0203235 Ga0373937_0203235_709_1662 281
67 3300044735 Ga0466968_0003224 Ga0466968_0003224_5033_5947 281
68 3300046454 Ga0495592_0040180 Ga0495592_0040180_288_1241 281
69 3300046463 Ga0495653_0033954 Ga0495653_0033954_249_1202 281
70 3300046529 Ga0495652_0042428 Ga0495652_0042428_2782_3735 281
71 3300046533 Ga0495640_0091325 Ga0495640_0091325_156_1109 281
72 3300046536 Ga0495587_0065356 Ga0495587_0065356_40_993 281
73 3300046559 Ga0495667_0017231 Ga0495667_0017231_2458_3411 281
74 3300046642 Ga0495634_0009790 Ga0495634_0009790_2912_3865 281
75 3300046663 Ga0495635_0005114 Ga0495635_0005114_2872_3825 281
76 3300046675 Ga0495657_0001401 Ga0495657_0001401_3215_4168 281
77 3300046679 Ga0495623_0218456 Ga0495623_0218456_24_977 281
78 3300046809 Ga0495600_0046112 Ga0495600_0046112_215_1168 281
79 3300047317 Ga0495604_0006700 Ga0495604_0006700_2830_3783 281
80 3300047319 Ga0495674_0013820 Ga0495674_0013820_3389_4342 281
81 3300047322 Ga0495680_0023484 Ga0495680_0023484_1678_2631 281
82 3300047471 Ga0495684_0031992 Ga0495684_0031992_2983_3936 281
83 3300048088 Ga0495602_0032804 Ga0495602_0032804_2464_3417 281
84 3300048909 Ga0496106_0154342 Ga0496106_0154342_104_1033 281
85 3300048911 Ga0496108_0517030 Ga0496108_0517030_50_1003 281
86 3300048912 Ga0496109_0090369 Ga0496109_0090369_935_1864 281
87 3300048912 Ga0496109_0293337 Ga0496109_0293337_376_1329 281
88 3300048914 Ga0496111_0010125 Ga0496111_0010125_892_1821 281
89 3300048915 Ga0496112_0000621 Ga0496112_0000621_23225_24178 281
90 3300048916 Ga0496113_0027464 Ga0496113_0027464_1423_2376 281
91 3300053077 Ga0495601_0080809 Ga0495601_0080809_1048_2001 281
92 3300053084 Ga0495595_0012429 Ga0495595_0012429_185_1138 281
93 3300005435 Ga0070714_100128800 Ga0070714_1001288003 282
94 3300006028 Ga0070717_10413641 Ga0070717_104136412 282
95 3300025929 Ga0207664_10227280 Ga0207664_102272802 282
96 3300039437 Ga0436365_1054951 Ga0436365_1054951_115_1032 282
97 3300045049 Ga0466959_0035092 Ga0466959_0035092_1118_2056 282
98 3300026089 Ga0207648_10175360 Ga0207648_101753601 283
99 3300039453 Ga0436362_0127759 Ga0436362_0127759_278_1198 283
100 3300039453 Ga0436362_0629257 Ga0436362_0629257_1882_2778 283
101 3300005981 Ga0081538_10000328 Ga0081538_1000032818 284
102 3300037466 Ga0395898_0092458 Ga0395898_0092458_1040_1990 284
103 3300038443 Ga0395901_0445878 Ga0395901_0445878_54_1004 284
104 3300044656 Ga0466969_0015689 Ga0466969_0015689_1545_2498 284
105 3300045049 Ga0466959_0035185 Ga0466959_0035185_2087_3040 284
106 3300050507 nmdc:mga05p37_393404_c1 nmdc:mga05p37_393404_c1_488_1480 284
107 3300006175 Ga0070712_100000965 Ga0070712_10000096514 286
108 3300025906 Ga0207699_10009612 Ga0207699_100096125 286
109 3300025915 Ga0207693_10002542 Ga0207693_100025423 286
110 3300036647 Ga0316582_0068980 Ga0316582_0068980_1398_2273 287
111 3300036712 Ga0316584_0165169 Ga0316584_0165169_120_995 287
112 3300049587 Ga0501071_0133903 Ga0501071_0133903_19_936 287
113 3300049741 Ga0501079_0069424 Ga0501079_0069424_730_1620 287
114 3300061734 Ga0530510_0132443 Ga0530510_0132443_854_1771 287
115 3300025981 Ga0207640_10382703 Ga0207640_103827031 289
116 3300005356 Ga0070674_100117809 Ga0070674_1001178091 290
117 3300044684 Ga0466966_0032474 Ga0466966_0032474_1974_2921 290
118 3300044694 Ga0466963_0085800 Ga0466963_0085800_1030_1977 290
119 3300044719 Ga0466971_0003879 Ga0466971_0003879_5434_6381 290
120 3300048912 Ga0496109_0081661 Ga0496109_0081661_892_1830 290
121 3300005329 Ga0070683_100023952 Ga0070683_1000239522 291
122 3300005337 Ga0070682_100005793 Ga0070682_1000057933 291
123 3300005338 Ga0068868_100017477 Ga0068868_1000174777 291
124 3300005339 Ga0070660_100003054 Ga0070660_10000305412 291
125 3300005340 Ga0070689_100047314 Ga0070689_1000473142 291
126 3300005345 Ga0070692_10010178 Ga0070692_100101783 291
127 3300005353 Ga0070669_100036162 Ga0070669_1000361622 291
128 3300005354 Ga0070675_100007308 Ga0070675_1000073089 291
129 3300005364 Ga0070673_100082743 Ga0070673_1000827432 291
130 3300005366 Ga0070659_100002893 Ga0070659_1000028932 291
131 3300005441 Ga0070700_100023899 Ga0070700_1000238992 291
132 3300005455 Ga0070663_100004596 Ga0070663_1000045962 291
133 3300005457 Ga0070662_100023799 Ga0070662_1000237993 291
134 3300005459 Ga0068867_100053837 Ga0068867_1000538372 291
135 3300005466 Ga0070685_10007278 Ga0070685_100072785 291
136 3300005539 Ga0068853_100027027 Ga0068853_1000270272 291
137 3300005543 Ga0070672_100031367 Ga0070672_1000313672 291
138 3300005544 Ga0070686_100003109 Ga0070686_1000031094 291
139 3300005564 Ga0070664_100046551 Ga0070664_1000465513 291
140 3300005578 Ga0068854_100011272 Ga0068854_1000112723 291
141 3300005616 Ga0068852_100021655 Ga0068852_1000216552 291
142 3300005718 Ga0068866_10129249 Ga0068866_101292492 291
143 3300005719 Ga0068861_100082651 Ga0068861_1000826512 291
144 3300005834 Ga0068851_10016271 Ga0068851_100162711 291
145 3300005842 Ga0068858_100113316 Ga0068858_1001133162 291
146 3300005844 Ga0068862_100159159 Ga0068862_1001591592 291
147 3300006048 Ga0075363_100031896 Ga0075363_1000318962 291
148 3300006852 Ga0075433_10016522 Ga0075433_100165223 291
149 3300009094 Ga0111539_10121198 Ga0111539_101211982 291
150 3300009098 Ga0105245_10004565 Ga0105245_100045657 291
151 3300009148 Ga0105243_10030151 Ga0105243_100301513 291
152 3300010375 Ga0105239_10011169 Ga0105239_100111696 291
153 3300013307 Ga0157372_10282866 Ga0157372_102828662 291
154 3300014326 Ga0157380_10029133 Ga0157380_100291333 291
155 3300014968 Ga0157379_10111633 Ga0157379_101116332 291
156 3300025321 Ga0207656_10039377 Ga0207656_100393772 291
157 3300025919 Ga0207657_10017263 Ga0207657_100172635 291
158 3300025920 Ga0207649_10031425 Ga0207649_100314252 291
159 3300025926 Ga0207659_10037620 Ga0207659_100376202 291
160 3300025927 Ga0207687_10026290 Ga0207687_100262902 291
161 3300025932 Ga0207690_10023007 Ga0207690_100230072 291
162 3300025933 Ga0207706_10004968 Ga0207706_1000496812 291
163 3300025935 Ga0207709_10019569 Ga0207709_100195693 291
164 3300025936 Ga0207670_10292307 Ga0207670_102923071 291
165 3300025937 Ga0207669_10152628 Ga0207669_101526282 291
166 3300025938 Ga0207704_10013520 Ga0207704_100135202 291
167 3300025940 Ga0207691_10005161 Ga0207691_1000516111 291
168 3300025944 Ga0207661_10090583 Ga0207661_100905831 291
169 3300025981 Ga0207640_10119692 Ga0207640_101196922 291
170 3300026023 Ga0207677_10040769 Ga0207677_100407692 291
171 3300026041 Ga0207639_10108784 Ga0207639_101087842 291
172 3300026075 Ga0207708_10008095 Ga0207708_100080956 291
173 3300026089 Ga0207648_10019050 Ga0207648_100190501 291
174 3300026118 Ga0207675_100011049 Ga0207675_1000110492 291
175 3300026142 Ga0207698_10006744 Ga0207698_100067442 291
176 3300028380 Ga0268265_10042771 Ga0268265_100427712 291
177 3300048909 Ga0496106_0026793 Ga0496106_0026793_634_1572 291
178 3300048909 Ga0496106_0059586 Ga0496106_0059586_166_1113 291
179 3300048910 Ga0496107_0031582 Ga0496107_0031582_1213_2151 291
180 3300048911 Ga0496108_0002794 Ga0496108_0002794_9371_10309 291
181 3300048913 Ga0496110_0047489 Ga0496110_0047489_1902_2840 291
182 3300050490 nmdc:mga03n38_38422_c1 nmdc:mga03n38_38422_c1_756_1694 291
183 3300050492 nmdc:mga0yw44_54170_c1 nmdc:mga0yw44_54170_c1_1303_2241 291
184 3300050511 nmdc:mga08y16_36428_c1 nmdc:mga08y16_36428_c1_2616_3554 291
185 3300050515 nmdc:mga0a205_71664_c1 nmdc:mga0a205_71664_c1_56_1003 291
186 3300049587 Ga0501071_0132296 Ga0501071_0132296_128_1072 292
187 3300054114 Ga0501084_0108751 Ga0501084_0108751_298_1242 292
188 3300006058 Ga0075432_10012798 Ga0075432_100127982 293
189 3300009094 Ga0111539_10006052 Ga0111539_100060524 293
190 3300027907 Ga0207428_10025079 Ga0207428_100250793 293
191 3300035115 Ga0373941_0070209 Ga0373941_0070209_180_1097 293
192 3300037466 Ga0395898_0098958 Ga0395898_0098958_553_1473 293
193 3300038443 Ga0395901_0215949 Ga0395901_0215949_571_1491 293
194 3300050511 nmdc:mga08y16_31389_c1 nmdc:mga08y16_31389_c1_2409_3326 293
195 3300031995 Ga0307409_100194127 Ga0307409_1001941272 294
196 3300032002 Ga0307416_100108008 Ga0307416_1001080083 294
197 3300005455 Ga0070663_100045019 Ga0070663_1000450193 295
198 3300005457 Ga0070662_100045263 Ga0070662_1000452632 295
199 3300005466 Ga0070685_10110662 Ga0070685_101106622 295
200 3300005535 Ga0070684_100002911 Ga0070684_1000029113 295
201 3300005548 Ga0070665_100046252 Ga0070665_1000462522 295
202 3300005563 Ga0068855_100325820 Ga0068855_1003258202 295
203 3300005577 Ga0068857_100349386 Ga0068857_1003493862 295
204 3300005615 Ga0070702_100060790 Ga0070702_1000607902 295
205 3300005618 Ga0068864_100021815 Ga0068864_1000218155 295
206 3300005844 Ga0068862_100140895 Ga0068862_1001408952 295
207 3300006175 Ga0070712_100183582 Ga0070712_1001835822 295
208 3300006881 Ga0068865_100158116 Ga0068865_1001581162 295
209 3300025901 Ga0207688_10000324 Ga0207688_1000032413 295
210 3300025915 Ga0207693_10033390 Ga0207693_100333903 295
211 3300025933 Ga0207706_10020079 Ga0207706_100200795 295
212 3300025938 Ga0207704_10083400 Ga0207704_100834002 295
213 3300025942 Ga0207689_10418040 Ga0207689_104180402 295
214 3300025949 Ga0207667_10490407 Ga0207667_104904071 295
215 3300026075 Ga0207708_10001190 Ga0207708_1000119020 295
216 3300026078 Ga0207702_10232242 Ga0207702_102322422 295
217 3300026095 Ga0207676_10056867 Ga0207676_100568672 295
218 3300028380 Ga0268265_10129032 Ga0268265_101290322 295
219 3300048908 Ga0496105_0317033 Ga0496105_0317033_261_1202 295
220 3300048915 Ga0496112_0013035 Ga0496112_0013035_5865_6806 295
221 3300048917 Ga0496114_0070279 Ga0496114_0070279_1356_2297 295
222 3300005545 Ga0070695_100244222 Ga0070695_1002442221 296
223 3300005549 Ga0070704_100422515 Ga0070704_1004225151 296
224 3300006847 Ga0075431_100029164 Ga0075431_1000291645 296
225 3300006852 Ga0075433_10503494 Ga0075433_105034942 296
226 3300006871 Ga0075434_100131565 Ga0075434_1001315652 296
227 3300009094 Ga0111539_10018405 Ga0111539_100184056 296
228 3300009094 Ga0111539_10022248 Ga0111539_100222484 296
229 3300009147 Ga0114129_10008915 Ga0114129_1000891515 296
230 3300009147 Ga0114129_10090132 Ga0114129_100901324 296
231 3300009147 Ga0114129_10219282 Ga0114129_102192822 296
232 3300027907 Ga0207428_10037179 Ga0207428_100371794 296
233 3300031852 Ga0307410_10028588 Ga0307410_100285882 296
234 3300031995 Ga0307409_100001709 Ga0307409_10000170911 296
235 3300032002 Ga0307416_100001189 Ga0307416_1000011899 296
236 3300032005 Ga0307411_10044303 Ga0307411_100443032 296
237 3300032126 Ga0307415_100000762 Ga0307415_1000007629 296
238 3300050507 nmdc:mga05p37_250336_c1 nmdc:mga05p37_250336_c1_779_1720 296
239 3300050507 nmdc:mga05p37_36443_c1 nmdc:mga05p37_36443_c1_1049_1948 296
240 3300050507 nmdc:mga05p37_48821_c1 nmdc:mga05p37_48821_c1_3080_4018 296
241 3300050511 nmdc:mga08y16_35990_c1 nmdc:mga08y16_35990_c1_1137_2036 296
242 3300050511 nmdc:mga08y16_425750_c1 nmdc:mga08y16_425750_c1_374_1273 296
243 3300050511 nmdc:mga08y16_58989_c1 nmdc:mga08y16_58989_c1_696_1637 296
244 3300050512 nmdc:mga0n895_358061_c1 nmdc:mga0n895_358061_c1_301_1242 296
245 3300049570 Ga0501033_0382540 Ga0501033_0382540_44_955 297
246 3300049575 Ga0501039_0011390 Ga0501039_0011390_29_940 297
247 3300025961 Ga0207712_10045539 Ga0207712_100455393 298
248 3300025972 Ga0207668_10183935 Ga0207668_101839352 298
249 3300046517 Ga0495630_0107516 Ga0495630_0107516_963_1883 298
250 3300035170 Ga0373943_0115042 Ga0373943_0115042_119_1042 300
251 3300005937 Ga0081455_10030297 Ga0081455_100302974 301
252 3300005985 Ga0081539_10039540 Ga0081539_100395403 301
253 3300005985 Ga0081539_10063210 Ga0081539_100632102 301
254 3300006846 Ga0075430_100022950 Ga0075430_1000229503 301
255 3300006847 Ga0075431_100473894 Ga0075431_1004738942 301
256 3300006847 Ga0075431_100551338 Ga0075431_1005513382 301
257 3300006880 Ga0075429_100047513 Ga0075429_1000475131 301
258 3300021384 Ga0213876_10123472 Ga0213876_101234722 301
259 3300050508 nmdc:mga09592_18783_c1 nmdc:mga09592_18783_c1_1453_2397 301
260 3300050509 nmdc:mga0qj67_62035_c1 nmdc:mga0qj67_62035_c1_226_1170 301
261 3300003373 JGI25407J50210_10014949 JGI25407J50210_100149492 302
262 3300005337 Ga0070682_100036480 Ga0070682_1000364803 302
263 3300005341 Ga0070691_10094760 Ga0070691_100947602 302
264 3300005343 Ga0070687_100175449 Ga0070687_1001754492 302
265 3300005347 Ga0070668_100076596 Ga0070668_1000765962 302
266 3300005444 Ga0070694_100140040 Ga0070694_1001400402 302
267 3300005456 Ga0070678_100019173 Ga0070678_1000191732 302
268 3300005456 Ga0070678_100050724 Ga0070678_1000507242 302
269 3300005544 Ga0070686_100015940 Ga0070686_1000159402 302
270 3300005546 Ga0070696_100154857 Ga0070696_1001548572 302
271 3300005937 Ga0081455_10019231 Ga0081455_100192312 302
272 3300005981 Ga0081538_10000032 Ga0081538_10000032117 302
273 3300005981 Ga0081538_10014065 Ga0081538_100140655 302
274 3300006038 Ga0075365_10000195 Ga0075365_1000019510 302
275 3300006038 Ga0075365_10000715 Ga0075365_100007155 302
276 3300006051 Ga0075364_10038632 Ga0075364_100386322 302
277 3300006163 Ga0070715_10022938 Ga0070715_100229382 302
278 3300006847 Ga0075431_100000134 Ga0075431_10000013452 302
279 3300006852 Ga0075433_10268044 Ga0075433_102680442 302
280 3300006871 Ga0075434_100029805 Ga0075434_1000298052 302
281 3300006881 Ga0068865_100071520 Ga0068865_1000715202 302
282 3300009094 Ga0111539_10318926 Ga0111539_103189262 302
283 3300009098 Ga0105245_10023300 Ga0105245_100233005 302
284 3300009147 Ga0114129_10016660 Ga0114129_100166606 302
285 3300009147 Ga0114129_10028828 Ga0114129_100288284 302
286 3300009147 Ga0114129_10403204 Ga0114129_104032042 302
287 3300009148 Ga0105243_10058925 Ga0105243_100589253 302
288 3300009177 Ga0105248_10182749 Ga0105248_101827493 302
289 3300009553 Ga0105249_10114451 Ga0105249_101144512 302
290 3300010375 Ga0105239_10035393 Ga0105239_100353936 302
291 3300011119 Ga0105246_10080375 Ga0105246_100803752 302
292 3300011119 Ga0105246_10085183 Ga0105246_100851832 302
293 3300014745 Ga0157377_10002386 Ga0157377_100023862 302
294 3300025905 Ga0207685_10016091 Ga0207685_100160912 302
295 3300025917 Ga0207660_10056411 Ga0207660_100564112 302
296 3300025927 Ga0207687_10012462 Ga0207687_100124625 302
297 3300025935 Ga0207709_10032663 Ga0207709_100326633 302
298 3300025937 Ga0207669_10046796 Ga0207669_100467962 302
299 3300025938 Ga0207704_10054295 Ga0207704_100542952 302
300 3300025972 Ga0207668_10185390 Ga0207668_101853902 302
301 3300026121 Ga0207683_10065771 Ga0207683_100657712 302
302 3300026121 Ga0207683_10076626 Ga0207683_100766262 302
303 3300031852 Ga0307410_10032424 Ga0307410_100324242 302
304 3300031995 Ga0307409_100089011 Ga0307409_1000890111 302
305 3300032002 Ga0307416_100051892 Ga0307416_1000518922 302
306 3300037418 Ga0395900_0137379 Ga0395900_0137379_1184_2131 302
307 3300037418 Ga0395900_0161398 Ga0395900_0161398_1336_2271 302
308 3300037466 Ga0395898_0008821 Ga0395898_0008821_3893_4840 302
309 3300037466 Ga0395898_0499737 Ga0395898_0499737_18_953 302
310 3300037471 Ga0395905_0013085 Ga0395905_0013085_4118_5065 302
311 3300038443 Ga0395901_0014926 Ga0395901_0014926_4380_5327 302
312 3300038443 Ga0395901_0044481 Ga0395901_0044481_2586_3515 302
313 3300038443 Ga0395901_0208573 Ga0395901_0208573_558_1493 302
314 3300044684 Ga0466966_0029296 Ga0466966_0029296_800_1729 302
315 3300044694 Ga0466963_0018303 Ga0466963_0018303_2735_3667 302
316 3300044694 Ga0466963_0065899 Ga0466963_0065899_1153_2085 302
317 3300044694 Ga0466963_0159774 Ga0466963_0159774_137_1069 302
318 3300044842 Ga0466957_0060023 Ga0466957_0060023_1044_1973 302
319 3300045836 Ga0466958_0024387 Ga0466958_0024387_663_1595 302
320 3300045836 Ga0466958_0064993 Ga0466958_0064993_316_1254 302
321 3300045836 Ga0466958_0169102 Ga0466958_0169102_41_973 302
322 3300045976 Ga0466967_0082269 Ga0466967_0082269_822_1754 302
323 3300045976 Ga0466967_0132062 Ga0466967_0132062_256_1176 302
324 3300045976 Ga0466967_0162016 Ga0466967_0162016_176_1108 302
325 3300046461 Ga0495641_0015311 Ga0495641_0015311_1695_2624 302
326 3300046681 Ga0495647_0045199 Ga0495647_0045199_727_1656 302
327 3300047315 Ga0495581_0086101 Ga0495581_0086101_758_1687 302
328 3300047321 Ga0495676_0036082 Ga0495676_0036082_695_1624 302
329 3300048904 Ga0496101_0001347 Ga0496101_0001347_8742_9671 302
330 3300048906 Ga0496103_0002108 Ga0496103_0002108_3122_4051 302
331 3300048908 Ga0496105_0053235 Ga0496105_0053235_185_1114 302
332 3300048909 Ga0496106_0003436 Ga0496106_0003436_8614_9543 302
333 3300048912 Ga0496109_0138710 Ga0496109_0138710_1332_2261 302
334 3300048913 Ga0496110_0119319 Ga0496110_0119319_548_1477 302
335 3300048914 Ga0496111_0067335 Ga0496111_0067335_1253_2182 302
336 3300048917 Ga0496114_0010013 Ga0496114_0010013_1761_2690 302
337 3300048918 Ga0496115_0022578 Ga0496115_0022578_1186_2115 302
338 3300049572 Ga0501036_0205600 Ga0501036_0205600_155_1099 302
339 3300049582 Ga0501048_0188371 Ga0501048_0188371_225_1169 302
340 3300049588 Ga0501072_0001858 Ga0501072_0001858_12141_13085 302
341 3300049592 Ga0501076_0019619 Ga0501076_0019619_187_1131 302
342 3300049741 Ga0501079_0180322 Ga0501079_0180322_139_1092 302
343 3300049741 Ga0501079_0232041 Ga0501079_0232041_264_1208 302
344 3300049743 Ga0501081_0031012 Ga0501081_0031012_602_1546 302
345 3300050491 nmdc:mga00v17_11539_c1 nmdc:mga00v17_11539_c1_1713_2660 302
346 3300050491 nmdc:mga00v17_77470_c1 nmdc:mga00v17_77470_c1_356_1276 302
347 3300050492 nmdc:mga0yw44_11124_c1 nmdc:mga0yw44_11124_c1_964_1884 302
348 3300050492 nmdc:mga0yw44_164927_c1 nmdc:mga0yw44_164927_c1_432_1379 302
349 3300050492 nmdc:mga0yw44_1754_c1 nmdc:mga0yw44_1754_c1_3583_4503 302
350 3300050507 nmdc:mga05p37_15267_c1 nmdc:mga05p37_15267_c1_5460_6404 302
351 3300050510 nmdc:mga06r32_207098_c1 nmdc:mga06r32_207098_c1_233_1162 302
352 3300050510 nmdc:mga06r32_7879_c1 nmdc:mga06r32_7879_c1_6551_7489 302
353 3300050512 nmdc:mga0n895_27595_c1 nmdc:mga0n895_27595_c1_704_1642 302
354 3300050515 nmdc:mga0a205_242805_c1 nmdc:mga0a205_242805_c1_267_1205 302
355 3300054114 Ga0501084_0014174 Ga0501084_0014174_2165_3109 302
356 3300061719 Ga0466962_0138202 Ga0466962_0138202_99_1043 302
357 3300061734 Ga0530510_0005939 Ga0530510_0005939_4120_5064 302
358 3300005444 Ga0070694_100366487 Ga0070694_1003664872 303
359 3300005535 Ga0070684_100074784 Ga0070684_1000747843 303
360 3300005548 Ga0070665_100040848 Ga0070665_1000408482 303
361 3300005844 Ga0068862_100625153 Ga0068862_1006251531 303
362 3300005937 Ga0081455_10021221 Ga0081455_100212212 303
363 3300005983 Ga0081540_1003253 Ga0081540_10032535 303
364 3300005985 Ga0081539_10024221 Ga0081539_100242212 303
365 3300006038 Ga0075365_10102365 Ga0075365_101023651 303
366 3300006048 Ga0075363_100030262 Ga0075363_1000302622 303
367 3300006178 Ga0075367_10038159 Ga0075367_100381592 303
368 3300009094 Ga0111539_10180512 Ga0111539_101805121 303
369 3300009098 Ga0105245_10000568 Ga0105245_1000056835 303
370 3300009098 Ga0105245_10083666 Ga0105245_100836662 303
371 3300009098 Ga0105245_10443690 Ga0105245_104436902 303
372 3300009147 Ga0114129_10235616 Ga0114129_102356163 303
373 3300021377 Ga0213874_10000028 Ga0213874_1000002813 303
374 3300021384 Ga0213876_10046527 Ga0213876_100465272 303
375 3300021388 Ga0213875_10010469 Ga0213875_100104693 303
376 3300025927 Ga0207687_10262095 Ga0207687_102620952 303
377 3300025934 Ga0207686_10265934 Ga0207686_102659341 303
378 3300025944 Ga0207661_10240681 Ga0207661_102406812 303
379 3300025972 Ga0207668_10069372 Ga0207668_100693722 303
380 3300026075 Ga0207708_10091077 Ga0207708_100910772 303
381 3300028379 Ga0268266_10008906 Ga0268266_100089063 303
382 3300031548 Ga0307408_100028879 Ga0307408_1000288794 303
383 3300031824 Ga0307413_10010947 Ga0307413_100109472 303
384 3300031852 Ga0307410_10133270 Ga0307410_101332702 303
385 3300031901 Ga0307406_10074725 Ga0307406_100747252 303
386 3300031903 Ga0307407_10011376 Ga0307407_100113762 303
387 3300032002 Ga0307416_100030131 Ga0307416_1000301312 303
388 3300032002 Ga0307416_100049733 Ga0307416_1000497333 303
389 3300037312 Ga0395899_0224525 Ga0395899_0224525_88_1014 303
390 3300037466 Ga0395898_0067020 Ga0395898_0067020_174_1115 303
391 3300037853 Ga0436364_0296398 Ga0436364_0296398_1897_2838 303
392 3300038443 Ga0395901_0025808 Ga0395901_0025808_2995_3924 303
393 3300039437 Ga0436365_0001544 Ga0436365_0001544_231_1178 303
394 3300039437 Ga0436365_0835713 Ga0436365_0835713_3532_4485 303
395 3300039450 Ga0436363_0174915 Ga0436363_0174915_17442_18389 303
396 3300041512 Ga0451853_2971813 Ga0451853_2971813_601_1533 303
397 3300044656 Ga0466969_0109304 Ga0466969_0109304_257_1198 303
398 3300044684 Ga0466966_0096191 Ga0466966_0096191_864_1811 303
399 3300044693 Ga0466961_0010987 Ga0466961_0010987_1657_2604 303
400 3300045049 Ga0466959_0007413 Ga0466959_0007413_5607_6548 303
401 3300045836 Ga0466958_0017843 Ga0466958_0017843_2862_3809 303
402 3300046474 Ga0495605_0074479 Ga0495605_0074479_609_1541 303
403 3300046500 Ga0495596_0086110 Ga0495596_0086110_256_1188 303
404 3300046615 Ga0495656_0064585 Ga0495656_0064585_118_1050 303
405 3300048913 Ga0496110_0298756 Ga0496110_0298756_454_1398 303
406 3300050511 nmdc:mga08y16_355554_c1 nmdc:mga08y16_355554_c1_509_1453 303
407 3300005327 Ga0070658_10022746 Ga0070658_100227463 304
408 3300005329 Ga0070683_100007131 Ga0070683_1000071318 304
409 3300005336 Ga0070680_100000746 Ga0070680_10000074619 304
410 3300005337 Ga0070682_100018093 Ga0070682_1000180933 304
411 3300005339 Ga0070660_100029345 Ga0070660_1000293454 304
412 3300005344 Ga0070661_100002426 Ga0070661_1000024268 304
413 3300005366 Ga0070659_100001090 Ga0070659_10000109016 304
414 3300005458 Ga0070681_10006683 Ga0070681_100066837 304
415 3300005530 Ga0070679_100137325 Ga0070679_1001373253 304
416 3300005577 Ga0068857_100046736 Ga0068857_1000467363 304
417 3300005614 Ga0068856_100011634 Ga0068856_1000116344 304
418 3300005614 Ga0068856_100022543 Ga0068856_1000225433 304
419 3300005616 Ga0068852_100007252 Ga0068852_1000072527 304
420 3300006846 Ga0075430_100184258 Ga0075430_1001842583 304
421 3300006852 Ga0075433_10014385 Ga0075433_100143855 304
422 3300006871 Ga0075434_100020844 Ga0075434_1000208443 304
423 3300006914 Ga0075436_100241070 Ga0075436_1002410701 304
424 3300007076 Ga0075435_100079288 Ga0075435_1000792882 304
425 3300009093 Ga0105240_10007232 Ga0105240_1000723212 304
426 3300009098 Ga0105245_10389318 Ga0105245_103893181 304
427 3300009147 Ga0114129_10224782 Ga0114129_102247823 304
428 3300009147 Ga0114129_10548223 Ga0114129_105482232 304
429 3300009147 Ga0114129_10559828 Ga0114129_105598282 304
430 3300009551 Ga0105238_10510390 Ga0105238_105103902 304
431 3300013105 Ga0157369_10006254 Ga0157369_100062545 304
432 3300013307 Ga0157372_10055368 Ga0157372_100553683 304
433 3300020070 Ga0206356_11699020 Ga0206356_116990202 304
434 3300020082 Ga0206353_10005236 Ga0206353_100052363 304
435 3300025912 Ga0207707_10006326 Ga0207707_100063267 304
436 3300025913 Ga0207695_10108674 Ga0207695_101086742 304
437 3300025914 Ga0207671_10053017 Ga0207671_100530172 304
438 3300025917 Ga0207660_10092712 Ga0207660_100927123 304
439 3300025919 Ga0207657_10007520 Ga0207657_100075205 304
440 3300025944 Ga0207661_10000599 Ga0207661_1000059911 304
441 3300026067 Ga0207678_10281740 Ga0207678_102817402 304
442 3300026075 Ga0207708_10226348 Ga0207708_102263482 304
443 3300026078 Ga0207702_10011747 Ga0207702_100117473 304
444 3300026116 Ga0207674_10019972 Ga0207674_100199727 304
445 3300031995 Ga0307409_100037506 Ga0307409_1000375063 304
446 3300031995 Ga0307409_100173147 Ga0307409_1001731472 304
447 3300032002 Ga0307416_100205720 Ga0307416_1002057203 304
448 3300032002 Ga0307416_100719971 Ga0307416_1007199712 304
449 3300032004 Ga0307414_10472814 Ga0307414_104728142 304
450 3300037418 Ga0395900_0003110 Ga0395900_0003110_2874_3815 304
451 3300037466 Ga0395898_0000333 Ga0395898_0000333_95501_96442 304
452 3300037466 Ga0395898_0254662 Ga0395898_0254662_29_973 304
453 3300038443 Ga0395901_0177226 Ga0395901_0177226_276_1220 304
454 3300044694 Ga0466963_0065451 Ga0466963_0065451_317_1267 304
455 3300046794 Ga0495589_0105489 Ga0495589_0105489_139_1053 304
456 3300048912 Ga0496109_0091050 Ga0496109_0091050_1382_2332 304
457 3300048912 Ga0496109_0300438 Ga0496109_0300438_20_967 304
458 3300048914 Ga0496111_0274310 Ga0496111_0274310_24_968 304
459 3300048916 Ga0496113_0055917 Ga0496113_0055917_435_1385 304
460 3300049587 Ga0501071_0233141 Ga0501071_0233141_117_1031 304
461 3300049743 Ga0501081_0219387 Ga0501081_0219387_25_939 304
462 3300050507 nmdc:mga05p37_235166_c1 nmdc:mga05p37_235166_c1_1257_2171 304
463 3300050507 nmdc:mga05p37_535739_c1 nmdc:mga05p37_535739_c1_328_1242 304
464 3300050511 nmdc:mga08y16_595257_c1 nmdc:mga08y16_595257_c1_78_1028 304
465 3300005329 Ga0070683_100003147 Ga0070683_1000031478 305
466 3300005356 Ga0070674_100007998 Ga0070674_1000079983 305
467 3300005547 Ga0070693_100267408 Ga0070693_1002674082 305
468 3300005718 Ga0068866_10098978 Ga0068866_100989781 305
469 3300009148 Ga0105243_10048548 Ga0105243_100485483 305
470 3300025937 Ga0207669_10036597 Ga0207669_100365973 305
471 3300025944 Ga0207661_10018558 Ga0207661_100185584 305
472 3300025972 Ga0207668_10015795 Ga0207668_100157953 305
473 3300031995 Ga0307409_100186175 Ga0307409_1001861751 305
474 3300032002 Ga0307416_100214911 Ga0307416_1002149113 305
475 3300037466 Ga0395898_0217949 Ga0395898_0217949_439_1356 305
476 3300049592 Ga0501076_0102659 Ga0501076_0102659_602_1519 305
477 3300049824 Ga0501045_0015114 Ga0501045_0015114_247_1164 305
478 3300060353 Ga0501082_0313680 Ga0501082_0313680_69_992 305
479 3300000549 LJQas_1000763 LJQas_10007632 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

5

308

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b66-assembly1.cif.gz_B impase (af2372) r92q/k164e with 400 mm glutamate 0.8936 3 304
6b64-assembly1.cif.gz_B impase (af2372) with 25 mm asp 0.8901 3 304
3luz-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.8743 3 307
6b5z-assembly1.cif.gz_A impase (af2372) with 25 mm asp 0.8678 3 304
6tqo-assembly1.cif.gz_T rrn anti-termination complex 0.8598 42 309
ID Description Score Start End Superfamily
1lbvA01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.8883 3 149 3.30.540.10
af_A4HWI6_353_462_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.8768 177 308 3.40.190.80
af_Q58327_174_293_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.8558 155 305 3.40.190.80
af_Q8CIN7_160_290_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.8558 156 305 3.40.190.80
4n81A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.8551 156 307 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A538F9N3-F1-model_v4 Inositol monophosphatase 0.99 1 313 GO:0006020
GO:0007165
GO:0008934
GO:0046872
AF-A0A7W0APG9-F1-model_v4 Inositol monophosphatase 0.9879 135 315 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A7V8ZDN2-F1-model_v4 Inositol monophosphatase 0.984 202 314 GO:0046872
AF-A0A538EBL0-F1-model_v4 Uncharacterized protein 0.98 182 313
AF-A0A7W0APG9-F1-model_v4 Inositol monophosphatase 0.9772 135 315 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.34 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map