F451911

General Info

Members Datasets Scaffolds Average Seq Length
478 226 956 183

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0382121|Ga0395898_0382121_622_1233
Length 203
Sequence MNPSWADLLGDCAVERTTARRLIAQLRACQIAALAFCRLLERWARGDAQPPTAGARNAALRRAAERVETALSGLEEPLKQYLLELEADALEGRSWYGGPGAAELIDWEPVLSRAGVPVQPERVAQAYLELAILVRALEGLSTAAEIDARPDVGSLWAGLFDLRENLLGRALDDVRALAASRSASSRASSAGPPSSFLITRNDS

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 1.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 6.07
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 12.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0382121 3300037466 Unclassified 1343
2 rootH1_10247513 3300003323 Bacteria 1112
3 JGI25407J50210_10000631 3300003373 Bacteria 7224
4 Ga0070658_10002021 3300005327 Bacteria 17019
5 Ga0070658_10006948 3300005327 Bacteria 9144
6 Ga0070658_10070962 3300005327 Bacteria 2852
7 Ga0070658_10141562 3300005327 Bacteria 2009
8 Ga0070658_10284467 3300005327 Bacteria 1408
9 Ga0070683_100021105 3300005329 Bacteria 5809
10 Ga0070683_100068758 3300005329 Bacteria 3300
11 Ga0070683_100142338 3300005329 Bacteria 2272
12 Ga0070683_100144815 3300005329 Unclassified 2251
13 Ga0070683_100163227 3300005329 Bacteria 2114
14 Ga0070683_100311857 3300005329 Bacteria 1497
15 Ga0070683_100342375 3300005329 Bacteria 1424
16 Ga0070680_100027059 3300005336 Bacteria 4592
17 Ga0068868_100135824 3300005338 Unclassified 2016
18 Ga0070660_100019152 3300005339 Bacteria 5010
19 Ga0070660_100023998 3300005339 Bacteria 4522
20 Ga0070660_100148380 3300005339 Bacteria 1885
21 Ga0070660_100193204 3300005339 Bacteria 1649
22 Ga0070660_100715429 3300005339 Bacteria 840
23 Ga0070691_10237880 3300005341 Bacteria 972
24 Ga0070687_100230086 3300005343 Unclassified 1140
25 Ga0070661_100009026 3300005344 Bacteria 6897
26 Ga0070671_100465641 3300005355 Bacteria 1085
27 Ga0070659_100020733 3300005366 Bacteria 4998
28 Ga0070659_100628077 3300005366 Bacteria 925
29 Ga0070714_100024364 3300005435 Bacteria 4982
30 Ga0070714_100358440 3300005435 Bacteria 1371
31 Ga0070714_101118081 3300005435 Unclassified 768
32 Ga0070713_100119800 3300005436 Bacteria 2306
33 Ga0070705_100281569 3300005440 Bacteria 1182
34 Ga0070700_100277764 3300005441 Bacteria 1213
35 Ga0070678_100354684 3300005456 Bacteria 1262
36 Ga0070662_100121165 3300005457 Bacteria 2005
37 Ga0070681_10020498 3300005458 Bacteria 6626
38 Ga0070681_10139116 3300005458 Bacteria 2358
39 Ga0070681_10142314 3300005458 Bacteria 2328
40 Ga0070681_10194262 3300005458 Bacteria 1949
41 Ga0068867_100612476 3300005459 Bacteria 951
42 Ga0070706_100074769 3300005467 Bacteria 3136
43 Ga0070706_100111930 3300005467 Bacteria 2541
44 Ga0070706_100284285 3300005467 Bacteria 1544
45 Ga0070706_100405034 3300005467 Unclassified 1270
46 Ga0070706_100733040 3300005467 Bacteria 916
47 Ga0070706_101238542 3300005467 Unclassified 685
48 Ga0070707_100383645 3300005468 Bacteria 1365
49 Ga0070698_100003923 3300005471 Bacteria 16353
50 Ga0070698_100051058 3300005471 Bacteria 4213
51 Ga0070698_100053801 3300005471 Bacteria 4089
52 Ga0070698_100152049 3300005471 Bacteria 2262
53 Ga0070698_101056567 3300005471 Unclassified 760
54 Ga0070699_100316622 3300005518 Bacteria 1401
55 Ga0070679_100022697 3300005530 Bacteria 6135
56 Ga0070679_100082129 3300005530 Bacteria 3213
57 Ga0070679_100324047 3300005530 Bacteria 1490
58 Ga0070679_100818418 3300005530 Bacteria 874
59 Ga0070684_100005429 3300005535 Bacteria 9764
60 Ga0070684_100034171 3300005535 Bacteria 4346
61 Ga0070684_100070863 3300005535 Bacteria 3068
62 Ga0070684_100073512 3300005535 Bacteria 3012
63 Ga0070684_100122534 3300005535 Bacteria 2340
64 Ga0070684_100225363 3300005535 Unclassified 1711
65 Ga0070684_100227051 3300005535 Bacteria 1704
66 Ga0070697_100250895 3300005536 Bacteria 1513
67 Ga0068853_100228474 3300005539 Bacteria 1701
68 Ga0068853_100344036 3300005539 Bacteria 1386
69 Ga0068853_100835426 3300005539 Bacteria 883
70 Ga0070695_100245387 3300005545 Unclassified 1301
71 Ga0068855_100077510 3300005563 Bacteria 3856
72 Ga0068855_100797514 3300005563 Bacteria 1004
73 Ga0068855_100851460 3300005563 Bacteria 966
74 Ga0070664_100050716 3300005564 Unclassified 3513
75 Ga0068857_100006198 3300005577 Bacteria 10224
76 Ga0068857_100045945 3300005577 Bacteria 3875
77 Ga0068856_100743880 3300005614 Bacteria 1000
78 Ga0068852_100066962 3300005616 Bacteria 3139
79 Ga0068861_100177052 3300005719 Bacteria 1772
80 Ga0081455_10042980 3300005937 Bacteria 3959
81 Ga0081455_10104302 3300005937 Bacteria 2268
82 Ga0081455_10105076 3300005937 Bacteria 2258
83 Ga0081455_10135281 3300005937 Bacteria 1921
84 Ga0081455_10166540 3300005937 Unclassified 1683
85 Ga0081538_10000057 3300005981 Bacteria 102521
86 Ga0081540_1004299 3300005983 Bacteria 10910
87 Ga0070717_10060662 3300006028 Bacteria 3132
88 Ga0075365_10276513 3300006038 Bacteria 1181
89 Ga0075432_10062761 3300006058 Bacteria 1325
90 Ga0075362_10015275 3300006177 Bacteria 3119
91 Ga0075427_10025254 3300006194 Unclassified 958
92 Ga0075366_10334840 3300006195 Unclassified 928
93 Ga0075430_100381326 3300006846 Unclassified 1163
94 Ga0075431_100042553 3300006847 Bacteria 4685
95 Ga0075431_100227488 3300006847 Bacteria 1901
96 Ga0075433_10171441 3300006852 Bacteria 1931
97 Ga0075433_10492381 3300006852 Unclassified 1079
98 Ga0075429_100126311 3300006880 Bacteria 2236
99 Ga0075429_100276824 3300006880 Bacteria 1469
100 Ga0075436_100087196 3300006914 Bacteria 2168
101 Ga0075436_100840622 3300006914 Bacteria 685
102 Ga0075435_100175076 3300007076 Bacteria 1812
103 Ga0105240_10032113 3300009093 Bacteria 6800
104 Ga0105240_10151278 3300009093 Bacteria 2764
105 Ga0111539_10070860 3300009094 Bacteria 4114
106 Ga0111539_10255583 3300009094 Bacteria 2040
107 Ga0111539_10634145 3300009094 Bacteria 1244
108 Ga0105245_10021697 3300009098 Bacteria 5637
109 Ga0114129_10005523 3300009147 Bacteria 17884
110 Ga0114129_10281590 3300009147 Bacteria 2221
111 Ga0114129_10335683 3300009147 Bacteria 2006
112 Ga0105243_10199727 3300009148 Bacteria 1753
113 Ga0105237_11286202 3300009545 Unclassified 738
114 Ga0105238_10469507 3300009551 Bacteria 1257
115 Ga0105238_11050537 3300009551 Bacteria 836
116 Ga0105239_10246417 3300010375 Bacteria 2006
117 Ga0105246_10357375 3300011119 Unclassified 1199
118 Ga0157371_10253627 3300013102 Unclassified 1267
119 Ga0157370_10357705 3300013104 Unclassified 1345
120 Ga0157370_10792100 3300013104 Bacteria 863
121 Ga0157369_10002228 3300013105 Bacteria 23342
122 Ga0157369_10042593 3300013105 Bacteria 4952
123 Ga0157369_10159811 3300013105 Unclassified 2379
124 Ga0157369_10531533 3300013105 Bacteria 1216
125 Ga0157369_10567169 3300013105 Bacteria 1173
126 Ga0182008_10002491 3300014497 Bacteria 11505
127 Ga0182008_10446783 3300014497 Unclassified 702
128 Ga0182007_10077107 3300015262 Bacteria 1093
129 Ga0206356_10668377 3300020070 Bacteria 6166
130 Ga0206356_11903558 3300020070 Bacteria 1076
131 Ga0206354_11241366 3300020081 Bacteria 2327
132 Ga0206353_10866138 3300020082 Bacteria 3035
133 Ga0213871_10001790 3300021441 Bacteria 3746
134 Ga0224712_10007795 3300022467 Bacteria 3136
135 Ga0207643_10415843 3300025908 Unclassified 852
136 Ga0207705_10072806 3300025909 Bacteria 2493
137 Ga0207705_10116956 3300025909 Bacteria 1974
138 Ga0207705_10220907 3300025909 Unclassified 1439
139 Ga0207684_10374139 3300025910 Bacteria 1226
140 Ga0207684_10402635 3300025910 Bacteria 1176
141 Ga0207684_10746205 3300025910 Unclassified 830
142 Ga0207707_10015050 3300025912 Bacteria 6736
143 Ga0207707_10032666 3300025912 Bacteria 4556
144 Ga0207707_10143614 3300025912 Bacteria 2086
145 Ga0207707_10818317 3300025912 Bacteria 775
146 Ga0207695_10085497 3300025913 Bacteria 3183
147 Ga0207663_10345690 3300025916 Unclassified 1125
148 Ga0207660_10007564 3300025917 Bacteria 7030
149 Ga0207660_10439772 3300025917 Bacteria 1054
150 Ga0207662_10282976 3300025918 Bacteria 1098
151 Ga0207657_10002639 3300025919 Bacteria 19358
152 Ga0207657_10019717 3300025919 Bacteria 6395
153 Ga0207657_10059920 3300025919 Bacteria 3268
154 Ga0207657_10233210 3300025919 Bacteria 1471
155 Ga0207657_10316700 3300025919 Bacteria 1234
156 Ga0207657_10548583 3300025919 Bacteria 904
157 Ga0207649_10024717 3300025920 Bacteria 3495
158 Ga0207652_10001672 3300025921 Bacteria 19424
159 Ga0207652_10208402 3300025921 Bacteria 1760
160 Ga0207652_10242807 3300025921 Bacteria 1624
161 Ga0207652_10425258 3300025921 Bacteria 1198
162 Ga0207652_10589898 3300025921 Unclassified 997
163 Ga0207652_10635613 3300025921 Bacteria 955
164 Ga0207694_10089109 3300025924 Bacteria 2433
165 Ga0207687_10700475 3300025927 Unclassified 860
166 Ga0207664_10009918 3300025929 Bacteria 6707
167 Ga0207664_10032591 3300025929 Bacteria 3996
168 Ga0207664_10075590 3300025929 Bacteria 2724
169 Ga0207690_10217384 3300025932 Bacteria 1460
170 Ga0207669_10423390 3300025937 Bacteria 1049
171 Ga0207661_10079319 3300025944 Bacteria 2706
172 Ga0207661_10154454 3300025944 Bacteria 1986
173 Ga0207661_10163908 3300025944 Bacteria 1930
174 Ga0207661_10175287 3300025944 Unclassified 1869
175 Ga0207667_10194346 3300025949 Bacteria 2082
176 Ga0207667_10692533 3300025949 Bacteria 1022
177 Ga0207667_11055323 3300025949 Unclassified 797
178 Ga0207639_10137883 3300026041 Bacteria 2029
179 Ga0207639_10339053 3300026041 Bacteria 1340
180 Ga0207639_11081838 3300026041 Bacteria 752
181 Ga0207702_10124821 3300026078 Bacteria 2309
182 Ga0207648_10458887 3300026089 Bacteria 1161
183 Ga0207674_10001837 3300026116 Bacteria 27050
184 Ga0207674_10031997 3300026116 Bacteria 5520
185 Ga0207675_100488888 3300026118 Unclassified 1224
186 Ga0207698_10552751 3300026142 Unclassified 1129
187 Ga0207428_10053372 3300027907 Bacteria 3224
188 Ga0207428_10107969 3300027907 Bacteria 2144
189 Ga0265319_1002066 3300028563 Bacteria 11280
190 Ga0265319_1013812 3300028563 Bacteria 3192
191 Ga0265319_1037149 3300028563 Bacteria 1662
192 Ga0265334_10001771 3300028573 Bacteria 10306
193 Ga0265334_10017550 3300028573 Bacteria 2955
194 Ga0265318_10000065 3300028577 Bacteria 102014
195 Ga0265318_10009067 3300028577 Bacteria 4396
196 Ga0265318_10070113 3300028577 Bacteria 1300
197 Ga0265336_10016330 3300028666 Bacteria 2428
198 Ga0265336_10186921 3300028666 Bacteria 616
199 Ga0265338_10003947 3300028800 Bacteria 20441
200 Ga0265338_10029703 3300028800 Bacteria 5411
201 Ga0265338_10066669 3300028800 Bacteria 3114
202 Ga0265338_10074936 3300028800 Bacteria 2874
203 Ga0265338_10080675 3300028800 Bacteria 2732
204 Ga0265338_10282598 3300028800 Bacteria 1212
205 Ga0265338_10425224 3300028800 Bacteria 943
206 Ga0265324_10025542 3300029957 Bacteria 2094
207 Ga0265330_10000243 3300031235 Bacteria 41099
208 Ga0265330_10056756 3300031235 Bacteria 1709
209 Ga0265332_10007665 3300031238 Bacteria 4876
210 Ga0265328_10002113 3300031239 Bacteria 8973
211 Ga0265320_10024489 3300031240 Bacteria 3192
212 Ga0265320_10038897 3300031240 Bacteria 2382
213 Ga0265320_10083205 3300031240 Bacteria 1491
214 Ga0265325_10001766 3300031241 Bacteria 14981
215 Ga0265329_10003161 3300031242 Bacteria 7246
216 Ga0265340_10005226 3300031247 Bacteria 7207
217 Ga0265340_10092771 3300031247 Bacteria 1410
218 Ga0265340_10114787 3300031247 Unclassified 1242
219 Ga0265339_10007161 3300031249 Bacteria 7237
220 Ga0265339_10065790 3300031249 Bacteria 1942
221 Ga0265331_10003736 3300031250 Bacteria 9675
222 Ga0265327_10020750 3300031251 Bacteria 3991
223 Ga0265327_10050873 3300031251 Bacteria 2165
224 Ga0265327_10076761 3300031251 Bacteria 1659
225 Ga0265316_10011772 3300031344 Bacteria 7868
226 Ga0265316_10258764 3300031344 Bacteria 1276
227 Ga0265316_10486112 3300031344 Bacteria 883
228 Ga0265313_10018442 3300031595 Bacteria 3916
229 Ga0265314_10005215 3300031711 Bacteria 11790
230 Ga0265314_10043931 3300031711 Bacteria 3171
231 Ga0265342_10013268 3300031712 Bacteria 5538
232 Ga0265342_10020198 3300031712 Bacteria 4280
233 Ga0307409_100452292 3300031995 Bacteria 1240
234 Ga0307416_100032326 3300032002 Bacteria 3952
235 Ga0307416_100186324 3300032002 Bacteria 1951
236 Ga0307415_100484863 3300032126 Bacteria 1077
237 Ga0373956_0453428 3300035119 Bacteria 612
238 Ga0373955_0200302 3300035172 Bacteria 1188
239 Ga0373931_0745538 3300035691 Bacteria 650
240 Ga0373937_0011467 3300036401 Bacteria 7780
241 Ga0373937_0469097 3300036401 Bacteria 1196
242 Ga0373937_1171522 3300036401 Unclassified 717
243 Ga0395899_0025826 3300037312 Bacteria 4434
244 Ga0395899_0043191 3300037312 Bacteria 3363
245 Ga0395899_0045525 3300037312 Bacteria 3269
246 Ga0395899_0088880 3300037312 Bacteria 2241
247 Ga0395900_0012242 3300037418 Bacteria 8771
248 Ga0395900_0027876 3300037418 Bacteria 5786
249 Ga0395900_0034499 3300037418 Bacteria 5210
250 Ga0395900_0049919 3300037418 Bacteria 4310
251 Ga0395900_0086598 3300037418 Bacteria 3219
252 Ga0395900_0088298 3300037418 Bacteria 3187
253 Ga0395900_0093794 3300037418 Bacteria 3083
254 Ga0395900_0154615 3300037418 Bacteria 2343
255 Ga0395900_0159046 3300037418 Bacteria 2305
256 Ga0395900_0266762 3300037418 Bacteria 1708
257 Ga0395900_0332570 3300037418 Bacteria 1497
258 Ga0395900_0384268 3300037418 Bacteria 1371
259 Ga0395900_0428937 3300037418 Unclassified 1282
260 Ga0395900_0689265 3300037418 Bacteria 956
261 Ga0395898_0012932 3300037466 Bacteria 8610
262 Ga0395898_0014416 3300037466 Bacteria 8119
263 Ga0395898_0024189 3300037466 Bacteria 6128
264 Ga0395898_0043107 3300037466 Bacteria 4447
265 Ga0395898_0062826 3300037466 Bacteria 3605
266 Ga0395898_0095723 3300037466 Bacteria 2852
267 Ga0395898_0126410 3300037466 Bacteria 2449
268 Ga0395898_0154480 3300037466 Bacteria 2195
269 Ga0395898_0407141 3300037466 Bacteria 1297
270 Ga0395898_0594636 3300037466 Bacteria 1049
271 Ga0395905_0022313 3300037471 Bacteria 5988
272 Ga0395905_0026767 3300037471 Bacteria 5438
273 Ga0395905_0035863 3300037471 Bacteria 4658
274 Ga0395905_0038049 3300037471 Bacteria 4513
275 Ga0395905_0065090 3300037471 Bacteria 3412
276 Ga0395905_0094949 3300037471 Bacteria 2798
277 Ga0395905_0263053 3300037471 Bacteria 1610
278 Ga0395905_0438569 3300037471 Bacteria 1203
279 Ga0395901_0010111 3300038443 Bacteria 9558
280 Ga0395901_0018403 3300038443 Bacteria 7130
281 Ga0395901_0023281 3300038443 Bacteria 6349
282 Ga0395901_0029751 3300038443 Bacteria 5624
283 Ga0395901_0069197 3300038443 Bacteria 3676
284 Ga0395901_0115805 3300038443 Bacteria 2815
285 Ga0395901_0157416 3300038443 Bacteria 2386
286 Ga0395901_0170439 3300038443 Bacteria 2284
287 Ga0395901_0237586 3300038443 Bacteria 1901
288 Ga0395901_0249714 3300038443 Bacteria 1849
289 Ga0395901_0252246 3300038443 Bacteria 1838
290 Ga0395901_0317472 3300038443 Unclassified 1612
291 Ga0395901_0358130 3300038443 Bacteria 1505
292 Ga0395901_0478204 3300038443 Bacteria 1271
293 Ga0395901_0732534 3300038443 Bacteria 983
294 Ga0395901_0762491 3300038443 Bacteria 960
295 Ga0436360_0260558 3300039438 Bacteria 6421
296 Ga0439448_0243535 3300042005 Unclassified 634
297 Ga0466966_0013228 3300044684 Bacteria 5464
298 Ga0466963_0014176 3300044694 Bacteria 4911
299 Ga0466963_0039526 3300044694 Bacteria 3089
300 Ga0466964_0071173 3300044706 Bacteria 1471
301 Ga0466968_0315118 3300044735 Bacteria 755
302 Ga0466957_0024966 3300044842 Bacteria 3540
303 Ga0466957_0139486 3300044842 Bacteria 1561
304 Ga0466957_0561420 3300044842 Bacteria 796
305 Ga0466960_0312439 3300044901 Bacteria 888
306 Ga0466959_0036316 3300045049 Bacteria 3641
307 Ga0466959_0350210 3300045049 Bacteria 1007
308 Ga0466958_0035141 3300045836 Bacteria 2993
309 Ga0466958_0205302 3300045836 Bacteria 1254
310 Ga0466967_0013566 3300045976 Bacteria 6303
311 Ga0466967_0014901 3300045976 Bacteria 6078
312 Ga0466967_0014938 3300045976 Bacteria 6072
313 Ga0466967_0133134 3300045976 Bacteria 2310
314 Ga0466967_0505859 3300045976 Bacteria 1186
315 Ga0495592_0323488 3300046454 Bacteria 996
316 Ga0495629_0035773 3300046459 Bacteria 3508
317 Ga0495641_0036497 3300046461 Bacteria 2309
318 Ga0495651_0053902 3300046462 Bacteria 3095
319 Ga0495653_0023011 3300046463 Bacteria 5039
320 Ga0495653_0152914 3300046463 Bacteria 1610
321 Ga0495582_0026458 3300046473 Bacteria 3180
322 Ga0495584_0144896 3300046491 Bacteria 1207
323 Ga0495584_0158957 3300046491 Bacteria 1148
324 Ga0495608_0223392 3300046511 Unclassified 1181
325 Ga0495616_0076767 3300046513 Bacteria 1605
326 Ga0495628_0147061 3300046516 Bacteria 1796
327 Ga0495628_0653301 3300046516 Bacteria 746
328 Ga0495630_0116538 3300046517 Bacteria 2025
329 Ga0495630_0416298 3300046517 Bacteria 1030
330 Ga0495630_0521450 3300046517 Bacteria 911
331 Ga0495630_0977586 3300046517 Archaea 644
332 Ga0495637_0245422 3300046520 Bacteria 646
333 Ga0495640_0322915 3300046533 Bacteria 956
334 Ga0495667_0028135 3300046559 Bacteria 3784
335 Ga0495656_0152862 3300046615 Bacteria 1116
336 Ga0495656_0154402 3300046615 Unclassified 1111
337 Ga0495668_0198068 3300046616 Bacteria 1100
338 Ga0495657_0093037 3300046675 Bacteria 1931
339 Ga0495657_0463091 3300046675 Bacteria 741
340 Ga0495657_0567610 3300046675 Bacteria 658
341 Ga0495646_0122022 3300046680 Bacteria 1474
342 Ga0495658_0337387 3300046683 Bacteria 957
343 Ga0495658_0421662 3300046683 Unclassified 851
344 Ga0495613_0081081 3300046689 Bacteria 2358
345 Ga0495670_0180423 3300046691 Unclassified 1115
346 Ga0495589_0056077 3300046794 Bacteria 1940
347 Ga0495600_0126442 3300046809 Bacteria 1663
348 Ga0495604_0588498 3300047317 Unclassified 714
349 Ga0495674_0029761 3300047319 Bacteria 4969
350 Ga0495674_0093333 3300047319 Bacteria 2568
351 Ga0495674_0224710 3300047319 Bacteria 1551
352 Ga0495680_0007225 3300047322 Bacteria 10229
353 Ga0495680_0013574 3300047322 Bacteria 7099
354 Ga0495680_0130271 3300047322 Bacteria 1849
355 Ga0495683_0349019 3300047323 Bacteria 625
356 Ga0495675_0245420 3300047444 Bacteria 1077
357 Ga0495684_0012988 3300047471 Bacteria 6429
358 Ga0495684_0072950 3300047471 Bacteria 2608
359 Ga0495684_0101465 3300047471 Bacteria 2175
360 Ga0495684_0343658 3300047471 Bacteria 1061
361 Ga0495602_0327583 3300048088 Bacteria 1112
362 Ga0496103_0104444 3300048906 Bacteria 1796
363 Ga0496103_0270732 3300048906 Bacteria 1093
364 Ga0496104_0004196 3300048907 Bacteria 12515
365 Ga0496105_0001176 3300048908 Bacteria 18219
366 Ga0496105_0084373 3300048908 Bacteria 2624
367 Ga0496105_0117284 3300048908 Bacteria 2196
368 Ga0496106_0242859 3300048909 Bacteria 1439
369 Ga0496107_0469595 3300048910 Bacteria 934
370 Ga0496108_0148540 3300048911 Unclassified 2022
371 Ga0496108_0163855 3300048911 Bacteria 1922
372 Ga0496109_0049687 3300048912 Bacteria 3819
373 Ga0496109_0183073 3300048912 Unclassified 1968
374 Ga0496109_0555188 3300048912 Unclassified 1083
375 Ga0496109_1382747 3300048912 Bacteria 639
376 Ga0496109_1461961 3300048912 Bacteria 619
377 Ga0496110_0030275 3300048913 Bacteria 4665
378 Ga0496110_0119878 3300048913 Bacteria 2370
379 Ga0496110_0137907 3300048913 Unclassified 2205
380 Ga0496111_0170520 3300048914 Bacteria 1617
381 Ga0496111_0366701 3300048914 Bacteria 1066
382 Ga0496111_0470580 3300048914 Unclassified 926
383 Ga0496112_0012090 3300048915 Bacteria 7922
384 Ga0496112_0016918 3300048915 Bacteria 6843
385 Ga0496112_0117383 3300048915 Bacteria 2631
386 Ga0496112_0244074 3300048915 Bacteria 1748
387 Ga0496112_0582863 3300048915 Unclassified 1051
388 Ga0496113_0207009 3300048916 Unclassified 1561
389 Ga0496113_0576564 3300048916 Bacteria 902
390 Ga0496114_0387837 3300048917 Bacteria 1237
391 Ga0501031_0009553 3300049568 Bacteria 6315
392 Ga0501032_0172336 3300049569 Bacteria 1418
393 Ga0501033_0020036 3300049570 Bacteria 5056
394 Ga0501034_0131841 3300049571 Bacteria 2482
395 Ga0501036_0013213 3300049572 Bacteria 6856
396 Ga0501037_0166468 3300049573 Bacteria 1569
397 Ga0501038_0004906 3300049574 Bacteria 12428
398 Ga0501039_0008650 3300049575 Bacteria 7755
399 Ga0501040_0005330 3300049576 Bacteria 8317
400 Ga0501040_0141741 3300049576 Bacteria 1693
401 Ga0501041_0253375 3300049577 Bacteria 1106
402 Ga0501042_0005361 3300049578 Bacteria 8248
403 Ga0501043_0016485 3300049579 Bacteria 5791
404 Ga0501046_0024886 3300049580 Bacteria 4904
405 Ga0501046_0869352 3300049580 Bacteria 630
406 Ga0501047_0348164 3300049581 Bacteria 1319
407 Ga0501067_0002644 3300049583 Bacteria 9922
408 Ga0501067_0043110 3300049583 Bacteria 2506
409 Ga0501067_0064021 3300049583 Unclassified 2036
410 Ga0501067_0105599 3300049583 Bacteria 1565
411 Ga0501068_0072887 3300049584 Bacteria 2097
412 Ga0501068_0339364 3300049584 Unclassified 965
413 Ga0501069_0008904 3300049585 Bacteria 5291
414 Ga0501069_0026816 3300049585 Bacteria 3157
415 Ga0501069_0030028 3300049585 Bacteria 2984
416 Ga0501070_0023825 3300049586 Bacteria 5130
417 Ga0501070_0049782 3300049586 Bacteria 3479
418 Ga0501070_0634160 3300049586 Unclassified 849
419 Ga0501071_0010074 3300049587 Bacteria 6318
420 Ga0501071_0102383 3300049587 Bacteria 2112
421 Ga0501071_0459214 3300049587 Bacteria 975
422 Ga0501071_0713800 3300049587 Unclassified 772
423 Ga0501072_0022722 3300049588 Bacteria 4866
424 Ga0501072_0294242 3300049588 Bacteria 1290
425 Ga0501073_0040137 3300049589 Bacteria 3314
426 Ga0501073_0054729 3300049589 Bacteria 2793
427 Ga0501074_0014857 3300049590 Bacteria 5661
428 Ga0501074_0020216 3300049590 Bacteria 4838
429 Ga0501074_0213967 3300049590 Bacteria 1373
430 Ga0501074_0273541 3300049590 Bacteria 1201
431 Ga0501075_0189052 3300049591 Bacteria 1570
432 Ga0501076_0040565 3300049592 Bacteria 3659
433 Ga0501077_0043463 3300049593 Bacteria 2855
434 Ga0501079_0051069 3300049741 Bacteria 3191
435 Ga0501080_0000156 3300049742 Bacteria 48753
436 Ga0501080_0005190 3300049742 Bacteria 11607
437 Ga0501080_0711152 3300049742 Bacteria 885
438 Ga0501081_0063882 3300049743 Bacteria 2555
439 Ga0501083_0000383 3300049744 Bacteria 28055
440 Ga0501083_0006482 3300049744 Bacteria 8302
441 Ga0501035_0009789 3300049822 Bacteria 8906
442 Ga0501035_0658948 3300049822 Bacteria 848
443 Ga0501044_0046874 3300049823 Bacteria 4473
444 nmdc:mga03683_64136_c1 3300050489 Bacteria 1558
445 nmdc:mga0yw44_62000_c1 3300050492 Bacteria 2295
446 nmdc:mga0yw44_84983_c1 3300050492 Bacteria 1990
447 nmdc:mga05p37_339866_c1 3300050507 Bacteria 1770
448 nmdc:mga05p37_6114_c1 3300050507 Bacteria 14180
449 nmdc:mga09592_229588_c1 3300050508 Unclassified 1608
450 nmdc:mga09592_30975_c1 3300050508 Bacteria 4455
451 nmdc:mga0qj67_70957_c1 3300050509 Bacteria 2779
452 nmdc:mga06r32_393696_c1 3300050510 Unclassified 1368
453 nmdc:mga06r32_511883_c1 3300050510 Bacteria 1177
454 nmdc:mga08y16_170749_c1 3300050511 Bacteria 2259
455 nmdc:mga08y16_196185_c1 3300050511 Bacteria 2093
456 nmdc:mga08y16_237243_c1 3300050511 Bacteria 1885
457 nmdc:mga08y16_527336_c1 3300050511 Bacteria 1197
458 nmdc:mga0n895_401130_c1 3300050512 Unclassified 1387
459 nmdc:mga0n895_557400_c1 3300050512 Unclassified 1151
460 nmdc:mga0rr50_146823_c1 3300050513 Bacteria 1902
461 nmdc:mga0rr50_476545_c1 3300050513 Bacteria 1060
462 nmdc:mga0a205_34098_c1 3300050515 Bacteria 3373
463 nmdc:mga0a205_653003_c1 3300050515 Bacteria 903
464 nmdc:mga0a205_663059_c1 3300050515 Bacteria 894
465 Ga0495612_0223198 3300053078 Bacteria 834
466 Ga0495595_0050950 3300053084 Bacteria 1918
467 Ga0495595_0083839 3300053084 Bacteria 1522
468 Ga0495595_0237798 3300053084 Unclassified 911
469 Ga0495619_0037498 3300053085 Bacteria 3159
470 Ga0495619_0050503 3300053085 Bacteria 2746
471 Ga0495619_0100673 3300053085 Bacteria 1966
472 Ga0501082_0080753 3300060353 Bacteria 2806
473 Ga0501082_0215570 3300060353 Bacteria 1670
474 Ga0501082_0456058 3300060353 Bacteria 1117
475 Ga0466962_0194893 3300061719 Unclassified 989
476 Ga0530510_0018182 3300061734 Bacteria 4983
477 Ga0530510_0053805 3300061734 Bacteria 2908
478 Ga0530510_0118083 3300061734 Unclassified 1946
479 Ga0395898_0382121
480 rootH1_10247513
481 JGI25407J50210_10000631
482 Ga0070658_10002021
483 Ga0070658_10006948
484 Ga0070658_10070962
485 Ga0070658_10141562
486 Ga0070658_10284467
487 Ga0070683_100021105
488 Ga0070683_100068758
489 Ga0070683_100142338
490 Ga0070683_100144815
491 Ga0070683_100163227
492 Ga0070683_100311857
493 Ga0070683_100342375
494 Ga0070680_100027059
495 Ga0068868_100135824
496 Ga0070660_100019152
497 Ga0070660_100023998
498 Ga0070660_100148380
499 Ga0070660_100193204
500 Ga0070660_100715429
501 Ga0070691_10237880
502 Ga0070687_100230086
503 Ga0070661_100009026
504 Ga0070671_100465641
505 Ga0070659_100020733
506 Ga0070659_100628077
507 Ga0070714_100024364
508 Ga0070714_100358440
509 Ga0070714_101118081
510 Ga0070713_100119800
511 Ga0070705_100281569
512 Ga0070700_100277764
513 Ga0070678_100354684
514 Ga0070662_100121165
515 Ga0070681_10020498
516 Ga0070681_10139116
517 Ga0070681_10142314
518 Ga0070681_10194262
519 Ga0068867_100612476
520 Ga0070706_100074769
521 Ga0070706_100111930
522 Ga0070706_100284285
523 Ga0070706_100405034
524 Ga0070706_100733040
525 Ga0070706_101238542
526 Ga0070707_100383645
527 Ga0070698_100003923
528 Ga0070698_100051058
529 Ga0070698_100053801
530 Ga0070698_100152049
531 Ga0070698_101056567
532 Ga0070699_100316622
533 Ga0070679_100022697
534 Ga0070679_100082129
535 Ga0070679_100324047
536 Ga0070679_100818418
537 Ga0070684_100005429
538 Ga0070684_100034171
539 Ga0070684_100070863
540 Ga0070684_100073512
541 Ga0070684_100122534
542 Ga0070684_100225363
543 Ga0070684_100227051
544 Ga0070697_100250895
545 Ga0068853_100228474
546 Ga0068853_100344036
547 Ga0068853_100835426
548 Ga0070695_100245387
549 Ga0068855_100077510
550 Ga0068855_100797514
551 Ga0068855_100851460
552 Ga0070664_100050716
553 Ga0068857_100006198
554 Ga0068857_100045945
555 Ga0068856_100743880
556 Ga0068852_100066962
557 Ga0068861_100177052
558 Ga0081455_10042980
559 Ga0081455_10104302
560 Ga0081455_10105076
561 Ga0081455_10135281
562 Ga0081455_10166540
563 Ga0081538_10000057
564 Ga0081540_1004299
565 Ga0070717_10060662
566 Ga0075365_10276513
567 Ga0075432_10062761
568 Ga0075362_10015275
569 Ga0075427_10025254
570 Ga0075366_10334840
571 Ga0075430_100381326
572 Ga0075431_100042553
573 Ga0075431_100227488
574 Ga0075433_10171441
575 Ga0075433_10492381
576 Ga0075429_100126311
577 Ga0075429_100276824
578 Ga0075436_100087196
579 Ga0075436_100840622
580 Ga0075435_100175076
581 Ga0105240_10032113
582 Ga0105240_10151278
583 Ga0111539_10070860
584 Ga0111539_10255583
585 Ga0111539_10634145
586 Ga0105245_10021697
587 Ga0114129_10005523
588 Ga0114129_10281590
589 Ga0114129_10335683
590 Ga0105243_10199727
591 Ga0105237_11286202
592 Ga0105238_10469507
593 Ga0105238_11050537
594 Ga0105239_10246417
595 Ga0105246_10357375
596 Ga0157371_10253627
597 Ga0157370_10357705
598 Ga0157370_10792100
599 Ga0157369_10002228
600 Ga0157369_10042593
601 Ga0157369_10159811
602 Ga0157369_10531533
603 Ga0157369_10567169
604 Ga0182008_10002491
605 Ga0182008_10446783
606 Ga0182007_10077107
607 Ga0206356_10668377
608 Ga0206356_11903558
609 Ga0206354_11241366
610 Ga0206353_10866138
611 Ga0213871_10001790
612 Ga0224712_10007795
613 Ga0207643_10415843
614 Ga0207705_10072806
615 Ga0207705_10116956
616 Ga0207705_10220907
617 Ga0207684_10374139
618 Ga0207684_10402635
619 Ga0207684_10746205
620 Ga0207707_10015050
621 Ga0207707_10032666
622 Ga0207707_10143614
623 Ga0207707_10818317
624 Ga0207695_10085497
625 Ga0207663_10345690
626 Ga0207660_10007564
627 Ga0207660_10439772
628 Ga0207662_10282976
629 Ga0207657_10002639
630 Ga0207657_10019717
631 Ga0207657_10059920
632 Ga0207657_10233210
633 Ga0207657_10316700
634 Ga0207657_10548583
635 Ga0207649_10024717
636 Ga0207652_10001672
637 Ga0207652_10208402
638 Ga0207652_10242807
639 Ga0207652_10425258
640 Ga0207652_10589898
641 Ga0207652_10635613
642 Ga0207694_10089109
643 Ga0207687_10700475
644 Ga0207664_10009918
645 Ga0207664_10032591
646 Ga0207664_10075590
647 Ga0207690_10217384
648 Ga0207669_10423390
649 Ga0207661_10079319
650 Ga0207661_10154454
651 Ga0207661_10163908
652 Ga0207661_10175287
653 Ga0207667_10194346
654 Ga0207667_10692533
655 Ga0207667_11055323
656 Ga0207639_10137883
657 Ga0207639_10339053
658 Ga0207639_11081838
659 Ga0207702_10124821
660 Ga0207648_10458887
661 Ga0207674_10001837
662 Ga0207674_10031997
663 Ga0207675_100488888
664 Ga0207698_10552751
665 Ga0207428_10053372
666 Ga0207428_10107969
667 Ga0265319_1002066
668 Ga0265319_1013812
669 Ga0265319_1037149
670 Ga0265334_10001771
671 Ga0265334_10017550
672 Ga0265318_10000065
673 Ga0265318_10009067
674 Ga0265318_10070113
675 Ga0265336_10016330
676 Ga0265336_10186921
677 Ga0265338_10003947
678 Ga0265338_10029703
679 Ga0265338_10066669
680 Ga0265338_10074936
681 Ga0265338_10080675
682 Ga0265338_10282598
683 Ga0265338_10425224
684 Ga0265324_10025542
685 Ga0265330_10000243
686 Ga0265330_10056756
687 Ga0265332_10007665
688 Ga0265328_10002113
689 Ga0265320_10024489
690 Ga0265320_10038897
691 Ga0265320_10083205
692 Ga0265325_10001766
693 Ga0265329_10003161
694 Ga0265340_10005226
695 Ga0265340_10092771
696 Ga0265340_10114787
697 Ga0265339_10007161
698 Ga0265339_10065790
699 Ga0265331_10003736
700 Ga0265327_10020750
701 Ga0265327_10050873
702 Ga0265327_10076761
703 Ga0265316_10011772
704 Ga0265316_10258764
705 Ga0265316_10486112
706 Ga0265313_10018442
707 Ga0265314_10005215
708 Ga0265314_10043931
709 Ga0265342_10013268
710 Ga0265342_10020198
711 Ga0307409_100452292
712 Ga0307416_100032326
713 Ga0307416_100186324
714 Ga0307415_100484863
715 Ga0373956_0453428
716 Ga0373955_0200302
717 Ga0373931_0745538
718 Ga0373937_0011467
719 Ga0373937_0469097
720 Ga0373937_1171522
721 Ga0395899_0025826
722 Ga0395899_0043191
723 Ga0395899_0045525
724 Ga0395899_0088880
725 Ga0395900_0012242
726 Ga0395900_0027876
727 Ga0395900_0034499
728 Ga0395900_0049919
729 Ga0395900_0086598
730 Ga0395900_0088298
731 Ga0395900_0093794
732 Ga0395900_0154615
733 Ga0395900_0159046
734 Ga0395900_0266762
735 Ga0395900_0332570
736 Ga0395900_0384268
737 Ga0395900_0428937
738 Ga0395900_0689265
739 Ga0395898_0012932
740 Ga0395898_0014416
741 Ga0395898_0024189
742 Ga0395898_0043107
743 Ga0395898_0062826
744 Ga0395898_0095723
745 Ga0395898_0126410
746 Ga0395898_0154480
747 Ga0395898_0407141
748 Ga0395898_0594636
749 Ga0395905_0022313
750 Ga0395905_0026767
751 Ga0395905_0035863
752 Ga0395905_0038049
753 Ga0395905_0065090
754 Ga0395905_0094949
755 Ga0395905_0263053
756 Ga0395905_0438569
757 Ga0395901_0010111
758 Ga0395901_0018403
759 Ga0395901_0023281
760 Ga0395901_0029751
761 Ga0395901_0069197
762 Ga0395901_0115805
763 Ga0395901_0157416
764 Ga0395901_0170439
765 Ga0395901_0237586
766 Ga0395901_0249714
767 Ga0395901_0252246
768 Ga0395901_0317472
769 Ga0395901_0358130
770 Ga0395901_0478204
771 Ga0395901_0732534
772 Ga0395901_0762491
773 Ga0436360_0260558
774 Ga0439448_0243535
775 Ga0466966_0013228
776 Ga0466963_0014176
777 Ga0466963_0039526
778 Ga0466964_0071173
779 Ga0466968_0315118
780 Ga0466957_0024966
781 Ga0466957_0139486
782 Ga0466957_0561420
783 Ga0466960_0312439
784 Ga0466959_0036316
785 Ga0466959_0350210
786 Ga0466958_0035141
787 Ga0466958_0205302
788 Ga0466967_0013566
789 Ga0466967_0014901
790 Ga0466967_0014938
791 Ga0466967_0133134
792 Ga0466967_0505859
793 Ga0495592_0323488
794 Ga0495629_0035773
795 Ga0495641_0036497
796 Ga0495651_0053902
797 Ga0495653_0023011
798 Ga0495653_0152914
799 Ga0495582_0026458
800 Ga0495584_0144896
801 Ga0495584_0158957
802 Ga0495608_0223392
803 Ga0495616_0076767
804 Ga0495628_0147061
805 Ga0495628_0653301
806 Ga0495630_0116538
807 Ga0495630_0416298
808 Ga0495630_0521450
809 Ga0495630_0977586
810 Ga0495637_0245422
811 Ga0495640_0322915
812 Ga0495667_0028135
813 Ga0495656_0152862
814 Ga0495656_0154402
815 Ga0495668_0198068
816 Ga0495657_0093037
817 Ga0495657_0463091
818 Ga0495657_0567610
819 Ga0495646_0122022
820 Ga0495658_0337387
821 Ga0495658_0421662
822 Ga0495613_0081081
823 Ga0495670_0180423
824 Ga0495589_0056077
825 Ga0495600_0126442
826 Ga0495604_0588498
827 Ga0495674_0029761
828 Ga0495674_0093333
829 Ga0495674_0224710
830 Ga0495680_0007225
831 Ga0495680_0013574
832 Ga0495680_0130271
833 Ga0495683_0349019
834 Ga0495675_0245420
835 Ga0495684_0012988
836 Ga0495684_0072950
837 Ga0495684_0101465
838 Ga0495684_0343658
839 Ga0495602_0327583
840 Ga0496103_0104444
841 Ga0496103_0270732
842 Ga0496104_0004196
843 Ga0496105_0001176
844 Ga0496105_0084373
845 Ga0496105_0117284
846 Ga0496106_0242859
847 Ga0496107_0469595
848 Ga0496108_0148540
849 Ga0496108_0163855
850 Ga0496109_0049687
851 Ga0496109_0183073
852 Ga0496109_0555188
853 Ga0496109_1382747
854 Ga0496109_1461961
855 Ga0496110_0030275
856 Ga0496110_0119878
857 Ga0496110_0137907
858 Ga0496111_0170520
859 Ga0496111_0366701
860 Ga0496111_0470580
861 Ga0496112_0012090
862 Ga0496112_0016918
863 Ga0496112_0117383
864 Ga0496112_0244074
865 Ga0496112_0582863
866 Ga0496113_0207009
867 Ga0496113_0576564
868 Ga0496114_0387837
869 Ga0501031_0009553
870 Ga0501032_0172336
871 Ga0501033_0020036
872 Ga0501034_0131841
873 Ga0501036_0013213
874 Ga0501037_0166468
875 Ga0501038_0004906
876 Ga0501039_0008650
877 Ga0501040_0005330
878 Ga0501040_0141741
879 Ga0501041_0253375
880 Ga0501042_0005361
881 Ga0501043_0016485
882 Ga0501046_0024886
883 Ga0501046_0869352
884 Ga0501047_0348164
885 Ga0501067_0002644
886 Ga0501067_0043110
887 Ga0501067_0064021
888 Ga0501067_0105599
889 Ga0501068_0072887
890 Ga0501068_0339364
891 Ga0501069_0008904
892 Ga0501069_0026816
893 Ga0501069_0030028
894 Ga0501070_0023825
895 Ga0501070_0049782
896 Ga0501070_0634160
897 Ga0501071_0010074
898 Ga0501071_0102383
899 Ga0501071_0459214
900 Ga0501071_0713800
901 Ga0501072_0022722
902 Ga0501072_0294242
903 Ga0501073_0040137
904 Ga0501073_0054729
905 Ga0501074_0014857
906 Ga0501074_0020216
907 Ga0501074_0213967
908 Ga0501074_0273541
909 Ga0501075_0189052
910 Ga0501076_0040565
911 Ga0501077_0043463
912 Ga0501079_0051069
913 Ga0501080_0000156
914 Ga0501080_0005190
915 Ga0501080_0711152
916 Ga0501081_0063882
917 Ga0501083_0000383
918 Ga0501083_0006482
919 Ga0501035_0009789
920 Ga0501035_0658948
921 Ga0501044_0046874
922 nmdc:mga03683_64136_c1
923 nmdc:mga0yw44_62000_c1
924 nmdc:mga0yw44_84983_c1
925 nmdc:mga05p37_339866_c1
926 nmdc:mga05p37_6114_c1
927 nmdc:mga09592_229588_c1
928 nmdc:mga09592_30975_c1
929 nmdc:mga0qj67_70957_c1
930 nmdc:mga06r32_393696_c1
931 nmdc:mga06r32_511883_c1
932 nmdc:mga08y16_170749_c1
933 nmdc:mga08y16_196185_c1
934 nmdc:mga08y16_237243_c1
935 nmdc:mga08y16_527336_c1
936 nmdc:mga0n895_401130_c1
937 nmdc:mga0n895_557400_c1
938 nmdc:mga0rr50_146823_c1
939 nmdc:mga0rr50_476545_c1
940 nmdc:mga0a205_34098_c1
941 nmdc:mga0a205_653003_c1
942 nmdc:mga0a205_663059_c1
943 Ga0495612_0223198
944 Ga0495595_0050950
945 Ga0495595_0083839
946 Ga0495595_0237798
947 Ga0495619_0037498
948 Ga0495619_0050503
949 Ga0495619_0100673
950 Ga0501082_0080753
951 Ga0501082_0215570
952 Ga0501082_0456058
953 Ga0466962_0194893
954 Ga0530510_0018182
955 Ga0530510_0053805
956 Ga0530510_0118083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vme-assembly2.cif.gz_U human escrt-i heterotetramer headpiece 0.7069 25 91
6sny-assembly1.cif.gz_A synthetic mimic of an epcr-binding pfemp1 bound to epcr 0.4785 22 146
6vme-assembly2.cif.gz_U human escrt-i heterotetramer headpiece 0.4759 25 91
6sny-assembly1.cif.gz_A synthetic mimic of an epcr-binding pfemp1 bound to epcr 0.4622 22 146
1ez3-assembly1.cif.gz_A crystal structure of the neuronal t-snare syntaxin-1a 0.4564 26 175
ID Description Score Start End Superfamily
af_D4A6H8_1_75_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6846 12 87 1.20.120.230
af_D4A6H8_1_75_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6544 12 87 1.20.120.230
af_Q54K81_850_982_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5662 10 146 1.20.120.230
af_Q54JY7_79_191_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.541 24 154 1.20.58.70
af_G5EGK1_937_1077_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5373 7 156 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A7W0SR42-F1-model_v4 DUF4254 domain-containing protein 0.9889 11 185
AF-A0A7W0SR42-F1-model_v4 DUF4254 domain-containing protein 0.9723 11 185
AF-A0A7V9CWL0-F1-model_v4 Uncharacterized protein 0.9708 36 185
AF-A0A7V9CWL0-F1-model_v4 Uncharacterized protein 0.9582 36 185
AF-A0A7V8XP22-F1-model_v4 Uncharacterized protein 0.9064 11 81

Map