F451913

General Info

Members Datasets Scaffolds Average Seq Length
478 234 465 104

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0499916|Ga0436365_0499916_46_402
Length 118
Sequence MMPWYLFTQENNPMRMLLRVSIPAEAGNAAAKAGTLGSTVEQILADLKPEAAYFFADDSGQRSGSIVFDMQDSSQIPAIAEPWFLAFNAKVSFRPVMSPQDLVKAGPSIIKAAGQYGK

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
3 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
4 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
5 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
6 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
7 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
8 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
11 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
12 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
13 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
82 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
83 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
229 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
232 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.72
Metatranscriptomes 3.56
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 2.09
Rhizoplane 4.81
Rhizosphere 87.45
Stem 0
Stem Tuber 0
Unclassified 4.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11347777 3300004799 Unclassified 584
2 Ga0058863_11669258 3300004799 Unclassified 597
3 Ga0058861_11119784 3300004800 Unclassified 722
4 Ga0058861_11634159 3300004800 Unclassified 803
5 Ga0058862_10637590 3300004803 Unclassified 627
6 Ga0058862_12101756 3300004803 Bacteria 750
7 Ga0058862_12831918 3300004803 Unclassified 636
8 Ga0070658_10208173 3300005327 Unclassified 1652
9 Ga0068869_100984043 3300005334 Unclassified 734
10 Ga0068869_101560330 3300005334 Bacteria 587
11 Ga0070666_10012888 3300005335 Bacteria 5287
12 Ga0070680_100860799 3300005336 Unclassified 781
13 Ga0070680_101242900 3300005336 Unclassified 644
14 Ga0070680_101866979 3300005336 Bacteria 521
15 Ga0068868_100043468 3300005338 Unclassified 3509
16 Ga0068868_101477336 3300005338 Unclassified 636
17 Ga0070692_11172948 3300005345 Unclassified 545
18 Ga0070673_100257882 3300005364 Unclassified 1522
19 Ga0070667_100017220 3300005367 Bacteria 5986
20 Ga0070667_102243288 3300005367 Unclassified 514
21 Ga0070714_100341735 3300005435 Bacteria 1404
22 Ga0070714_100425447 3300005435 Bacteria 1258
23 Ga0070714_100434291 3300005435 Bacteria 1245
24 Ga0070714_100821562 3300005435 Bacteria 901
25 Ga0070714_101528825 3300005435 Unclassified 652
26 Ga0070713_100045793 3300005436 Unclassified 3587
27 Ga0070713_100057491 3300005436 Unclassified 3239
28 Ga0070713_102058649 3300005436 Unclassified 554
29 Ga0070710_10152953 3300005437 Bacteria 1424
30 Ga0070705_100663865 3300005440 Unclassified 815
31 Ga0070705_101635435 3300005440 Unclassified 543
32 Ga0070694_100551500 3300005444 Bacteria 923
33 Ga0070708_100019690 3300005445 Bacteria 5676
34 Ga0070708_100451983 3300005445 Unclassified 1212
35 Ga0070662_100974318 3300005457 Bacteria 725
36 Ga0070681_10248863 3300005458 Bacteria 1690
37 Ga0070681_10946681 3300005458 Bacteria 780
38 Ga0068867_100855819 3300005459 Unclassified 815
39 Ga0068867_101137934 3300005459 Unclassified 714
40 Ga0068867_102183103 3300005459 Unclassified 525
41 Ga0070706_101011964 3300005467 Bacteria 766
42 Ga0070707_100290129 3300005468 Unclassified 1590
43 Ga0070707_102100607 3300005468 Unclassified 532
44 Ga0070698_100730349 3300005471 Unclassified 933
45 Ga0070699_100190620 3300005518 Bacteria 1821
46 Ga0070679_100258252 3300005530 Unclassified 1698
47 Ga0070697_100152888 3300005536 Bacteria 1946
48 Ga0068853_101429238 3300005539 Unclassified 669
49 Ga0068853_101629284 3300005539 Unclassified 625
50 Ga0070672_101560419 3300005543 Unclassified 592
51 Ga0070686_101056955 3300005544 Unclassified 668
52 Ga0070695_101479547 3300005545 Unclassified 565
53 Ga0070665_100005951 3300005548 Bacteria 12492
54 Ga0070665_100206539 3300005548 Bacteria 1965
55 Ga0070665_100315352 3300005548 Bacteria 1568
56 Ga0068855_100843294 3300005563 Unclassified 972
57 Ga0068855_100909450 3300005563 Unclassified 929
58 Ga0068855_101225555 3300005563 Unclassified 779
59 Ga0068855_101528937 3300005563 Unclassified 685
60 Ga0068857_100880267 3300005577 Bacteria 858
61 Ga0068857_101063253 3300005577 Unclassified 780
62 Ga0068856_100062638 3300005614 Bacteria 3674
63 Ga0068856_100195210 3300005614 Bacteria 2038
64 Ga0068856_100217234 3300005614 Bacteria 1927
65 Ga0068856_100545793 3300005614 Bacteria 1180
66 Ga0068856_100554214 3300005614 Bacteria 1171
67 Ga0068856_101039486 3300005614 Bacteria 837
68 Ga0068856_101533987 3300005614 Bacteria 680
69 Ga0068852_101249223 3300005616 Bacteria 764
70 Ga0068852_102673163 3300005616 Unclassified 518
71 Ga0068859_100531405 3300005617 Bacteria 1271
72 Ga0068859_101026467 3300005617 Bacteria 906
73 Ga0068864_100092483 3300005618 Bacteria 2670
74 Ga0068864_100140998 3300005618 Unclassified 2174
75 Ga0068864_102167418 3300005618 Unclassified 562
76 Ga0068861_100708277 3300005719 Unclassified 936
77 Ga0068861_102204104 3300005719 Unclassified 552
78 Ga0068863_100033420 3300005841 Unclassified 4900
79 Ga0068863_100405932 3300005841 Unclassified 1333
80 Ga0068858_100040352 3300005842 Unclassified 4328
81 Ga0068858_100046463 3300005842 Bacteria 4024
82 Ga0068858_101471617 3300005842 Unclassified 671
83 Ga0068860_100007408 3300005843 Bacteria 10978
84 Ga0068860_100877580 3300005843 Unclassified 912
85 Ga0068860_101055083 3300005843 Bacteria 831
86 Ga0068860_101354414 3300005843 Unclassified 733
87 Ga0070717_10002769 3300006028 Bacteria 12397
88 Ga0070715_10267919 3300006163 Unclassified 900
89 Ga0070712_101499773 3300006175 Bacteria 589
90 Ga0097621_100043667 3300006237 Unclassified 3614
91 Ga0097621_100053323 3300006237 Unclassified 3296
92 Ga0097621_100116296 3300006237 Unclassified 2264
93 Ga0097621_101588586 3300006237 Bacteria 622
94 Ga0075370_10436014 3300006353 Bacteria 788
95 Ga0068871_100107063 3300006358 Unclassified 2348
96 Ga0068871_100184170 3300006358 Bacteria 1796
97 Ga0068871_100352076 3300006358 Unclassified 1303
98 Ga0068871_100488908 3300006358 Bacteria 1108
99 Ga0068871_100695807 3300006358 Bacteria 931
100 Ga0068871_100730557 3300006358 Unclassified 909
101 Ga0068871_100814195 3300006358 Bacteria 861
102 Ga0075428_100386180 3300006844 Bacteria 1501
103 Ga0075428_100958827 3300006844 Bacteria 906
104 Ga0075430_100461742 3300006846 Bacteria 1048
105 Ga0075430_100796252 3300006846 Bacteria 779
106 Ga0075434_100246756 3300006871 Unclassified 1805
107 Ga0075429_100615181 3300006880 Bacteria 952
108 Ga0068865_100120586 3300006881 Bacteria 1949
109 Ga0075436_101481184 3300006914 Bacteria 515
110 Ga0075436_101510033 3300006914 Unclassified 510
111 Ga0097620_100531360 3300006931 Bacteria 1271
112 Ga0097620_101026599 3300006931 Bacteria 906
113 Ga0075435_101394090 3300007076 Unclassified 614
114 Ga0105240_10001867 3300009093 Bacteria 35069
115 Ga0105240_10069012 3300009093 Bacteria 4376
116 Ga0105240_10261286 3300009093 Unclassified 1997
117 Ga0105240_10290340 3300009093 Bacteria 1875
118 Ga0105240_10611425 3300009093 Unclassified 1199
119 Ga0105240_10895396 3300009093 Unclassified 955
120 Ga0105240_11712391 3300009093 Unclassified 656
121 Ga0105240_12243138 3300009093 Unclassified 566
122 Ga0111539_11367421 3300009094 Unclassified 821
123 Ga0105245_10005609 3300009098 Bacteria 11028
124 Ga0105245_10038936 3300009098 Unclassified 4231
125 Ga0105245_10081043 3300009098 Bacteria 2966
126 Ga0105245_10250897 3300009098 Unclassified 1719
127 Ga0105245_10574729 3300009098 Bacteria 1151
128 Ga0105245_12691023 3300009098 Bacteria 550
129 Ga0105247_10446124 3300009101 Bacteria 932
130 Ga0105247_10634193 3300009101 Bacteria 796
131 Ga0105247_11225459 3300009101 Unclassified 599
132 Ga0105247_11231228 3300009101 Bacteria 598
133 Ga0114129_10279650 3300009147 Bacteria 2230
134 Ga0114129_10989562 3300009147 Unclassified 1060
135 Ga0114129_13510764 3300009147 Unclassified 501
136 Ga0105243_12583178 3300009148 Unclassified 547
137 Ga0105241_10163786 3300009174 Bacteria 1830
138 Ga0105241_10275999 3300009174 Unclassified 1434
139 Ga0105241_10458787 3300009174 Unclassified 1128
140 Ga0105241_10516414 3300009174 Bacteria 1068
141 Ga0105241_10554795 3300009174 Bacteria 1032
142 Ga0105241_12615580 3300009174 Bacteria 507
143 Ga0105242_10012892 3300009176 Bacteria 6443
144 Ga0105248_10048994 3300009177 Bacteria 4739
145 Ga0105248_10084587 3300009177 Unclassified 3568
146 Ga0105248_10813618 3300009177 Bacteria 1054
147 Ga0105248_11017963 3300009177 Bacteria 936
148 Ga0105248_11826001 3300009177 Unclassified 689
149 Ga0105248_11845471 3300009177 Unclassified 686
150 Ga0105237_10017960 3300009545 Bacteria 7329
151 Ga0105237_10045632 3300009545 Bacteria 4409
152 Ga0105237_10289312 3300009545 Bacteria 1641
153 Ga0105237_10578674 3300009545 Unclassified 1130
154 Ga0105237_12204589 3300009545 Unclassified 560
155 Ga0105238_10282856 3300009551 Unclassified 1640
156 Ga0105238_10752296 3300009551 Unclassified 989
157 Ga0105238_10778231 3300009551 Unclassified 972
158 Ga0105238_11105475 3300009551 Bacteria 815
159 Ga0105238_11298809 3300009551 Bacteria 753
160 Ga0105238_12667085 3300009551 Unclassified 536
161 Ga0105249_10096653 3300009553 Bacteria 2772
162 Ga0105249_12194415 3300009553 Unclassified 625
163 Ga0105249_12315644 3300009553 Unclassified 610
164 Ga0105249_13500272 3300009553 Unclassified 506
165 Ga0123340_1067025 3300009763 Bacteria 915
166 Ga0123341_1037269 3300009765 Bacteria 3322
167 Ga0123342_1055409 3300009766 Bacteria 1115
168 Ga0105239_10114402 3300010375 Unclassified 2992
169 Ga0105239_10142900 3300010375 Bacteria 2668
170 Ga0105239_10215861 3300010375 Bacteria 2151
171 Ga0105239_10229576 3300010375 Bacteria 2082
172 Ga0105239_10417346 3300010375 Bacteria 1520
173 Ga0105239_11324117 3300010375 Bacteria 831
174 Ga0105239_11536664 3300010375 Unclassified 769
175 Ga0105246_10012299 3300011119 Bacteria 5336
176 Ga0105246_10338054 3300011119 Unclassified 1229
177 Ga0157373_10137294 3300013100 Unclassified 1719
178 Ga0157371_10097838 3300013102 Bacteria 2080
179 Ga0157371_10103397 3300013102 Bacteria 2021
180 Ga0157370_10114334 3300013104 Unclassified 2522
181 Ga0157370_10840177 3300013104 Unclassified 835
182 Ga0157370_10919640 3300013104 Unclassified 793
183 Ga0157369_10120144 3300013105 Unclassified 2789
184 Ga0157369_10174874 3300013105 Bacteria 2261
185 Ga0157369_10283028 3300013105 Bacteria 1727
186 Ga0157369_10372720 3300013105 Bacteria 1482
187 Ga0157369_10480956 3300013105 Bacteria 1285
188 Ga0157369_10703493 3300013105 Bacteria 1040
189 Ga0157374_10010666 3300013296 Bacteria 7915
190 Ga0157374_10024856 3300013296 Bacteria 5373
191 Ga0157374_10045348 3300013296 Bacteria 4069
192 Ga0157374_10339769 3300013296 Bacteria 1490
193 Ga0157374_10412145 3300013296 Unclassified 1349
194 Ga0157374_10444054 3300013296 Bacteria 1298
195 Ga0157374_11546054 3300013296 Unclassified 687
196 Ga0157374_12230580 3300013296 Unclassified 575
197 Ga0157378_10013255 3300013297 Bacteria 7207
198 Ga0157378_10022842 3300013297 Bacteria 5505
199 Ga0157378_10985934 3300013297 Unclassified 876
200 Ga0157378_11866511 3300013297 Unclassified 650
201 Ga0157378_12860953 3300013297 Unclassified 535
202 Ga0163162_10083137 3300013306 Unclassified 3275
203 Ga0163162_10341632 3300013306 Bacteria 1629
204 Ga0163162_10931586 3300013306 Bacteria 981
205 Ga0163162_11447142 3300013306 Unclassified 782
206 Ga0157372_10070878 3300013307 Unclassified 3923
207 Ga0157372_10124906 3300013307 Bacteria 2958
208 Ga0157372_13263763 3300013307 Bacteria 517
209 Ga0157375_10003915 3300013308 Bacteria 12913
210 Ga0157375_10873131 3300013308 Bacteria 1045
211 Ga0157375_12325892 3300013308 Bacteria 639
212 Ga0157375_12675599 3300013308 Bacteria 596
213 Ga0157375_12995448 3300013308 Unclassified 564
214 Ga0163163_10012839 3300014325 Bacteria 7644
215 Ga0163163_10073337 3300014325 Bacteria 3414
216 Ga0163163_10122282 3300014325 Unclassified 2637
217 Ga0163163_10586357 3300014325 Bacteria 1178
218 Ga0163163_10813249 3300014325 Unclassified 998
219 Ga0163163_11248534 3300014325 Unclassified 805
220 Ga0163163_11822644 3300014325 Bacteria 669
221 Ga0163163_11880924 3300014325 Unclassified 658
222 Ga0163163_12055282 3300014325 Unclassified 631
223 Ga0157377_10232341 3300014745 Unclassified 1186
224 Ga0157379_10027911 3300014968 Bacteria 5024
225 Ga0157379_10149364 3300014968 Unclassified 2108
226 Ga0157379_10466811 3300014968 Bacteria 1167
227 Ga0157379_10502269 3300014968 Unclassified 1124
228 Ga0157376_10032887 3300014969 Bacteria 4169
229 Ga0157376_10050081 3300014969 Bacteria 3463
230 Ga0157376_10104248 3300014969 Unclassified 2485
231 Ga0197907_11240395 3300020069 Bacteria 1194
232 Ga0206355_1571630 3300020076 Unclassified 1207
233 Ga0206350_10109100 3300020080 Unclassified 650
234 Ga0154015_1218273 3300020610 Bacteria 763
235 Ga0213875_10007643 3300021388 Bacteria 5570
236 Ga0213875_10024769 3300021388 Bacteria 2861
237 Ga0213875_10119963 3300021388 Bacteria 1229
238 Ga0213875_10183980 3300021388 Unclassified 982
239 Ga0213875_10425582 3300021388 Bacteria 634
240 Ga0213871_10000793 3300021441 Bacteria 4707
241 Ga0224712_10343650 3300022467 Unclassified 704
242 Ga0207705_10159300 3300025909 Unclassified 1695
243 Ga0207654_10316709 3300025911 Unclassified 1065
244 Ga0207707_11162021 3300025912 Unclassified 626
245 Ga0207695_10001835 3300025913 Bacteria 33390
246 Ga0207695_10332431 3300025913 Unclassified 1408
247 Ga0207671_10007818 3300025914 Bacteria 9194
248 Ga0207671_10165004 3300025914 Bacteria 1717
249 Ga0207671_10346478 3300025914 Unclassified 1178
250 Ga0207671_10639996 3300025914 Bacteria 847
251 Ga0207693_10533989 3300025915 Unclassified 915
252 Ga0207660_10697420 3300025917 Unclassified 828
253 Ga0207660_11096000 3300025917 Unclassified 649
254 Ga0207662_11054609 3300025918 Unclassified 578
255 Ga0207652_10555873 3300025921 Unclassified 1031
256 Ga0207652_11888107 3300025921 Unclassified 503
257 Ga0207646_10251061 3300025922 Unclassified 1598
258 Ga0207646_10281139 3300025922 Bacteria 1504
259 Ga0207694_10060643 3300025924 Bacteria 2944
260 Ga0207694_10892863 3300025924 Unclassified 751
261 Ga0207687_10000735 3300025927 Bacteria 22239
262 Ga0207687_10081610 3300025927 Bacteria 2337
263 Ga0207687_10090490 3300025927 Unclassified 2230
264 Ga0207687_10161036 3300025927 Bacteria 1722
265 Ga0207687_10755587 3300025927 Bacteria 828
266 Ga0207687_11051527 3300025927 Bacteria 699
267 Ga0207700_10415833 3300025928 Unclassified 1180
268 Ga0207700_10636230 3300025928 Bacteria 951
269 Ga0207700_11739749 3300025928 Unclassified 549
270 Ga0207700_11824577 3300025928 Unclassified 534
271 Ga0207664_10046606 3300025929 Bacteria 3403
272 Ga0207664_10203625 3300025929 Unclassified 1710
273 Ga0207664_10894569 3300025929 Unclassified 797
274 Ga0207664_11077947 3300025929 Unclassified 719
275 Ga0207644_10969792 3300025931 Unclassified 713
276 Ga0207686_10149627 3300025934 Bacteria 1624
277 Ga0207686_10244636 3300025934 Unclassified 1307
278 Ga0207709_10674602 3300025935 Unclassified 825
279 Ga0207670_10563392 3300025936 Bacteria 932
280 Ga0207704_10069430 3300025938 Bacteria 2226
281 Ga0207711_10038802 3300025941 Unclassified 4050
282 Ga0207711_10073896 3300025941 Bacteria 2964
283 Ga0207711_11054798 3300025941 Unclassified 753
284 Ga0207689_10159869 3300025942 Bacteria 1856
285 Ga0207689_11187314 3300025942 Unclassified 642
286 Ga0207661_10367998 3300025944 Unclassified 1299
287 Ga0207667_10192148 3300025949 Bacteria 2095
288 Ga0207667_10290378 3300025949 Bacteria 1671
289 Ga0207667_10444234 3300025949 Unclassified 1318
290 Ga0207667_11989863 3300025949 Unclassified 541
291 Ga0207712_10104779 3300025961 Bacteria 2110
292 Ga0207712_10626894 3300025961 Bacteria 933
293 Ga0207658_10018386 3300025986 Unclassified 4827
294 Ga0207677_10873420 3300026023 Bacteria 809
295 Ga0207703_10027363 3300026035 Bacteria 4491
296 Ga0207703_10044496 3300026035 Unclassified 3568
297 Ga0207639_11340955 3300026041 Unclassified 671
298 Ga0207702_10036836 3300026078 Unclassified 4093
299 Ga0207702_10216195 3300026078 Bacteria 1784
300 Ga0207702_10776237 3300026078 Unclassified 947
301 Ga0207702_10783126 3300026078 Unclassified 942
302 Ga0207702_12254007 3300026078 Bacteria 533
303 Ga0207641_10101202 3300026088 Unclassified 2539
304 Ga0207641_10571563 3300026088 Unclassified 1104
305 Ga0207648_10021041 3300026089 Bacteria 5869
306 Ga0207676_10328839 3300026095 Bacteria 1406
307 Ga0207676_10360021 3300026095 Bacteria 1348
308 Ga0207676_10388205 3300026095 Unclassified 1301
309 Ga0207676_11976647 3300026095 Unclassified 582
310 Ga0207674_11499025 3300026116 Unclassified 643
311 Ga0207675_100696535 3300026118 Unclassified 1024
312 Ga0207675_101911988 3300026118 Unclassified 612
313 Ga0207683_10044321 3300026121 Bacteria 3889
314 Ga0268266_10006419 3300028379 Bacteria 10775
315 Ga0268266_10030150 3300028379 Unclassified 4609
316 Ga0268265_12140955 3300028380 Unclassified 566
317 Ga0268264_10008247 3300028381 Bacteria 8652
318 Ga0268264_10158662 3300028381 Bacteria 2035
319 Ga0268264_12441871 3300028381 Unclassified 528
320 Ga0307515_10417822 3300028794 Bacteria 962
321 Ga0265338_10197353 3300028800 Bacteria 1520
322 Ga0265338_10436067 3300028800 Bacteria 929
323 Ga0265338_10533608 3300028800 Bacteria 823
324 Ga0265762_1023371 3300030760 Bacteria 1145
325 Ga0265760_10072262 3300031090 Bacteria 1059
326 Ga0265330_10204633 3300031235 Bacteria 834
327 Ga0265328_10000028 3300031239 Bacteria 112296
328 Ga0265328_10142955 3300031239 Bacteria 898
329 Ga0265329_10004537 3300031242 Bacteria 5758
330 Ga0265331_10002452 3300031250 Bacteria 12568
331 Ga0265327_10037897 3300031251 Bacteria 2634
332 Ga0265316_10008887 3300031344 Bacteria 9275
333 Ga0265342_10088695 3300031712 Bacteria 1776
334 Ga0373953_0317250 3300035117 Unclassified 681
335 Ga0373943_0513047 3300035170 Bacteria 701
336 Ga0373946_0526168 3300035171 Unclassified 608
337 Ga0373931_0445866 3300035691 Unclassified 827
338 Ga0373931_0490995 3300035691 Unclassified 791
339 Ga0373935_0231906 3300035692 Unclassified 1286
340 Ga0373935_1093649 3300035692 Unclassified 593
341 Ga0373935_1170238 3300035692 Unclassified 573
342 Ga0373927_0027650 3300035695 Unclassified 3703
343 Ga0373927_0832623 3300035695 Unclassified 609
344 Ga0373933_0061098 3300035724 Bacteria 2273
345 Ga0373947_0057922 3300035725 Unclassified 2346
346 Ga0373947_0721430 3300035725 Unclassified 680
347 Ga0373937_0111607 3300036401 Bacteria 2543
348 Ga0373937_0792642 3300036401 Bacteria 895
349 Ga0373937_1860850 3300036401 Bacteria 548
350 Ga0373937_2101116 3300036401 Unclassified 511
351 Ga0373925_0012629 3300037068 Bacteria 6118
352 Ga0373925_0225698 3300037068 Bacteria 1496
353 Ga0373925_0507636 3300037068 Bacteria 990
354 Ga0373925_0850526 3300037068 Unclassified 752
355 Ga0373925_0905378 3300037068 Unclassified 727
356 Ga0395899_0051111 3300037312 Unclassified 3068
357 Ga0395899_0385311 3300037312 Unclassified 931
358 Ga0395899_0536498 3300037312 Unclassified 754
359 Ga0395900_0358448 3300037418 Unclassified 1430
360 Ga0395898_0086402 3300037466 Bacteria 3023
361 Ga0395898_0098655 3300037466 Unclassified 2805
362 Ga0395898_0521950 3300037466 Bacteria 1129
363 Ga0395905_0552088 3300037471 Unclassified 1053
364 Ga0436364_0185143 3300037853 Bacteria 6745
365 Ga0436364_0314431 3300037853 Bacteria 2569
366 Ga0436364_0879388 3300037853 Unclassified 533
367 Ga0436364_0918478 3300037853 Bacteria 1747
368 Ga0436364_1027481 3300037853 Bacteria 33875
369 Ga0436364_1204558 3300037853 Unclassified 1770
370 Ga0436364_1236453 3300037853 Bacteria 20335
371 Ga0395901_0754465 3300038443 Unclassified 966
372 Ga0436365_0280272 3300039437 Bacteria 2044
373 Ga0436365_0499916 3300039437 Unclassified 800
374 Ga0436365_1046836 3300039437 Unclassified 1158
375 Ga0436360_0515048 3300039438 Bacteria 14683
376 Ga0436361_0194798 3300039447 Unclassified 670
377 Ga0436363_0803688 3300039450 Bacteria 1750
378 Ga0436363_1205100 3300039450 Bacteria 1438
379 Ga0436362_0603635 3300039453 Bacteria 676
380 Ga0436362_0737956 3300039453 Unclassified 508
381 Ga0439448_0272448 3300042005 Unclassified 599
382 Ga0453684_0623607 3300044712 Bacteria 1179
383 Ga0466958_0243672 3300045836 Unclassified 1149
384 Ga0466967_2004231 3300045976 Unclassified 575
385 Ga0495627_000769 3300046453 Bacteria 23843
386 Ga0495592_0004781 3300046454 Bacteria 9945
387 Ga0495629_0042113 3300046459 Bacteria 3210
388 Ga0495638_0006272 3300046460 Bacteria 8678
389 Ga0495651_0952276 3300046462 Unclassified 523
390 Ga0495580_0018724 3300046472 Bacteria 5153
391 Ga0495580_0027002 3300046472 Unclassified 4181
392 Ga0495580_0031617 3300046472 Bacteria 3823
393 Ga0495580_0146318 3300046472 Bacteria 1638
394 Ga0495580_0273731 3300046472 Bacteria 1153
395 Ga0495580_0345323 3300046472 Unclassified 1009
396 Ga0495580_0806936 3300046472 Bacteria 608
397 Ga0495582_0108845 3300046473 Bacteria 1556
398 Ga0495664_0398986 3300046477 Bacteria 826
399 Ga0495608_0146376 3300046511 Unclassified 1507
400 Ga0495630_0024197 3300046517 Bacteria 4492
401 Ga0495630_1053789 3300046517 Unclassified 617
402 Ga0495652_0483628 3300046529 Bacteria 861
403 Ga0495652_0503753 3300046529 Bacteria 839
404 Ga0495586_0058054 3300046535 Bacteria 2101
405 Ga0495586_0210339 3300046535 Bacteria 1104
406 Ga0495597_0243877 3300046542 Bacteria 708
407 Ga0495667_0504902 3300046559 Unclassified 757
408 Ga0495667_0514555 3300046559 Unclassified 749
409 Ga0495634_0036862 3300046642 Bacteria 3343
410 Ga0495625_0221154 3300046660 Bacteria 1241
411 Ga0495599_0291207 3300046678 Bacteria 987
412 Ga0495658_1097969 3300046683 Unclassified 507
413 Ga0495613_0097462 3300046689 Bacteria 2125
414 Ga0495613_0123687 3300046689 Bacteria 1856
415 Ga0495624_0222391 3300046690 Bacteria 1145
416 Ga0495660_0250001 3300046810 Bacteria 823
417 Ga0495674_0700066 3300047319 Unclassified 795
418 Ga0495674_0847420 3300047319 Bacteria 708
419 Ga0495680_0100663 3300047322 Bacteria 2153
420 Ga0495687_032369 3300047443 Bacteria 2388
421 Ga0495684_0048711 3300047471 Bacteria 3239
422 Ga0495684_0178204 3300047471 Bacteria 1577
423 Ga0495684_0474357 3300047471 Bacteria 865
424 Ga0495593_0560763 3300047673 Unclassified 573
425 Ga0495602_1002054 3300048088 Bacteria 551
426 Ga0496100_0081941 3300048903 Unclassified 2181
427 Ga0496101_0490936 3300048904 Bacteria 970
428 Ga0496102_0061644 3300048905 Bacteria 3433
429 Ga0496102_0567412 3300048905 Bacteria 1058
430 Ga0496104_0264347 3300048907 Bacteria 1633
431 Ga0496104_0340183 3300048907 Bacteria 1413
432 Ga0496104_0551020 3300048907 Bacteria 1064
433 Ga0496104_0942661 3300048907 Bacteria 768
434 Ga0496105_0033415 3300048908 Bacteria 4224
435 Ga0496105_0075698 3300048908 Unclassified 2780
436 Ga0496106_1074070 3300048909 Bacteria 631
437 Ga0496107_0108923 3300048910 Bacteria 2034
438 Ga0496110_0481320 3300048913 Unclassified 1131
439 Ga0496112_0580940 3300048915 Bacteria 1053
440 Ga0496113_0717138 3300048916 Unclassified 797
441 Ga0496114_0057907 3300048917 Bacteria 3235
442 Ga0496114_0339208 3300048917 Bacteria 1329
443 Ga0496114_0761730 3300048917 Unclassified 846
444 Ga0496115_0023424 3300048918 Unclassified 4792
445 Ga0496115_0039688 3300048918 Bacteria 3739
446 Ga0496115_0481431 3300048918 Bacteria 999
447 Ga0496115_0930956 3300048918 Bacteria 668
448 Ga0496115_1133963 3300048918 Unclassified 591
449 Ga0495678_138734 3300049459 Bacteria 798
450 nmdc:mga07m45_408037_c1 3300050496 Bacteria 788
451 nmdc:mga05p37_113745_c1 3300050507 Bacteria 3327
452 nmdc:mga05p37_344453_c1 3300050507 Bacteria 1756
453 nmdc:mga09592_574210_c1 3300050508 Bacteria 967
454 nmdc:mga0qj67_664462_c1 3300050509 Bacteria 831
455 nmdc:mga06r32_241391_c1 3300050510 Bacteria 1794
456 nmdc:mga0n895_231635_c1 3300050512 Unclassified 1875
457 nmdc:mga0rr50_97867_c1 3300050513 Unclassified 2009
458 Ga0500595_087192 3300053119 Unclassified 907
459 Ga0500652_283713 3300053131 Bacteria 646
460 Ga0500577_0002317 3300053142 Bacteria 4845
461 Ga0500616_0000583 3300053153 Bacteria 44437
462 Ga0500611_027232 3300053727 Bacteria 1149
463 Ga0587093_114116 3300059478 Unclassified 500
464 Ga0587088_093316 3300059508 Unclassified 662
465 Ga0587094_027519 3300059513 Bacteria 863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0536498 Ga0395899_0536498_62_367 86
2 3300059513 Ga0587094_027519 Ga0587094_027519_473_778 86
3 3300005577 Ga0068857_101063253 Ga0068857_1010632532 95
4 3300037068 Ga0373925_0225698 Ga0373925_0225698_141_428 95
5 3300046472 Ga0495580_0018724 Ga0495580_0018724_2667_2954 95
6 3300009098 Ga0105245_10081043 Ga0105245_100810432 97
7 3300009174 Ga0105241_12615580 Ga0105241_126155801 97
8 3300009177 Ga0105248_10048994 Ga0105248_100489942 97
9 3300009545 Ga0105237_10045632 Ga0105237_100456322 97
10 3300009551 Ga0105238_11298809 Ga0105238_112988092 97
11 3300009553 Ga0105249_10096653 Ga0105249_100966532 97
12 3300010375 Ga0105239_10229576 Ga0105239_102295763 97
13 3300013306 Ga0163162_10341632 Ga0163162_103416321 97
14 3300013308 Ga0157375_10003915 Ga0157375_100039152 97
15 iso_pu_bacteria 2838661181 2838667055 97
16 iso_pu_bacteria 2923556063 2923562990 97
17 3300035691 Ga0373931_0490995 Ga0373931_0490995_427_726 99
18 iso_pu_bacteria 2513237088 2513596955 99
19 iso_pu_bacteria 2513237138 2513865184 99
20 iso_pu_bacteria 2513237146 2513928617 99
21 iso_pu_bacteria 2582581866 2585396512 99
22 iso_pu_bacteria 2582581867 2585399887 99
23 iso_pu_bacteria 2585427590 2585820975 99
24 iso_pu_bacteria 2599185170 2599420031 99
25 iso_pu_bacteria 2838035591 2838040239 99
26 iso_pu_bacteria 2933016740 2933018624 99
27 3300009177 Ga0105248_10813618 Ga0105248_108136182 100
28 3300037312 Ga0395899_0051111 Ga0395899_0051111_838_1140 100
29 3300039450 Ga0436363_1205100 Ga0436363_1205100_728_1048 100
30 3300005548 Ga0070665_100206539 Ga0070665_1002065393 101
31 3300005563 Ga0068855_100843294 Ga0068855_1008432942 101
32 3300005616 Ga0068852_101249223 Ga0068852_1012492231 101
33 3300009093 Ga0105240_10069012 Ga0105240_100690125 101
34 3300009098 Ga0105245_10250897 Ga0105245_102508973 101
35 3300009177 Ga0105248_11826001 Ga0105248_118260011 101
36 3300009545 Ga0105237_10289312 Ga0105237_102893123 101
37 3300009553 Ga0105249_13500272 Ga0105249_135002722 101
38 3300009763 Ga0123340_1067025 Ga0123340_10670252 101
39 3300009765 Ga0123341_1037269 Ga0123341_10372692 101
40 3300009766 Ga0123342_1055409 Ga0123342_10554092 101
41 3300010375 Ga0105239_10114402 Ga0105239_101144022 101
42 3300014325 Ga0163163_10586357 Ga0163163_105863573 101
43 3300014325 Ga0163163_10813249 Ga0163163_108132492 101
44 3300025913 Ga0207695_10332431 Ga0207695_103324311 101
45 3300025941 Ga0207711_11054798 Ga0207711_110547982 101
46 3300025949 Ga0207667_11989863 Ga0207667_119898631 101
47 3300028379 Ga0268266_10030150 Ga0268266_100301504 101
48 3300046542 Ga0495597_0243877 Ga0495597_0243877_392_697 101
49 3300048907 Ga0496104_0264347 Ga0496104_0264347_658_963 101
50 3300048908 Ga0496105_0075698 Ga0496105_0075698_21_326 101
51 3300053119 Ga0500595_087192 Ga0500595_087192_331_636 101
52 3300053153 Ga0500616_0000583 Ga0500616_0000583_15434_15739 101
53 iso_pu_bacteria 2510917020 2511125282 101
54 iso_pu_bacteria 2643221583 2643923702 101
55 3300009093 Ga0105240_10261286 Ga0105240_102612863 102
56 3300009093 Ga0105240_10611425 Ga0105240_106114252 102
57 3300009174 Ga0105241_10163786 Ga0105241_101637862 102
58 3300009545 Ga0105237_10578674 Ga0105237_105786742 102
59 3300009551 Ga0105238_10282856 Ga0105238_102828562 102
60 3300009551 Ga0105238_10778231 Ga0105238_107782311 102
61 3300009553 Ga0105249_12194415 Ga0105249_121944151 102
62 3300010375 Ga0105239_10142900 Ga0105239_101429002 102
63 3300037853 Ga0436364_0879388 Ga0436364_0879388_162_476 102
64 3300039450 Ga0436363_0803688 Ga0436363_0803688_75_389 102
65 3300042005 Ga0439448_0272448 Ga0439448_0272448_183_500 102
66 3300046454 Ga0495592_0004781 Ga0495592_0004781_3760_4089 102
67 3300053131 Ga0500652_283713 Ga0500652_283713_280_588 102
68 3300005336 Ga0070680_101866979 Ga0070680_1018669791 103
69 3300005471 Ga0070698_100730349 Ga0070698_1007303491 103
70 3300005548 Ga0070665_100005951 Ga0070665_1000059517 103
71 3300006353 Ga0075370_10436014 Ga0075370_104360141 103
72 3300006844 Ga0075428_100386180 Ga0075428_1003861803 103
73 3300006844 Ga0075428_100958827 Ga0075428_1009588272 103
74 3300006846 Ga0075430_100461742 Ga0075430_1004617421 103
75 3300009093 Ga0105240_10001867 Ga0105240_1000186719 103
76 3300009093 Ga0105240_10895396 Ga0105240_108953962 103
77 3300009093 Ga0105240_12243138 Ga0105240_122431382 103
78 3300009094 Ga0111539_11367421 Ga0111539_113674212 103
79 3300009098 Ga0105245_10005609 Ga0105245_100056094 103
80 3300009098 Ga0105245_10038936 Ga0105245_100389364 103
81 3300009098 Ga0105245_10574729 Ga0105245_105747292 103
82 3300009098 Ga0105245_12691023 Ga0105245_126910232 103
83 3300009101 Ga0105247_10446124 Ga0105247_104461242 103
84 3300009101 Ga0105247_11225459 Ga0105247_112254591 103
85 3300009101 Ga0105247_11231228 Ga0105247_112312281 103
86 3300009147 Ga0114129_10989562 Ga0114129_109895622 103
87 3300009148 Ga0105243_12583178 Ga0105243_125831782 103
88 3300009174 Ga0105241_10275999 Ga0105241_102759992 103
89 3300009174 Ga0105241_10458787 Ga0105241_104587871 103
90 3300009174 Ga0105241_10554795 Ga0105241_105547951 103
91 3300009176 Ga0105242_10012892 Ga0105242_100128924 103
92 3300009177 Ga0105248_10084587 Ga0105248_100845874 103
93 3300009177 Ga0105248_11017963 Ga0105248_110179632 103
94 3300009177 Ga0105248_11845471 Ga0105248_118454711 103
95 3300009545 Ga0105237_10017960 Ga0105237_100179605 103
96 3300009545 Ga0105237_12204589 Ga0105237_122045892 103
97 3300009551 Ga0105238_11105475 Ga0105238_111054752 103
98 3300009551 Ga0105238_12667085 Ga0105238_126670852 103
99 3300010375 Ga0105239_10215861 Ga0105239_102158612 103
100 3300010375 Ga0105239_11536664 Ga0105239_115366641 103
101 3300011119 Ga0105246_10012299 Ga0105246_100122994 103
102 3300011119 Ga0105246_10338054 Ga0105246_103380542 103
103 3300013100 Ga0157373_10137294 Ga0157373_101372941 103
104 3300013102 Ga0157371_10097838 Ga0157371_100978382 103
105 3300013102 Ga0157371_10103397 Ga0157371_101033971 103
106 3300013104 Ga0157370_10840177 Ga0157370_108401771 103
107 3300013104 Ga0157370_10919640 Ga0157370_109196402 103
108 3300013105 Ga0157369_10120144 Ga0157369_101201444 103
109 3300013105 Ga0157369_10283028 Ga0157369_102830282 103
110 3300013105 Ga0157369_10480956 Ga0157369_104809561 103
111 3300013105 Ga0157369_10703493 Ga0157369_107034932 103
112 3300013296 Ga0157374_10010666 Ga0157374_100106667 103
113 3300013296 Ga0157374_10024856 Ga0157374_100248568 103
114 3300013296 Ga0157374_10045348 Ga0157374_100453485 103
115 3300013296 Ga0157374_10339769 Ga0157374_103397692 103
116 3300013296 Ga0157374_10412145 Ga0157374_104121452 103
117 3300013296 Ga0157374_10444054 Ga0157374_104440543 103
118 3300013296 Ga0157374_11546054 Ga0157374_115460541 103
119 3300013297 Ga0157378_10013255 Ga0157378_100132557 103
120 3300013297 Ga0157378_10022842 Ga0157378_100228424 103
121 3300013297 Ga0157378_11866511 Ga0157378_118665112 103
122 3300013297 Ga0157378_12860953 Ga0157378_128609531 103
123 3300013306 Ga0163162_10083137 Ga0163162_100831373 103
124 3300013306 Ga0163162_10931586 Ga0163162_109315861 103
125 3300013307 Ga0157372_10124906 Ga0157372_101249063 103
126 3300013307 Ga0157372_13263763 Ga0157372_132637632 103
127 3300013308 Ga0157375_10873131 Ga0157375_108731311 103
128 3300013308 Ga0157375_12325892 Ga0157375_123258922 103
129 3300013308 Ga0157375_12675599 Ga0157375_126755992 103
130 3300014325 Ga0163163_10012839 Ga0163163_100128396 103
131 3300014325 Ga0163163_10073337 Ga0163163_100733373 103
132 3300014325 Ga0163163_10122282 Ga0163163_101222823 103
133 3300014325 Ga0163163_11248534 Ga0163163_112485341 103
134 3300014325 Ga0163163_11822644 Ga0163163_118226441 103
135 3300014325 Ga0163163_11880924 Ga0163163_118809242 103
136 3300014745 Ga0157377_10232341 Ga0157377_102323411 103
137 3300014968 Ga0157379_10027911 Ga0157379_100279117 103
138 3300014968 Ga0157379_10149364 Ga0157379_101493641 103
139 3300014968 Ga0157379_10466811 Ga0157379_104668112 103
140 3300014968 Ga0157379_10502269 Ga0157379_105022691 103
141 3300014969 Ga0157376_10032887 Ga0157376_100328872 103
142 3300014969 Ga0157376_10050081 Ga0157376_100500812 103
143 3300014969 Ga0157376_10104248 Ga0157376_101042482 103
144 3300020076 Ga0206355_1571630 Ga0206355_15716303 103
145 3300025931 Ga0207644_10969792 Ga0207644_109697922 103
146 3300028379 Ga0268266_10006419 Ga0268266_100064193 103
147 3300028381 Ga0268264_10008247 Ga0268264_100082475 103
148 3300028794 Ga0307515_10417822 Ga0307515_104178222 103
149 3300028800 Ga0265338_10197353 Ga0265338_101973532 103
150 3300031235 Ga0265330_10204633 Ga0265330_102046331 103
151 3300031239 Ga0265328_10000028 Ga0265328_1000002833 103
152 3300031239 Ga0265328_10142955 Ga0265328_101429551 103
153 3300031242 Ga0265329_10004537 Ga0265329_100045378 103
154 3300031250 Ga0265331_10002452 Ga0265331_100024522 103
155 3300031251 Ga0265327_10037897 Ga0265327_100378972 103
156 3300031344 Ga0265316_10008887 Ga0265316_100088878 103
157 3300031712 Ga0265342_10088695 Ga0265342_100886952 103
158 3300035117 Ga0373953_0317250 Ga0373953_0317250_283_594 103
159 3300035170 Ga0373943_0513047 Ga0373943_0513047_166_477 103
160 3300035171 Ga0373946_0526168 Ga0373946_0526168_240_551 103
161 3300035692 Ga0373935_0231906 Ga0373935_0231906_403_714 103
162 3300035692 Ga0373935_1093649 Ga0373935_1093649_54_365 103
163 3300035692 Ga0373935_1170238 Ga0373935_1170238_182_493 103
164 3300035695 Ga0373927_0027650 Ga0373927_0027650_3342_3653 103
165 3300035695 Ga0373927_0832623 Ga0373927_0832623_79_390 103
166 3300035724 Ga0373933_0061098 Ga0373933_0061098_604_915 103
167 3300035725 Ga0373947_0057922 Ga0373947_0057922_1483_1794 103
168 3300035725 Ga0373947_0721430 Ga0373947_0721430_262_573 103
169 3300036401 Ga0373937_0111607 Ga0373937_0111607_16_327 103
170 3300036401 Ga0373937_0792642 Ga0373937_0792642_82_393 103
171 3300036401 Ga0373937_1860850 Ga0373937_1860850_38_349 103
172 3300036401 Ga0373937_2101116 Ga0373937_2101116_144_455 103
173 3300037068 Ga0373925_0012629 Ga0373925_0012629_21_332 103
174 3300037068 Ga0373925_0905378 Ga0373925_0905378_231_542 103
175 3300037312 Ga0395899_0385311 Ga0395899_0385311_560_871 103
176 3300037418 Ga0395900_0358448 Ga0395900_0358448_813_1124 103
177 3300037466 Ga0395898_0098655 Ga0395898_0098655_1831_2142 103
178 3300037853 Ga0436364_0918478 Ga0436364_0918478_1091_1432 103
179 3300037853 Ga0436364_1236453 Ga0436364_1236453_19076_19420 103
180 3300039437 Ga0436365_1046836 Ga0436365_1046836_478_789 103
181 3300044712 Ga0453684_0623607 Ga0453684_0623607_135_446 103
182 3300045976 Ga0466967_2004231 Ga0466967_2004231_87_398 103
183 3300046459 Ga0495629_0042113 Ga0495629_0042113_2433_2744 103
184 3300046460 Ga0495638_0006272 Ga0495638_0006272_4082_4393 103
185 3300046462 Ga0495651_0952276 Ga0495651_0952276_181_492 103
186 3300046472 Ga0495580_0027002 Ga0495580_0027002_3453_3764 103
187 3300046472 Ga0495580_0031617 Ga0495580_0031617_2373_2684 103
188 3300046472 Ga0495580_0146318 Ga0495580_0146318_1045_1356 103
189 3300046472 Ga0495580_0273731 Ga0495580_0273731_600_911 103
190 3300046472 Ga0495580_0345323 Ga0495580_0345323_153_464 103
191 3300046472 Ga0495580_0806936 Ga0495580_0806936_136_447 103
192 3300046473 Ga0495582_0108845 Ga0495582_0108845_656_967 103
193 3300046477 Ga0495664_0398986 Ga0495664_0398986_68_379 103
194 3300046511 Ga0495608_0146376 Ga0495608_0146376_446_757 103
195 3300046517 Ga0495630_0024197 Ga0495630_0024197_3968_4279 103
196 3300046517 Ga0495630_1053789 Ga0495630_1053789_166_477 103
197 3300046529 Ga0495652_0483628 Ga0495652_0483628_257_568 103
198 3300046535 Ga0495586_0058054 Ga0495586_0058054_557_868 103
199 3300046535 Ga0495586_0210339 Ga0495586_0210339_81_392 103
200 3300046559 Ga0495667_0504902 Ga0495667_0504902_358_669 103
201 3300046559 Ga0495667_0514555 Ga0495667_0514555_365_676 103
202 3300046642 Ga0495634_0036862 Ga0495634_0036862_1189_1500 103
203 3300046660 Ga0495625_0221154 Ga0495625_0221154_610_921 103
204 3300046678 Ga0495599_0291207 Ga0495599_0291207_74_385 103
205 3300046683 Ga0495658_1097969 Ga0495658_1097969_40_351 103
206 3300046689 Ga0495613_0097462 Ga0495613_0097462_1007_1318 103
207 3300046689 Ga0495613_0123687 Ga0495613_0123687_1025_1336 103
208 3300046690 Ga0495624_0222391 Ga0495624_0222391_422_733 103
209 3300046810 Ga0495660_0250001 Ga0495660_0250001_483_794 103
210 3300047319 Ga0495674_0700066 Ga0495674_0700066_323_634 103
211 3300047319 Ga0495674_0847420 Ga0495674_0847420_298_612 103
212 3300047322 Ga0495680_0100663 Ga0495680_0100663_1413_1724 103
213 3300047443 Ga0495687_032369 Ga0495687_032369_67_402 103
214 3300047471 Ga0495684_0048711 Ga0495684_0048711_1613_1924 103
215 3300047471 Ga0495684_0178204 Ga0495684_0178204_318_629 103
216 3300047471 Ga0495684_0474357 Ga0495684_0474357_503_814 103
217 3300047673 Ga0495593_0560763 Ga0495593_0560763_141_452 103
218 3300048903 Ga0496100_0081941 Ga0496100_0081941_1675_1986 103
219 3300048904 Ga0496101_0490936 Ga0496101_0490936_313_624 103
220 3300048905 Ga0496102_0061644 Ga0496102_0061644_1243_1554 103
221 3300048905 Ga0496102_0567412 Ga0496102_0567412_102_413 103
222 3300048907 Ga0496104_0340183 Ga0496104_0340183_737_1048 103
223 3300048907 Ga0496104_0942661 Ga0496104_0942661_236_547 103
224 3300048908 Ga0496105_0033415 Ga0496105_0033415_2657_2968 103
225 3300048909 Ga0496106_1074070 Ga0496106_1074070_103_414 103
226 3300048910 Ga0496107_0108923 Ga0496107_0108923_1215_1526 103
227 3300048913 Ga0496110_0481320 Ga0496110_0481320_531_842 103
228 3300048915 Ga0496112_0580940 Ga0496112_0580940_12_323 103
229 3300048916 Ga0496113_0717138 Ga0496113_0717138_386_697 103
230 3300048917 Ga0496114_0057907 Ga0496114_0057907_541_852 103
231 3300048917 Ga0496114_0761730 Ga0496114_0761730_358_669 103
232 3300048918 Ga0496115_0023424 Ga0496115_0023424_42_353 103
233 3300048918 Ga0496115_0039688 Ga0496115_0039688_2546_2857 103
234 3300048918 Ga0496115_1133963 Ga0496115_1133963_117_428 103
235 3300050496 nmdc:mga07m45_408037_c1 nmdc:mga07m45_408037_c1_171_563 103
236 3300050507 nmdc:mga05p37_344453_c1 nmdc:mga05p37_344453_c1_1011_1322 103
237 3300050508 nmdc:mga09592_574210_c1 nmdc:mga09592_574210_c1_138_449 103
238 3300050509 nmdc:mga0qj67_664462_c1 nmdc:mga0qj67_664462_c1_107_418 103
239 3300050510 nmdc:mga06r32_241391_c1 nmdc:mga06r32_241391_c1_502_813 103
240 3300053727 Ga0500611_027232 Ga0500611_027232_811_1122 103
241 3300004800 Ga0058861_11119784 Ga0058861_111197841 104
242 3300004800 Ga0058861_11634159 Ga0058861_116341591 104
243 3300004803 Ga0058862_12831918 Ga0058862_128319182 104
244 3300005336 Ga0070680_100860799 Ga0070680_1008607992 104
245 3300005338 Ga0068868_101477336 Ga0068868_1014773361 104
246 3300005367 Ga0070667_102243288 Ga0070667_1022432881 104
247 3300005435 Ga0070714_100341735 Ga0070714_1003417352 104
248 3300005435 Ga0070714_101528825 Ga0070714_1015288251 104
249 3300005445 Ga0070708_100019690 Ga0070708_1000196907 104
250 3300005468 Ga0070707_100290129 Ga0070707_1002901292 104
251 3300005530 Ga0070679_100258252 Ga0070679_1002582522 104
252 3300005548 Ga0070665_100315352 Ga0070665_1003153522 104
253 3300005563 Ga0068855_101225555 Ga0068855_1012255552 104
254 3300005563 Ga0068855_101528937 Ga0068855_1015289372 104
255 3300005719 Ga0068861_100708277 Ga0068861_1007082772 104
256 3300005842 Ga0068858_101471617 Ga0068858_1014716172 104
257 3300006871 Ga0075434_100246756 Ga0075434_1002467563 104
258 3300007076 Ga0075435_101394090 Ga0075435_1013940901 104
259 3300009093 Ga0105240_11712391 Ga0105240_117123912 104
260 3300009147 Ga0114129_10279650 Ga0114129_102796503 104
261 3300009147 Ga0114129_13510764 Ga0114129_135107641 104
262 3300009551 Ga0105238_10752296 Ga0105238_107522961 104
263 3300010375 Ga0105239_10417346 Ga0105239_104173461 104
264 3300013105 Ga0157369_10174874 Ga0157369_101748743 104
265 3300013296 Ga0157374_12230580 Ga0157374_122305801 104
266 3300013297 Ga0157378_10985934 Ga0157378_109859342 104
267 3300014325 Ga0163163_12055282 Ga0163163_120552821 104
268 3300025917 Ga0207660_10697420 Ga0207660_106974201 104
269 3300025921 Ga0207652_10555873 Ga0207652_105558732 104
270 3300025921 Ga0207652_11888107 Ga0207652_118881071 104
271 3300025922 Ga0207646_10251061 Ga0207646_102510613 104
272 3300025922 Ga0207646_10281139 Ga0207646_102811392 104
273 3300025924 Ga0207694_10892863 Ga0207694_108928632 104
274 3300025929 Ga0207664_10894569 Ga0207664_108945691 104
275 3300025929 Ga0207664_11077947 Ga0207664_110779471 104
276 3300025949 Ga0207667_10444234 Ga0207667_104442342 104
277 3300028800 Ga0265338_10436067 Ga0265338_104360672 104
278 3300028800 Ga0265338_10533608 Ga0265338_105336082 104
279 3300035691 Ga0373931_0445866 Ga0373931_0445866_460_801 104
280 3300037068 Ga0373925_0507636 Ga0373925_0507636_519_854 104
281 3300037068 Ga0373925_0850526 Ga0373925_0850526_329_664 104
282 3300037471 Ga0395905_0552088 Ga0395905_0552088_446_766 104
283 3300048918 Ga0496115_0481431 Ga0496115_0481431_251_586 104
284 3300050507 nmdc:mga05p37_113745_c1 nmdc:mga05p37_113745_c1_2231_2545 104
285 3300050512 nmdc:mga0n895_231635_c1 nmdc:mga0n895_231635_c1_666_1001 104
286 3300050513 nmdc:mga0rr50_97867_c1 nmdc:mga0rr50_97867_c1_760_1095 104
287 3300059478 Ga0587093_114116 Ga0587093_114116_40_375 104
288 3300004799 Ga0058863_11347777 Ga0058863_113477771 105
289 3300004799 Ga0058863_11669258 Ga0058863_116692581 105
290 3300004803 Ga0058862_10637590 Ga0058862_106375901 105
291 3300004803 Ga0058862_12101756 Ga0058862_121017562 105
292 3300005327 Ga0070658_10208173 Ga0070658_102081734 105
293 3300005334 Ga0068869_100984043 Ga0068869_1009840432 105
294 3300005334 Ga0068869_101560330 Ga0068869_1015603301 105
295 3300005335 Ga0070666_10012888 Ga0070666_100128883 105
296 3300005336 Ga0070680_101242900 Ga0070680_1012429001 105
297 3300005338 Ga0068868_100043468 Ga0068868_1000434683 105
298 3300005345 Ga0070692_11172948 Ga0070692_111729482 105
299 3300005364 Ga0070673_100257882 Ga0070673_1002578822 105
300 3300005367 Ga0070667_100017220 Ga0070667_1000172205 105
301 3300005435 Ga0070714_100425447 Ga0070714_1004254472 105
302 3300005435 Ga0070714_100434291 Ga0070714_1004342912 105
303 3300005435 Ga0070714_100821562 Ga0070714_1008215622 105
304 3300005436 Ga0070713_100045793 Ga0070713_1000457932 105
305 3300005436 Ga0070713_100057491 Ga0070713_1000574914 105
306 3300005436 Ga0070713_102058649 Ga0070713_1020586491 105
307 3300005437 Ga0070710_10152953 Ga0070710_101529533 105
308 3300005440 Ga0070705_100663865 Ga0070705_1006638652 105
309 3300005440 Ga0070705_101635435 Ga0070705_1016354351 105
310 3300005444 Ga0070694_100551500 Ga0070694_1005515002 105
311 3300005445 Ga0070708_100451983 Ga0070708_1004519832 105
312 3300005457 Ga0070662_100974318 Ga0070662_1009743181 105
313 3300005458 Ga0070681_10248863 Ga0070681_102488633 105
314 3300005458 Ga0070681_10946681 Ga0070681_109466812 105
315 3300005459 Ga0068867_100855819 Ga0068867_1008558191 105
316 3300005459 Ga0068867_101137934 Ga0068867_1011379342 105
317 3300005459 Ga0068867_102183103 Ga0068867_1021831031 105
318 3300005467 Ga0070706_101011964 Ga0070706_1010119642 105
319 3300005468 Ga0070707_102100607 Ga0070707_1021006071 105
320 3300005518 Ga0070699_100190620 Ga0070699_1001906202 105
321 3300005536 Ga0070697_100152888 Ga0070697_1001528883 105
322 3300005539 Ga0068853_101429238 Ga0068853_1014292382 105
323 3300005539 Ga0068853_101629284 Ga0068853_1016292841 105
324 3300005543 Ga0070672_101560419 Ga0070672_1015604192 105
325 3300005544 Ga0070686_101056955 Ga0070686_1010569551 105
326 3300005545 Ga0070695_101479547 Ga0070695_1014795472 105
327 3300005563 Ga0068855_100909450 Ga0068855_1009094501 105
328 3300005577 Ga0068857_100880267 Ga0068857_1008802671 105
329 3300005614 Ga0068856_100062638 Ga0068856_1000626385 105
330 3300005614 Ga0068856_100195210 Ga0068856_1001952102 105
331 3300005614 Ga0068856_100217234 Ga0068856_1002172342 105
332 3300005614 Ga0068856_100545793 Ga0068856_1005457932 105
333 3300005614 Ga0068856_100554214 Ga0068856_1005542142 105
334 3300005614 Ga0068856_101039486 Ga0068856_1010394861 105
335 3300005614 Ga0068856_101533987 Ga0068856_1015339871 105
336 3300005616 Ga0068852_102673163 Ga0068852_1026731631 105
337 3300005617 Ga0068859_100531405 Ga0068859_1005314053 105
338 3300005617 Ga0068859_101026467 Ga0068859_1010264672 105
339 3300005618 Ga0068864_100092483 Ga0068864_1000924834 105
340 3300005618 Ga0068864_100140998 Ga0068864_1001409983 105
341 3300005618 Ga0068864_102167418 Ga0068864_1021674181 105
342 3300005719 Ga0068861_102204104 Ga0068861_1022041042 105
343 3300005841 Ga0068863_100033420 Ga0068863_1000334205 105
344 3300005841 Ga0068863_100405932 Ga0068863_1004059322 105
345 3300005842 Ga0068858_100040352 Ga0068858_1000403523 105
346 3300005842 Ga0068858_100046463 Ga0068858_1000464633 105
347 3300005843 Ga0068860_100007408 Ga0068860_1000074088 105
348 3300005843 Ga0068860_100877580 Ga0068860_1008775802 105
349 3300005843 Ga0068860_101055083 Ga0068860_1010550832 105
350 3300005843 Ga0068860_101354414 Ga0068860_1013544142 105
351 3300006028 Ga0070717_10002769 Ga0070717_100027695 105
352 3300006163 Ga0070715_10267919 Ga0070715_102679192 105
353 3300006175 Ga0070712_101499773 Ga0070712_1014997732 105
354 3300006237 Ga0097621_100043667 Ga0097621_1000436676 105
355 3300006237 Ga0097621_100053323 Ga0097621_1000533233 105
356 3300006237 Ga0097621_100116296 Ga0097621_1001162962 105
357 3300006237 Ga0097621_101588586 Ga0097621_1015885861 105
358 3300006358 Ga0068871_100107063 Ga0068871_1001070633 105
359 3300006358 Ga0068871_100184170 Ga0068871_1001841702 105
360 3300006358 Ga0068871_100352076 Ga0068871_1003520762 105
361 3300006358 Ga0068871_100488908 Ga0068871_1004889081 105
362 3300006358 Ga0068871_100695807 Ga0068871_1006958072 105
363 3300006358 Ga0068871_100730557 Ga0068871_1007305571 105
364 3300006358 Ga0068871_100814195 Ga0068871_1008141951 105
365 3300006846 Ga0075430_100796252 Ga0075430_1007962522 105
366 3300006880 Ga0075429_100615181 Ga0075429_1006151813 105
367 3300006881 Ga0068865_100120586 Ga0068865_1001205863 105
368 3300006914 Ga0075436_101481184 Ga0075436_1014811842 105
369 3300006914 Ga0075436_101510033 Ga0075436_1015100331 105
370 3300006931 Ga0097620_100531360 Ga0097620_1005313603 105
371 3300006931 Ga0097620_101026599 Ga0097620_1010265992 105
372 3300009093 Ga0105240_10290340 Ga0105240_102903403 105
373 3300009101 Ga0105247_10634193 Ga0105247_106341932 105
374 3300009174 Ga0105241_10516414 Ga0105241_105164142 105
375 3300009553 Ga0105249_12315644 Ga0105249_123156441 105
376 3300010375 Ga0105239_11324117 Ga0105239_113241171 105
377 3300013104 Ga0157370_10114334 Ga0157370_101143344 105
378 3300013105 Ga0157369_10372720 Ga0157369_103727203 105
379 3300013306 Ga0163162_11447142 Ga0163162_114471421 105
380 3300013307 Ga0157372_10070878 Ga0157372_100708785 105
381 3300013308 Ga0157375_12995448 Ga0157375_129954481 105
382 3300020069 Ga0197907_11240395 Ga0197907_112403952 105
383 3300020080 Ga0206350_10109100 Ga0206350_101091002 105
384 3300020610 Ga0154015_1218273 Ga0154015_12182731 105
385 3300021388 Ga0213875_10007643 Ga0213875_100076433 105
386 3300021388 Ga0213875_10024769 Ga0213875_100247691 105
387 3300021388 Ga0213875_10119963 Ga0213875_101199632 105
388 3300021388 Ga0213875_10183980 Ga0213875_101839801 105
389 3300021388 Ga0213875_10425582 Ga0213875_104255821 105
390 3300021441 Ga0213871_10000793 Ga0213871_100007937 105
391 3300022467 Ga0224712_10343650 Ga0224712_103436501 105
392 3300025909 Ga0207705_10159300 Ga0207705_101593003 105
393 3300025911 Ga0207654_10316709 Ga0207654_103167091 105
394 3300025912 Ga0207707_11162021 Ga0207707_111620211 105
395 3300025913 Ga0207695_10001835 Ga0207695_100018357 105
396 3300025914 Ga0207671_10007818 Ga0207671_100078186 105
397 3300025914 Ga0207671_10165004 Ga0207671_101650041 105
398 3300025914 Ga0207671_10346478 Ga0207671_103464782 105
399 3300025914 Ga0207671_10639996 Ga0207671_106399962 105
400 3300025915 Ga0207693_10533989 Ga0207693_105339892 105
401 3300025917 Ga0207660_11096000 Ga0207660_110960001 105
402 3300025918 Ga0207662_11054609 Ga0207662_110546091 105
403 3300025924 Ga0207694_10060643 Ga0207694_100606432 105
404 3300025927 Ga0207687_10000735 Ga0207687_100007357 105
405 3300025927 Ga0207687_10081610 Ga0207687_100816103 105
406 3300025927 Ga0207687_10090490 Ga0207687_100904902 105
407 3300025927 Ga0207687_10161036 Ga0207687_101610362 105
408 3300025927 Ga0207687_10755587 Ga0207687_107555871 105
409 3300025927 Ga0207687_11051527 Ga0207687_110515271 105
410 3300025928 Ga0207700_10415833 Ga0207700_104158332 105
411 3300025928 Ga0207700_10636230 Ga0207700_106362302 105
412 3300025928 Ga0207700_11739749 Ga0207700_117397491 105
413 3300025928 Ga0207700_11824577 Ga0207700_118245772 105
414 3300025929 Ga0207664_10046606 Ga0207664_100466062 105
415 3300025929 Ga0207664_10203625 Ga0207664_102036251 105
416 3300025934 Ga0207686_10149627 Ga0207686_101496273 105
417 3300025934 Ga0207686_10244636 Ga0207686_102446362 105
418 3300025935 Ga0207709_10674602 Ga0207709_106746022 105
419 3300025936 Ga0207670_10563392 Ga0207670_105633922 105
420 3300025938 Ga0207704_10069430 Ga0207704_100694303 105
421 3300025941 Ga0207711_10038802 Ga0207711_100388024 105
422 3300025941 Ga0207711_10073896 Ga0207711_100738963 105
423 3300025942 Ga0207689_10159869 Ga0207689_101598694 105
424 3300025942 Ga0207689_11187314 Ga0207689_111873142 105
425 3300025944 Ga0207661_10367998 Ga0207661_103679982 105
426 3300025949 Ga0207667_10192148 Ga0207667_101921482 105
427 3300025949 Ga0207667_10290378 Ga0207667_102903783 105
428 3300025961 Ga0207712_10104779 Ga0207712_101047792 105
429 3300025961 Ga0207712_10626894 Ga0207712_106268942 105
430 3300025986 Ga0207658_10018386 Ga0207658_100183863 105
431 3300026023 Ga0207677_10873420 Ga0207677_108734202 105
432 3300026035 Ga0207703_10027363 Ga0207703_100273635 105
433 3300026035 Ga0207703_10044496 Ga0207703_100444964 105
434 3300026041 Ga0207639_11340955 Ga0207639_113409552 105
435 3300026078 Ga0207702_10036836 Ga0207702_100368362 105
436 3300026078 Ga0207702_10216195 Ga0207702_102161952 105
437 3300026078 Ga0207702_10776237 Ga0207702_107762372 105
438 3300026078 Ga0207702_10783126 Ga0207702_107831262 105
439 3300026078 Ga0207702_12254007 Ga0207702_122540072 105
440 3300026088 Ga0207641_10101202 Ga0207641_101012023 105
441 3300026088 Ga0207641_10571563 Ga0207641_105715631 105
442 3300026089 Ga0207648_10021041 Ga0207648_100210416 105
443 3300026095 Ga0207676_10328839 Ga0207676_103288392 105
444 3300026095 Ga0207676_10360021 Ga0207676_103600211 105
445 3300026095 Ga0207676_10388205 Ga0207676_103882052 105
446 3300026095 Ga0207676_11976647 Ga0207676_119766471 105
447 3300026116 Ga0207674_11499025 Ga0207674_114990251 105
448 3300026118 Ga0207675_100696535 Ga0207675_1006965351 105
449 3300026118 Ga0207675_101911988 Ga0207675_1019119881 105
450 3300026121 Ga0207683_10044321 Ga0207683_100443212 105
451 3300028380 Ga0268265_12140955 Ga0268265_121409551 105
452 3300028381 Ga0268264_10158662 Ga0268264_101586622 105
453 3300028381 Ga0268264_12441871 Ga0268264_124418711 105
454 3300030760 Ga0265762_1023371 Ga0265762_10233711 105
455 3300031090 Ga0265760_10072262 Ga0265760_100722622 105
456 3300037466 Ga0395898_0086402 Ga0395898_0086402_2627_2944 105
457 3300037466 Ga0395898_0521950 Ga0395898_0521950_338_655 105
458 3300037853 Ga0436364_0185143 Ga0436364_0185143_5636_5962 105
459 3300037853 Ga0436364_0314431 Ga0436364_0314431_504_821 105
460 3300037853 Ga0436364_1027481 Ga0436364_1027481_3917_4234 105
461 3300037853 Ga0436364_1204558 Ga0436364_1204558_510_827 105
462 3300038443 Ga0395901_0754465 Ga0395901_0754465_527_844 105
463 3300039437 Ga0436365_0280272 Ga0436365_0280272_1565_1915 105
464 3300039437 Ga0436365_0499916 Ga0436365_0499916_46_402 105
465 3300039438 Ga0436360_0515048 Ga0436360_0515048_12914_13231 105
466 3300039447 Ga0436361_0194798 Ga0436361_0194798_244_561 105
467 3300039453 Ga0436362_0603635 Ga0436362_0603635_309_626 105
468 3300039453 Ga0436362_0737956 Ga0436362_0737956_62_379 105
469 3300045836 Ga0466958_0243672 Ga0466958_0243672_159_593 105
470 3300046453 Ga0495627_000769 Ga0495627_000769_4968_5285 105
471 3300046529 Ga0495652_0503753 Ga0495652_0503753_75_392 105
472 3300048088 Ga0495602_1002054 Ga0495602_1002054_138_455 105
473 3300048907 Ga0496104_0551020 Ga0496104_0551020_572_889 105
474 3300048917 Ga0496114_0339208 Ga0496114_0339208_541_858 105
475 3300048918 Ga0496115_0930956 Ga0496115_0930956_176_493 105
476 3300049459 Ga0495678_138734 Ga0495678_138734_421_738 105
477 3300053142 Ga0500577_0002317 Ga0500577_0002317_92_409 105
478 3300059508 Ga0587088_093316 Ga0587088_093316_145_462 105

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cfx-assembly1.cif.gz_C structure of b.subtilis lrpc 0.7027 2 85
6u9d-assembly1.cif.gz_O saccharomyces cerevisiae acetohydroxyacid synthase 0.7012 1 80
2jzx-assembly1.cif.gz_A pcbp2 kh1-kh2 domains 0.6814 1 73
3bkf-assembly1.cif.gz_A zinc-bound c-terminal domain of nikr 0.6675 1 85
2qz8-assembly1.cif.gz_B-2 crystal structure of mycobacterium tuberculosis leucine response regulatory protein (lrpa) 0.6646 2 85
ID Description Score Start End Superfamily
af_P9WHG9_657_737_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7309 1 84 3.30.70.260
af_Q2FWK5_1_78_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7283 1 82 3.30.70.260
2ko1B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.723 1 84 3.30.70.260
af_Q2FWK5_1_78_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7206 1 82 3.30.70.260
af_B0G189_453_564_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7149 2 81 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A7C7BP33-F1-model_v4 deleted 0.991 1 103
AF-L8PF79-F1-model_v4 Uncharacterized protein 0.9909 1 94
AF-A0A3D4Z6H0-F1-model_v4 Panthothenate synthetase 0.9743 1 103
AF-A0A7C7BP33-F1-model_v4 deleted 0.9721 1 103
AF-A0A5N9H5T9-F1-model_v4 Panthothenate synthetase 0.9696 1 103

Feature Viewer

pLDDT pTM Quality
96.95 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map