F451703

General Info

Members Datasets Scaffolds Average Seq Length
477 239 954 69

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10580674|Ga0157372_105806743
Length 73
Sequence MANKKFEFNKSLTDLNENDLKARIQEDELRLKKLEFAHAISPLENPMTIRALRRDVARLKTELKKKTLGANVK

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
159 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
162 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
163 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
166 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
232 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
233 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
234 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
235 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 1.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.35
Nodule 0
Rhizoplane 2.1
Rhizosphere 92.66
Stem 0
Stem Tuber 0
Unclassified 2.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10580674 3300013307 Bacteria 1306
2 Ga0070676_10109137 3300005328 Bacteria 1720
3 Ga0070670_100268411 3300005331 Bacteria 1488
4 Ga0070670_100390131 3300005331 Bacteria 1228
5 Ga0070670_100452176 3300005331 Bacteria 1138
6 Ga0070670_100555590 3300005331 Bacteria 1024
7 Ga0070677_10060927 3300005333 Bacteria 1556
8 Ga0070677_10070679 3300005333 Bacteria 1467
9 Ga0070677_10262844 3300005333 Bacteria 862
10 Ga0070677_10294086 3300005333 Bacteria 823
11 Ga0068869_100087320 3300005334 Bacteria 2339
12 Ga0068869_101459031 3300005334 Bacteria 607
13 Ga0068869_102165775 3300005334 Bacteria 500
14 Ga0068868_100714046 3300005338 Bacteria 898
15 Ga0068868_101191300 3300005338 Bacteria 704
16 Ga0068868_101279176 3300005338 Bacteria 681
17 Ga0068868_101397320 3300005338 Bacteria 653
18 Ga0070689_102237392 3300005340 Bacteria 501
19 Ga0070692_11411470 3300005345 Bacteria 503
20 Ga0070668_100059272 3300005347 Bacteria 2963
21 Ga0070669_100126368 3300005353 Bacteria 1957
22 Ga0070669_100844473 3300005353 Bacteria 780
23 Ga0070675_100175442 3300005354 Bacteria 1850
24 Ga0070675_100622377 3300005354 Bacteria 980
25 Ga0070671_101681353 3300005355 Bacteria 563
26 Ga0070674_100065927 3300005356 Bacteria 2543
27 Ga0070674_100143489 3300005356 Bacteria 1795
28 Ga0070674_100761477 3300005356 Bacteria 833
29 Ga0070673_100279556 3300005364 Bacteria 1464
30 Ga0070688_100401068 3300005365 Bacteria 1015
31 Ga0070688_100428361 3300005365 Bacteria 985
32 Ga0070688_100945164 3300005365 Bacteria 682
33 Ga0070667_100647031 3300005367 Unclassified 976
34 Ga0070667_100739290 3300005367 Bacteria 911
35 Ga0070667_100761546 3300005367 Bacteria 898
36 Ga0070667_100868918 3300005367 Bacteria 839
37 Ga0070667_101063513 3300005367 Bacteria 756
38 Ga0070667_102354686 3300005367 Bacteria 501
39 Ga0070701_10346256 3300005438 Bacteria 927
40 Ga0070700_100548611 3300005441 Bacteria 897
41 Ga0070700_100753050 3300005441 Bacteria 780
42 Ga0070663_100688115 3300005455 Bacteria 868
43 Ga0070663_101192749 3300005455 Unclassified 668
44 Ga0070663_102020885 3300005455 Bacteria 519
45 Ga0070678_100107406 3300005456 Bacteria 2177
46 Ga0070678_100200263 3300005456 Bacteria 1647
47 Ga0070678_101955877 3300005456 Bacteria 554
48 Ga0068867_100099746 3300005459 Bacteria 2216
49 Ga0070685_10293535 3300005466 Bacteria 1093
50 Ga0070698_100036969 3300005471 Bacteria 5037
51 Ga0068853_100466130 3300005539 Bacteria 1189
52 Ga0068853_100718513 3300005539 Bacteria 954
53 Ga0068853_100866548 3300005539 Bacteria 867
54 Ga0068853_101077065 3300005539 Bacteria 775
55 Ga0070672_100064827 3300005543 Bacteria 2888
56 Ga0070672_100802037 3300005543 Bacteria 828
57 Ga0070686_100875192 3300005544 Bacteria 729
58 Ga0070665_100392186 3300005548 Bacteria 1396
59 Ga0068855_100916394 3300005563 Bacteria 925
60 Ga0070664_101537344 3300005564 Bacteria 630
61 Ga0068857_100330068 3300005577 Bacteria 1410
62 Ga0068857_102415608 3300005577 Bacteria 516
63 Ga0068856_100346135 3300005614 Bacteria 1505
64 Ga0068856_101578105 3300005614 Bacteria 670
65 Ga0068852_100227253 3300005616 Bacteria 1778
66 Ga0068852_100452055 3300005616 Bacteria 1272
67 Ga0068852_100892609 3300005616 Bacteria 906
68 Ga0068852_101197588 3300005616 Bacteria 781
69 Ga0068852_102093378 3300005616 Bacteria 588
70 Ga0068859_100011297 3300005617 Bacteria 8986
71 Ga0068859_100527138 3300005617 Bacteria 1276
72 Ga0068859_100804066 3300005617 Bacteria 1028
73 Ga0068859_102038168 3300005617 Bacteria 633
74 Ga0068864_100297664 3300005618 Bacteria 1510
75 Ga0068864_100688975 3300005618 Bacteria 997
76 Ga0068864_101472563 3300005618 Bacteria 683
77 Ga0068864_102059006 3300005618 Bacteria 577
78 Ga0068866_10042338 3300005718 Bacteria 2266
79 Ga0068861_100590408 3300005719 Bacteria 1018
80 Ga0068861_100846427 3300005719 Bacteria 862
81 Ga0068863_101044579 3300005841 Bacteria 821
82 Ga0068863_101131733 3300005841 Bacteria 788
83 Ga0068858_100173456 3300005842 Bacteria 2034
84 Ga0068858_101368795 3300005842 Bacteria 697
85 Ga0068858_102046869 3300005842 Bacteria 566
86 Ga0068858_102507185 3300005842 Unclassified 509
87 Ga0068860_100032482 3300005843 Bacteria 5015
88 Ga0068860_100827823 3300005843 Bacteria 940
89 Ga0068862_100718056 3300005844 Bacteria 969
90 Ga0068862_101047281 3300005844 Bacteria 809
91 Ga0068862_101969716 3300005844 Bacteria 595
92 Ga0081539_10137372 3300005985 Bacteria 1192
93 Ga0075366_10142814 3300006195 Bacteria 1448
94 Ga0075366_10575881 3300006195 Unclassified 697
95 Ga0075366_10587065 3300006195 Bacteria 690
96 Ga0075366_10619515 3300006195 Bacteria 671
97 Ga0075366_10724714 3300006195 Bacteria 618
98 Ga0097621_100405054 3300006237 Bacteria 1222
99 Ga0097621_100532410 3300006237 Bacteria 1068
100 Ga0097621_100978123 3300006237 Bacteria 791
101 Ga0097621_102180271 3300006237 Bacteria 530
102 Ga0075370_10476588 3300006353 Bacteria 752
103 Ga0068871_100297971 3300006358 Bacteria 1415
104 Ga0068871_100313485 3300006358 Bacteria 1379
105 Ga0075430_101347742 3300006846 Bacteria 587
106 Ga0075434_101688960 3300006871 Bacteria 641
107 Ga0075434_101820624 3300006871 Bacteria 615
108 Ga0075429_101583558 3300006880 Bacteria 569
109 Ga0068865_100345594 3300006881 Bacteria 1203
110 Ga0068865_100721139 3300006881 Bacteria 854
111 Ga0097620_100011297 3300006931 Bacteria 8986
112 Ga0097620_100527115 3300006931 Bacteria 1276
113 Ga0097620_100804018 3300006931 Bacteria 1028
114 Ga0097620_102038240 3300006931 Bacteria 633
115 Ga0075435_101260386 3300007076 Bacteria 647
116 Ga0105240_10267364 3300009093 Bacteria 1970
117 Ga0111539_10044551 3300009094 Bacteria 5315
118 Ga0111539_10560888 3300009094 Bacteria 1330
119 Ga0105247_10002304 3300009101 Bacteria 13045
120 Ga0114129_10690307 3300009147 Bacteria 1313
121 Ga0105243_10894353 3300009148 Bacteria 883
122 Ga0105241_10014100 3300009174 Bacteria 5856
123 Ga0105242_10394296 3300009176 Bacteria 1290
124 Ga0105242_10717505 3300009176 Bacteria 980
125 Ga0105237_10014365 3300009545 Bacteria 8285
126 Ga0105238_10008067 3300009551 Bacteria 10530
127 Ga0105249_10059926 3300009553 Bacteria 3492
128 Ga0105249_10114006 3300009553 Bacteria 2559
129 Ga0105249_10674147 3300009553 Bacteria 1093
130 Ga0105249_11454828 3300009553 Bacteria 757
131 Ga0105249_12014776 3300009553 Bacteria 650
132 Ga0105246_10462754 3300011119 Bacteria 1069
133 Ga0105246_10673155 3300011119 Bacteria 903
134 Ga0157373_10671727 3300013100 Bacteria 758
135 Ga0157371_10763877 3300013102 Bacteria 727
136 Ga0157370_10339108 3300013104 Bacteria 1385
137 Ga0157369_11301071 3300013105 Bacteria 741
138 Ga0157369_11551431 3300013105 Bacteria 674
139 Ga0157374_10441462 3300013296 Bacteria 1302
140 Ga0157374_10704408 3300013296 Bacteria 1023
141 Ga0157378_10420066 3300013297 Bacteria 1321
142 Ga0157378_11677886 3300013297 Bacteria 682
143 Ga0163162_10334540 3300013306 Bacteria 1647
144 Ga0163162_11221627 3300013306 Bacteria 853
145 Ga0163162_11274916 3300013306 Unclassified 835
146 Ga0163162_11483352 3300013306 Bacteria 772
147 Ga0157372_10048397 3300013307 Bacteria 4726
148 Ga0157372_10347423 3300013307 Bacteria 1728
149 Ga0157372_10693372 3300013307 Bacteria 1185
150 Ga0157372_11260486 3300013307 Bacteria 853
151 Ga0157372_11725899 3300013307 Bacteria 720
152 Ga0157375_10103965 3300013308 Bacteria 2928
153 Ga0163163_10179071 3300014325 Bacteria 2167
154 Ga0163163_12250842 3300014325 Bacteria 604
155 Ga0157380_10078672 3300014326 Bacteria 2691
156 Ga0157377_10045304 3300014745 Bacteria 2456
157 Ga0157377_10753146 3300014745 Bacteria 713
158 Ga0157376_10094106 3300014969 Bacteria 2603
159 Ga0157376_10173652 3300014969 Bacteria 1964
160 Ga0157376_10280684 3300014969 Bacteria 1568
161 Ga0157376_11380379 3300014969 Bacteria 736
162 Ga0182005_1066448 3300015265 Bacteria 988
163 Ga0163161_10005594 3300017792 Bacteria 8712
164 Ga0163161_11009848 3300017792 Bacteria 711
165 Ga0163161_11076549 3300017792 Bacteria 690
166 Ga0213876_10007626 3300021384 Bacteria 5875
167 Ga0213876_10240851 3300021384 Bacteria 962
168 Ga0207697_10028260 3300025315 Bacteria 2294
169 Ga0207656_10334448 3300025321 Bacteria 754
170 Ga0207682_10012681 3300025893 Bacteria 3286
171 Ga0207642_10072928 3300025899 Bacteria 1640
172 Ga0207642_10316013 3300025899 Bacteria 910
173 Ga0207642_10879567 3300025899 Bacteria 573
174 Ga0207710_10002332 3300025900 Bacteria 8872
175 Ga0207680_10038269 3300025903 Bacteria 2776
176 Ga0207680_10039067 3300025903 Bacteria 2751
177 Ga0207680_10130538 3300025903 Bacteria 1655
178 Ga0207647_10107015 3300025904 Bacteria 1655
179 Ga0207685_10090940 3300025905 Bacteria 1285
180 Ga0207645_10278126 3300025907 Bacteria 1111
181 Ga0207643_10093125 3300025908 Bacteria 1759
182 Ga0207643_10117573 3300025908 Bacteria 1572
183 Ga0207654_10000881 3300025911 Bacteria 16661
184 Ga0207707_11331700 3300025912 Bacteria 576
185 Ga0207695_10009751 3300025913 Bacteria 11818
186 Ga0207695_10447497 3300025913 Bacteria 1175
187 Ga0207671_10003750 3300025914 Bacteria 14958
188 Ga0207657_10082847 3300025919 Bacteria 2692
189 Ga0207657_11118955 3300025919 Bacteria 601
190 Ga0207649_10024359 3300025920 Bacteria 3517
191 Ga0207649_11488650 3300025920 Bacteria 536
192 Ga0207681_10122939 3300025923 Bacteria 1906
193 Ga0207681_10579091 3300025923 Bacteria 926
194 Ga0207681_10808724 3300025923 Bacteria 783
195 Ga0207694_10017481 3300025924 Bacteria 5419
196 Ga0207650_10605312 3300025925 Bacteria 922
197 Ga0207659_10070971 3300025926 Bacteria 2542
198 Ga0207659_11180791 3300025926 Bacteria 658
199 Ga0207659_11196694 3300025926 Bacteria 653
200 Ga0207659_11370563 3300025926 Bacteria 606
201 Ga0207659_11825967 3300025926 Unclassified 516
202 Ga0207644_10012415 3300025931 Bacteria 5658
203 Ga0207644_10372469 3300025931 Bacteria 1163
204 Ga0207644_10433370 3300025931 Bacteria 1078
205 Ga0207644_10862454 3300025931 Bacteria 758
206 Ga0207644_11341035 3300025931 Bacteria 601
207 Ga0207644_11850404 3300025931 Bacteria 505
208 Ga0207690_10089407 3300025932 Bacteria 2172
209 Ga0207706_10006478 3300025933 Bacteria 10869
210 Ga0207706_10029582 3300025933 Bacteria 4889
211 Ga0207706_10182010 3300025933 Bacteria 1845
212 Ga0207706_10369217 3300025933 Bacteria 1246
213 Ga0207686_10413367 3300025934 Bacteria 1030
214 Ga0207686_10915080 3300025934 Bacteria 708
215 Ga0207670_10045746 3300025936 Bacteria 2903
216 Ga0207670_11459844 3300025936 Bacteria 581
217 Ga0207669_10220711 3300025937 Bacteria 1391
218 Ga0207669_10325732 3300025937 Bacteria 1178
219 Ga0207669_11252323 3300025937 Bacteria 629
220 Ga0207704_10032113 3300025938 Bacteria 2967
221 Ga0207704_10429603 3300025938 Bacteria 1049
222 Ga0207691_10027644 3300025940 Bacteria 5317
223 Ga0207691_10223490 3300025940 Bacteria 1632
224 Ga0207691_10381527 3300025940 Bacteria 1203
225 Ga0207691_10855890 3300025940 Bacteria 762
226 Ga0207711_10654699 3300025941 Bacteria 980
227 Ga0207711_11116471 3300025941 Bacteria 729
228 Ga0207689_10047217 3300025942 Bacteria 3557
229 Ga0207689_10047794 3300025942 Bacteria 3530
230 Ga0207689_10065087 3300025942 Bacteria 2999
231 Ga0207689_10102682 3300025942 Bacteria 2349
232 Ga0207689_10341194 3300025942 Bacteria 1244
233 Ga0207689_11108160 3300025942 Bacteria 667
234 Ga0207689_11437485 3300025942 Bacteria 577
235 Ga0207689_11822390 3300025942 Bacteria 502
236 Ga0207661_10036296 3300025944 Bacteria 3846
237 Ga0207661_10147927 3300025944 Bacteria 2028
238 Ga0207679_10236813 3300025945 Bacteria 1544
239 Ga0207679_10348693 3300025945 Bacteria 1290
240 Ga0207679_11121336 3300025945 Bacteria 722
241 Ga0207679_11553523 3300025945 Bacteria 607
242 Ga0207667_10546417 3300025949 Bacteria 1172
243 Ga0207667_10717866 3300025949 Bacteria 1001
244 Ga0207667_11202895 3300025949 Bacteria 737
245 Ga0207651_10034510 3300025960 Bacteria 3277
246 Ga0207651_10461196 3300025960 Bacteria 1092
247 Ga0207651_10662041 3300025960 Bacteria 917
248 Ga0207651_10815727 3300025960 Bacteria 828
249 Ga0207651_10959316 3300025960 Bacteria 763
250 Ga0207712_10032796 3300025961 Bacteria 3507
251 Ga0207712_10892481 3300025961 Bacteria 785
252 Ga0207712_11201589 3300025961 Bacteria 676
253 Ga0207712_12120135 3300025961 Bacteria 503
254 Ga0207668_10891656 3300025972 Bacteria 791
255 Ga0207640_10114278 3300025981 Bacteria 1921
256 Ga0207640_10649980 3300025981 Bacteria 898
257 Ga0207658_10040536 3300025986 Bacteria 3367
258 Ga0207658_10200993 3300025986 Bacteria 1664
259 Ga0207658_10370707 3300025986 Bacteria 1252
260 Ga0207658_10606631 3300025986 Bacteria 984
261 Ga0207658_10772910 3300025986 Bacteria 871
262 Ga0207677_10591421 3300026023 Bacteria 973
263 Ga0207677_10733019 3300026023 Bacteria 879
264 Ga0207677_11040297 3300026023 Bacteria 744
265 Ga0207677_11462678 3300026023 Bacteria 630
266 Ga0207677_12289530 3300026023 Bacteria 503
267 Ga0207703_10050866 3300026035 Bacteria 3355
268 Ga0207703_11278772 3300026035 Bacteria 705
269 Ga0207639_10032251 3300026041 Bacteria 3855
270 Ga0207639_10258646 3300026041 Bacteria 1521
271 Ga0207639_10429206 3300026041 Bacteria 1196
272 Ga0207639_10493718 3300026041 Bacteria 1117
273 Ga0207678_10024172 3300026067 Bacteria 5309
274 Ga0207678_10172238 3300026067 Bacteria 1848
275 Ga0207678_11165599 3300026067 Bacteria 682
276 Ga0207678_11949916 3300026067 Unclassified 512
277 Ga0207678_12030434 3300026067 Bacteria 500
278 Ga0207702_10023864 3300026078 Bacteria 5074
279 Ga0207702_10119403 3300026078 Bacteria 2357
280 Ga0207641_10029136 3300026088 Bacteria 4565
281 Ga0207641_10494973 3300026088 Bacteria 1186
282 Ga0207641_11020793 3300026088 Bacteria 824
283 Ga0207641_11419216 3300026088 Bacteria 695
284 Ga0207641_11425236 3300026088 Bacteria 694
285 Ga0207641_12365858 3300026088 Bacteria 530
286 Ga0207648_10130210 3300026089 Bacteria 2215
287 Ga0207648_10145785 3300026089 Bacteria 2088
288 Ga0207648_10344339 3300026089 Bacteria 1343
289 Ga0207648_12190989 3300026089 Unclassified 513
290 Ga0207676_10077274 3300026095 Bacteria 2693
291 Ga0207676_10159337 3300026095 Bacteria 1953
292 Ga0207676_10192669 3300026095 Bacteria 1795
293 Ga0207676_10237026 3300026095 Bacteria 1634
294 Ga0207676_10237255 3300026095 Bacteria 1634
295 Ga0207676_11447360 3300026095 Bacteria 683
296 Ga0207674_10007100 3300026116 Bacteria 13087
297 Ga0207674_10025546 3300026116 Bacteria 6296
298 Ga0207674_10359316 3300026116 Bacteria 1408
299 Ga0207674_10443833 3300026116 Bacteria 1254
300 Ga0207674_10724073 3300026116 Unclassified 960
301 Ga0207674_11399538 3300026116 Bacteria 669
302 Ga0207675_100104863 3300026118 Bacteria 2664
303 Ga0207675_100114561 3300026118 Bacteria 2547
304 Ga0207675_100270416 3300026118 Bacteria 1649
305 Ga0207675_100922027 3300026118 Bacteria 890
306 Ga0207683_10006890 3300026121 Bacteria 9730
307 Ga0207683_10024454 3300026121 Bacteria 5203
308 Ga0207683_10066421 3300026121 Bacteria 3180
309 Ga0207683_10556120 3300026121 Bacteria 1061
310 Ga0207683_11488625 3300026121 Bacteria 625
311 Ga0207698_10129183 3300026142 Bacteria 2156
312 Ga0207698_10179647 3300026142 Bacteria 1873
313 Ga0207698_10249472 3300026142 Bacteria 1623
314 Ga0207698_11019026 3300026142 Bacteria 839
315 Ga0207698_11124960 3300026142 Bacteria 798
316 Ga0207698_11705521 3300026142 Unclassified 645
317 Ga0207698_11858559 3300026142 Bacteria 617
318 Ga0207698_12551650 3300026142 Bacteria 521
319 Ga0207428_10260319 3300027907 Bacteria 1292
320 Ga0207428_10312408 3300027907 Bacteria 1162
321 Ga0268266_10051036 3300028379 Bacteria 3550
322 Ga0268266_10203042 3300028379 Bacteria 1815
323 Ga0268266_11609564 3300028379 Bacteria 625
324 Ga0268265_10496442 3300028380 Bacteria 1149
325 Ga0268265_11529839 3300028380 Bacteria 671
326 Ga0268264_10024831 3300028381 Bacteria 4896
327 Ga0268264_10314109 3300028381 Bacteria 1479
328 Ga0268264_12494445 3300028381 Bacteria 522
329 Ga0265322_10023100 3300028654 Bacteria 1779
330 Ga0265336_10026760 3300028666 Bacteria 1810
331 Ga0265338_10112920 3300028800 Bacteria 2184
332 Ga0307513_10092596 3300031456 Bacteria 3076
333 Ga0307410_10954993 3300031852 Bacteria 737
334 Ga0307406_10239176 3300031901 Bacteria 1361
335 Ga0307412_11553640 3300031911 Bacteria 603
336 Ga0307416_102469740 3300032002 Bacteria 619
337 Ga0307415_100828686 3300032126 Bacteria 847
338 Ga0316593_10121009 3300032168 Bacteria 940
339 Ga0316592_1001616 3300033524 Bacteria 3695
340 Ga0373944_0049436 3300035089 Bacteria 1322
341 Ga0373923_0132365 3300035111 Bacteria 1122
342 Ga0373954_0134098 3300035118 Bacteria 1206
343 Ga0373956_0182139 3300035119 Bacteria 993
344 Ga0373957_0092950 3300035120 Bacteria 1201
345 Ga0373946_0090550 3300035171 Bacteria 1355
346 Ga0373955_0021670 3300035172 Bacteria 3248
347 Ga0373924_0065656 3300035410 Bacteria 1524
348 Ga0373931_1037711 3300035691 Bacteria 556
349 Ga0373935_0028322 3300035692 Bacteria 3463
350 Ga0373933_0177511 3300035724 Bacteria 1357
351 Ga0373947_1099262 3300035725 Unclassified 542
352 Ga0373937_0002462 3300036401 Bacteria 15390
353 Ga0373925_0067283 3300037068 Bacteria 2702
354 Ga0373925_0187553 3300037068 Bacteria 1640
355 Ga0436365_0399608 3300039437 Bacteria 1280
356 Ga0436365_0781227 3300039437 Bacteria 11182
357 Ga0451791_0774309 3300041451 Bacteria 715
358 Ga0451804_0240540 3300041463 Unclassified 596
359 Ga0451807_0039650 3300041486 Bacteria 1105
360 Ga0451807_2079991 3300041486 Bacteria 508
361 Ga0451839_1108716 3300041496 Bacteria 694
362 Ga0451845_0743078 3300041501 Bacteria 599
363 Ga0451851_1046907 3300041507 Bacteria 1551
364 Ga0451851_1182174 3300041507 Bacteria 797
365 Ga0439445_0049332 3300042004 Bacteria 1133
366 Ga0450921_024250 3300042123 Bacteria 592
367 Ga0439444_0073290 3300042437 Bacteria 737
368 Ga0439459_0119003 3300042438 Bacteria 664
369 Ga0451577_0000433 3300042876 Bacteria 74789
370 Ga0451577_0041532 3300042876 Bacteria 4128
371 Ga0451577_0080589 3300042876 Bacteria 2903
372 Ga0451577_0143230 3300042876 Bacteria 2148
373 Ga0451577_0194181 3300042876 Bacteria 1832
374 Ga0466969_0223706 3300044656 Bacteria 856
375 Ga0466972_0013651 3300044658 Bacteria 4075
376 Ga0453683_0000055 3300044673 Bacteria 192588
377 Ga0453683_0014569 3300044673 Bacteria 5101
378 Ga0453683_0176231 3300044673 Bacteria 1355
379 Ga0466961_0079427 3300044693 Bacteria 2077
380 Ga0453684_0012498 3300044712 Bacteria 13983
381 Ga0453684_0012598 3300044712 Bacteria 13911
382 Ga0453684_0014056 3300044712 Bacteria 12880
383 Ga0453684_0048058 3300044712 Bacteria 5649
384 Ga0453684_0050952 3300044712 Bacteria 5435
385 Ga0453684_0108947 3300044712 Bacteria 3370
386 Ga0453684_0298710 3300044712 Bacteria 1831
387 Ga0453684_0313759 3300044712 Bacteria 1778
388 Ga0453684_0488269 3300044712 Bacteria 1366
389 Ga0453684_0861326 3300044712 Bacteria 973
390 Ga0453684_1061243 3300044712 Bacteria 858
391 Ga0453684_1065117 3300044712 Bacteria 856
392 Ga0466971_0013188 3300044719 Bacteria 3626
393 Ga0466968_0416510 3300044735 Bacteria 660
394 Ga0466970_0262831 3300044765 Bacteria 968
395 Ga0466957_0009999 3300044842 Bacteria 5428
396 Ga0466957_0129769 3300044842 Bacteria 1614
397 Ga0466960_0816250 3300044901 Bacteria 565
398 Ga0466959_0019573 3300045049 Bacteria 4978
399 Ga0451576_0003461 3300045051 Bacteria 21644
400 Ga0451576_0053102 3300045051 Bacteria 4246
401 Ga0451576_0239153 3300045051 Bacteria 1897
402 Ga0451576_0244860 3300045051 Bacteria 1873
403 Ga0451576_0271918 3300045051 Bacteria 1771
404 Ga0451576_0295851 3300045051 Bacteria 1692
405 Ga0451576_0425880 3300045051 Bacteria 1393
406 Ga0451576_0494727 3300045051 Bacteria 1284
407 Ga0451576_1674981 3300045051 Bacteria 659
408 Ga0495592_0152307 3300046454 Bacteria 1598
409 Ga0495653_0047662 3300046463 Bacteria 3314
410 Ga0495580_0250151 3300046472 Bacteria 1214
411 Ga0495582_0106792 3300046473 Bacteria 1571
412 Ga0495639_0357637 3300046475 Bacteria 734
413 Ga0495664_0523282 3300046477 Unclassified 707
414 Ga0495608_0064445 3300046511 Bacteria 2402
415 Ga0495618_0051336 3300046514 Bacteria 2605
416 Ga0495628_0008937 3300046516 Bacteria 8568
417 Ga0495630_0017830 3300046517 Bacteria 5207
418 Ga0495586_0045013 3300046535 Bacteria 2378
419 Ga0495645_0301436 3300046543 Bacteria 1047
420 Ga0495667_0052928 3300046559 Bacteria 2674
421 Ga0495634_0023809 3300046642 Bacteria 4302
422 Ga0495635_0110660 3300046663 Bacteria 1876
423 Ga0495657_0065463 3300046675 Bacteria 2390
424 Ga0495599_0012479 3300046678 Bacteria 5240
425 Ga0495646_0627622 3300046680 Bacteria 544
426 Ga0495647_0300299 3300046681 Bacteria 724
427 Ga0495658_0622784 3300046683 Bacteria 691
428 Ga0495613_0048041 3300046689 Bacteria 3152
429 Ga0495600_0041157 3300046809 Bacteria 3011
430 Ga0495581_0660801 3300047315 Bacteria 604
431 Ga0495674_0323334 3300047319 Bacteria 1256
432 Ga0495672_0121471 3300047320 Bacteria 1387
433 Ga0495680_0099566 3300047322 Bacteria 2167
434 Ga0495675_0049011 3300047444 Bacteria 2686
435 Ga0495684_0070102 3300047471 Bacteria 2665
436 Ga0496104_0911420 3300048907 Bacteria 784
437 Ga0496106_0774919 3300048909 Bacteria 762
438 Ga0496109_1749058 3300048912 Bacteria 555
439 Ga0496111_0103596 3300048914 Bacteria 2093
440 Ga0496114_0117463 3300048917 Bacteria 2285
441 Ga0496114_1063701 3300048917 Bacteria 693
442 Ga0501312_111290 3300049528 Bacteria 522
443 Ga0501032_0084079 3300049569 Bacteria 2116
444 Ga0501034_0201366 3300049571 Bacteria 1949
445 Ga0501036_1468452 3300049572 Bacteria 552
446 Ga0501037_0022979 3300049573 Bacteria 4612
447 Ga0501037_0743891 3300049573 Bacteria 650
448 Ga0501037_0967054 3300049573 Bacteria 556
449 Ga0501043_0560407 3300049579 Bacteria 848
450 Ga0501043_0925919 3300049579 Bacteria 624
451 Ga0501047_0634308 3300049581 Bacteria 889
452 Ga0501047_0715224 3300049581 Bacteria 819
453 Ga0501048_0471974 3300049582 Bacteria 899
454 Ga0501070_0142890 3300049586 Bacteria 1976
455 Ga0501035_0623569 3300049822 Bacteria 877
456 Ga0501044_0020175 3300049823 Bacteria 7113
457 Ga0501044_0284934 3300049823 Bacteria 1585
458 Ga0501044_0470472 3300049823 Bacteria 1161
459 nmdc:mga00v17_817336_c1 3300050491 Bacteria 593
460 nmdc:mga0k408_12089_c1 3300050493 Bacteria 4714
461 nmdc:mga0k408_154606_c1 3300050493 Bacteria 1366
462 nmdc:mga0k408_98050_c1 3300050493 Bacteria 1727
463 nmdc:mga05p37_898400_c1 3300050507 Bacteria 955
464 nmdc:mga08y16_26169_c1 3300050511 Bacteria 6153
465 nmdc:mga08y16_438837_c1 3300050511 Bacteria 1333
466 nmdc:mga08y16_885813_c1 3300050511 Bacteria 880
467 nmdc:mga0rr50_770935_c1 3300050513 Bacteria 821
468 Ga0495595_0610754 3300053084 Bacteria 558
469 Ga0500618_109637 3300053125 Bacteria 623
470 Ga0500603_031035 3300053150 Bacteria 1379
471 Ga0500619_048891 3300053154 Bacteria 1363
472 Ga0500638_288271 3300053162 Unclassified 640
473 Ga0500639_236025 3300053163 Bacteria 747
474 Ga0500636_0029465 3300053177 Bacteria 3243
475 Ga0587080_004508 3300059503 Bacteria 1815
476 Ga0587108_006082 3300059653 Bacteria 925
477 Ga0466962_0021441 3300061719 Bacteria 3102
478 Ga0157372_10580674
479 Ga0070676_10109137
480 Ga0070670_100268411
481 Ga0070670_100390131
482 Ga0070670_100452176
483 Ga0070670_100555590
484 Ga0070677_10060927
485 Ga0070677_10070679
486 Ga0070677_10262844
487 Ga0070677_10294086
488 Ga0068869_100087320
489 Ga0068869_101459031
490 Ga0068869_102165775
491 Ga0068868_100714046
492 Ga0068868_101191300
493 Ga0068868_101279176
494 Ga0068868_101397320
495 Ga0070689_102237392
496 Ga0070692_11411470
497 Ga0070668_100059272
498 Ga0070669_100126368
499 Ga0070669_100844473
500 Ga0070675_100175442
501 Ga0070675_100622377
502 Ga0070671_101681353
503 Ga0070674_100065927
504 Ga0070674_100143489
505 Ga0070674_100761477
506 Ga0070673_100279556
507 Ga0070688_100401068
508 Ga0070688_100428361
509 Ga0070688_100945164
510 Ga0070667_100647031
511 Ga0070667_100739290
512 Ga0070667_100761546
513 Ga0070667_100868918
514 Ga0070667_101063513
515 Ga0070667_102354686
516 Ga0070701_10346256
517 Ga0070700_100548611
518 Ga0070700_100753050
519 Ga0070663_100688115
520 Ga0070663_101192749
521 Ga0070663_102020885
522 Ga0070678_100107406
523 Ga0070678_100200263
524 Ga0070678_101955877
525 Ga0068867_100099746
526 Ga0070685_10293535
527 Ga0070698_100036969
528 Ga0068853_100466130
529 Ga0068853_100718513
530 Ga0068853_100866548
531 Ga0068853_101077065
532 Ga0070672_100064827
533 Ga0070672_100802037
534 Ga0070686_100875192
535 Ga0070665_100392186
536 Ga0068855_100916394
537 Ga0070664_101537344
538 Ga0068857_100330068
539 Ga0068857_102415608
540 Ga0068856_100346135
541 Ga0068856_101578105
542 Ga0068852_100227253
543 Ga0068852_100452055
544 Ga0068852_100892609
545 Ga0068852_101197588
546 Ga0068852_102093378
547 Ga0068859_100011297
548 Ga0068859_100527138
549 Ga0068859_100804066
550 Ga0068859_102038168
551 Ga0068864_100297664
552 Ga0068864_100688975
553 Ga0068864_101472563
554 Ga0068864_102059006
555 Ga0068866_10042338
556 Ga0068861_100590408
557 Ga0068861_100846427
558 Ga0068863_101044579
559 Ga0068863_101131733
560 Ga0068858_100173456
561 Ga0068858_101368795
562 Ga0068858_102046869
563 Ga0068858_102507185
564 Ga0068860_100032482
565 Ga0068860_100827823
566 Ga0068862_100718056
567 Ga0068862_101047281
568 Ga0068862_101969716
569 Ga0081539_10137372
570 Ga0075366_10142814
571 Ga0075366_10575881
572 Ga0075366_10587065
573 Ga0075366_10619515
574 Ga0075366_10724714
575 Ga0097621_100405054
576 Ga0097621_100532410
577 Ga0097621_100978123
578 Ga0097621_102180271
579 Ga0075370_10476588
580 Ga0068871_100297971
581 Ga0068871_100313485
582 Ga0075430_101347742
583 Ga0075434_101688960
584 Ga0075434_101820624
585 Ga0075429_101583558
586 Ga0068865_100345594
587 Ga0068865_100721139
588 Ga0097620_100011297
589 Ga0097620_100527115
590 Ga0097620_100804018
591 Ga0097620_102038240
592 Ga0075435_101260386
593 Ga0105240_10267364
594 Ga0111539_10044551
595 Ga0111539_10560888
596 Ga0105247_10002304
597 Ga0114129_10690307
598 Ga0105243_10894353
599 Ga0105241_10014100
600 Ga0105242_10394296
601 Ga0105242_10717505
602 Ga0105237_10014365
603 Ga0105238_10008067
604 Ga0105249_10059926
605 Ga0105249_10114006
606 Ga0105249_10674147
607 Ga0105249_11454828
608 Ga0105249_12014776
609 Ga0105246_10462754
610 Ga0105246_10673155
611 Ga0157373_10671727
612 Ga0157371_10763877
613 Ga0157370_10339108
614 Ga0157369_11301071
615 Ga0157369_11551431
616 Ga0157374_10441462
617 Ga0157374_10704408
618 Ga0157378_10420066
619 Ga0157378_11677886
620 Ga0163162_10334540
621 Ga0163162_11221627
622 Ga0163162_11274916
623 Ga0163162_11483352
624 Ga0157372_10048397
625 Ga0157372_10347423
626 Ga0157372_10693372
627 Ga0157372_11260486
628 Ga0157372_11725899
629 Ga0157375_10103965
630 Ga0163163_10179071
631 Ga0163163_12250842
632 Ga0157380_10078672
633 Ga0157377_10045304
634 Ga0157377_10753146
635 Ga0157376_10094106
636 Ga0157376_10173652
637 Ga0157376_10280684
638 Ga0157376_11380379
639 Ga0182005_1066448
640 Ga0163161_10005594
641 Ga0163161_11009848
642 Ga0163161_11076549
643 Ga0213876_10007626
644 Ga0213876_10240851
645 Ga0207697_10028260
646 Ga0207656_10334448
647 Ga0207682_10012681
648 Ga0207642_10072928
649 Ga0207642_10316013
650 Ga0207642_10879567
651 Ga0207710_10002332
652 Ga0207680_10038269
653 Ga0207680_10039067
654 Ga0207680_10130538
655 Ga0207647_10107015
656 Ga0207685_10090940
657 Ga0207645_10278126
658 Ga0207643_10093125
659 Ga0207643_10117573
660 Ga0207654_10000881
661 Ga0207707_11331700
662 Ga0207695_10009751
663 Ga0207695_10447497
664 Ga0207671_10003750
665 Ga0207657_10082847
666 Ga0207657_11118955
667 Ga0207649_10024359
668 Ga0207649_11488650
669 Ga0207681_10122939
670 Ga0207681_10579091
671 Ga0207681_10808724
672 Ga0207694_10017481
673 Ga0207650_10605312
674 Ga0207659_10070971
675 Ga0207659_11180791
676 Ga0207659_11196694
677 Ga0207659_11370563
678 Ga0207659_11825967
679 Ga0207644_10012415
680 Ga0207644_10372469
681 Ga0207644_10433370
682 Ga0207644_10862454
683 Ga0207644_11341035
684 Ga0207644_11850404
685 Ga0207690_10089407
686 Ga0207706_10006478
687 Ga0207706_10029582
688 Ga0207706_10182010
689 Ga0207706_10369217
690 Ga0207686_10413367
691 Ga0207686_10915080
692 Ga0207670_10045746
693 Ga0207670_11459844
694 Ga0207669_10220711
695 Ga0207669_10325732
696 Ga0207669_11252323
697 Ga0207704_10032113
698 Ga0207704_10429603
699 Ga0207691_10027644
700 Ga0207691_10223490
701 Ga0207691_10381527
702 Ga0207691_10855890
703 Ga0207711_10654699
704 Ga0207711_11116471
705 Ga0207689_10047217
706 Ga0207689_10047794
707 Ga0207689_10065087
708 Ga0207689_10102682
709 Ga0207689_10341194
710 Ga0207689_11108160
711 Ga0207689_11437485
712 Ga0207689_11822390
713 Ga0207661_10036296
714 Ga0207661_10147927
715 Ga0207679_10236813
716 Ga0207679_10348693
717 Ga0207679_11121336
718 Ga0207679_11553523
719 Ga0207667_10546417
720 Ga0207667_10717866
721 Ga0207667_11202895
722 Ga0207651_10034510
723 Ga0207651_10461196
724 Ga0207651_10662041
725 Ga0207651_10815727
726 Ga0207651_10959316
727 Ga0207712_10032796
728 Ga0207712_10892481
729 Ga0207712_11201589
730 Ga0207712_12120135
731 Ga0207668_10891656
732 Ga0207640_10114278
733 Ga0207640_10649980
734 Ga0207658_10040536
735 Ga0207658_10200993
736 Ga0207658_10370707
737 Ga0207658_10606631
738 Ga0207658_10772910
739 Ga0207677_10591421
740 Ga0207677_10733019
741 Ga0207677_11040297
742 Ga0207677_11462678
743 Ga0207677_12289530
744 Ga0207703_10050866
745 Ga0207703_11278772
746 Ga0207639_10032251
747 Ga0207639_10258646
748 Ga0207639_10429206
749 Ga0207639_10493718
750 Ga0207678_10024172
751 Ga0207678_10172238
752 Ga0207678_11165599
753 Ga0207678_11949916
754 Ga0207678_12030434
755 Ga0207702_10023864
756 Ga0207702_10119403
757 Ga0207641_10029136
758 Ga0207641_10494973
759 Ga0207641_11020793
760 Ga0207641_11419216
761 Ga0207641_11425236
762 Ga0207641_12365858
763 Ga0207648_10130210
764 Ga0207648_10145785
765 Ga0207648_10344339
766 Ga0207648_12190989
767 Ga0207676_10077274
768 Ga0207676_10159337
769 Ga0207676_10192669
770 Ga0207676_10237026
771 Ga0207676_10237255
772 Ga0207676_11447360
773 Ga0207674_10007100
774 Ga0207674_10025546
775 Ga0207674_10359316
776 Ga0207674_10443833
777 Ga0207674_10724073
778 Ga0207674_11399538
779 Ga0207675_100104863
780 Ga0207675_100114561
781 Ga0207675_100270416
782 Ga0207675_100922027
783 Ga0207683_10006890
784 Ga0207683_10024454
785 Ga0207683_10066421
786 Ga0207683_10556120
787 Ga0207683_11488625
788 Ga0207698_10129183
789 Ga0207698_10179647
790 Ga0207698_10249472
791 Ga0207698_11019026
792 Ga0207698_11124960
793 Ga0207698_11705521
794 Ga0207698_11858559
795 Ga0207698_12551650
796 Ga0207428_10260319
797 Ga0207428_10312408
798 Ga0268266_10051036
799 Ga0268266_10203042
800 Ga0268266_11609564
801 Ga0268265_10496442
802 Ga0268265_11529839
803 Ga0268264_10024831
804 Ga0268264_10314109
805 Ga0268264_12494445
806 Ga0265322_10023100
807 Ga0265336_10026760
808 Ga0265338_10112920
809 Ga0307513_10092596
810 Ga0307410_10954993
811 Ga0307406_10239176
812 Ga0307412_11553640
813 Ga0307416_102469740
814 Ga0307415_100828686
815 Ga0316593_10121009
816 Ga0316592_1001616
817 Ga0373944_0049436
818 Ga0373923_0132365
819 Ga0373954_0134098
820 Ga0373956_0182139
821 Ga0373957_0092950
822 Ga0373946_0090550
823 Ga0373955_0021670
824 Ga0373924_0065656
825 Ga0373931_1037711
826 Ga0373935_0028322
827 Ga0373933_0177511
828 Ga0373947_1099262
829 Ga0373937_0002462
830 Ga0373925_0067283
831 Ga0373925_0187553
832 Ga0436365_0399608
833 Ga0436365_0781227
834 Ga0451791_0774309
835 Ga0451804_0240540
836 Ga0451807_0039650
837 Ga0451807_2079991
838 Ga0451839_1108716
839 Ga0451845_0743078
840 Ga0451851_1046907
841 Ga0451851_1182174
842 Ga0439445_0049332
843 Ga0450921_024250
844 Ga0439444_0073290
845 Ga0439459_0119003
846 Ga0451577_0000433
847 Ga0451577_0041532
848 Ga0451577_0080589
849 Ga0451577_0143230
850 Ga0451577_0194181
851 Ga0466969_0223706
852 Ga0466972_0013651
853 Ga0453683_0000055
854 Ga0453683_0014569
855 Ga0453683_0176231
856 Ga0466961_0079427
857 Ga0453684_0012498
858 Ga0453684_0012598
859 Ga0453684_0014056
860 Ga0453684_0048058
861 Ga0453684_0050952
862 Ga0453684_0108947
863 Ga0453684_0298710
864 Ga0453684_0313759
865 Ga0453684_0488269
866 Ga0453684_0861326
867 Ga0453684_1061243
868 Ga0453684_1065117
869 Ga0466971_0013188
870 Ga0466968_0416510
871 Ga0466970_0262831
872 Ga0466957_0009999
873 Ga0466957_0129769
874 Ga0466960_0816250
875 Ga0466959_0019573
876 Ga0451576_0003461
877 Ga0451576_0053102
878 Ga0451576_0239153
879 Ga0451576_0244860
880 Ga0451576_0271918
881 Ga0451576_0295851
882 Ga0451576_0425880
883 Ga0451576_0494727
884 Ga0451576_1674981
885 Ga0495592_0152307
886 Ga0495653_0047662
887 Ga0495580_0250151
888 Ga0495582_0106792
889 Ga0495639_0357637
890 Ga0495664_0523282
891 Ga0495608_0064445
892 Ga0495618_0051336
893 Ga0495628_0008937
894 Ga0495630_0017830
895 Ga0495586_0045013
896 Ga0495645_0301436
897 Ga0495667_0052928
898 Ga0495634_0023809
899 Ga0495635_0110660
900 Ga0495657_0065463
901 Ga0495599_0012479
902 Ga0495646_0627622
903 Ga0495647_0300299
904 Ga0495658_0622784
905 Ga0495613_0048041
906 Ga0495600_0041157
907 Ga0495581_0660801
908 Ga0495674_0323334
909 Ga0495672_0121471
910 Ga0495680_0099566
911 Ga0495675_0049011
912 Ga0495684_0070102
913 Ga0496104_0911420
914 Ga0496106_0774919
915 Ga0496109_1749058
916 Ga0496111_0103596
917 Ga0496114_0117463
918 Ga0496114_1063701
919 Ga0501312_111290
920 Ga0501032_0084079
921 Ga0501034_0201366
922 Ga0501036_1468452
923 Ga0501037_0022979
924 Ga0501037_0743891
925 Ga0501037_0967054
926 Ga0501043_0560407
927 Ga0501043_0925919
928 Ga0501047_0634308
929 Ga0501047_0715224
930 Ga0501048_0471974
931 Ga0501070_0142890
932 Ga0501035_0623569
933 Ga0501044_0020175
934 Ga0501044_0284934
935 Ga0501044_0470472
936 nmdc:mga00v17_817336_c1
937 nmdc:mga0k408_12089_c1
938 nmdc:mga0k408_154606_c1
939 nmdc:mga0k408_98050_c1
940 nmdc:mga05p37_898400_c1
941 nmdc:mga08y16_26169_c1
942 nmdc:mga08y16_438837_c1
943 nmdc:mga08y16_885813_c1
944 nmdc:mga0rr50_770935_c1
945 Ga0495595_0610754
946 Ga0500618_109637
947 Ga0500603_031035
948 Ga0500619_048891
949 Ga0500638_288271
950 Ga0500639_236025
951 Ga0500636_0029465
952 Ga0587080_004508
953 Ga0587108_006082
954 Ga0466962_0021441

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00831

Ribosomal_L29

Ribosomal L29 protein

10

66

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r81-assembly1.cif.gz_j1 structure of the translating neurospora crassa ribosome arrested by cycloheximide 0.9626 10 68
4trh-assembly1.cif.gz_B the legionella effector sidc defines a unique family of ubiquitin ligases important for bacterial phagosomal remodeling 0.9492 16 63
6cp0-assembly1.cif.gz_A sdca in complex with the e2, ubch5c 0.9483 16 62
5dgf-assembly1.cif.gz_O5 complex of yeast 80s ribosome with hypusine-containing/non-modified eif5a and/or a peptidyl-trna analog 0.9366 15 68
8pv1-assembly1.cif.gz_Lh chaetomium thermophilum pre-60s state 6 - pre-5s rotation - l1 intermediate - composite structure 0.9317 13 66
ID Description Score Start End Superfamily
af_Q2FZ34_110_392_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.951 16 66 3.40.630.30
af_Q2FZ34_165_379_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.951 16 66 3.40.630.30
4wceV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9317 13 68 1.10.287.310
4wf9V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.924 13 68 1.10.287.310
4uk8Z01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9216 10 68 1.10.287.310
ID Description Score Start End GO Terms
AF-D8QUJ1-F1-model_v4 PX domain-containing protein 0.9773 16 64 GO:0005768
GO:0016020
GO:0035091
AF-W2UYX2-F1-model_v4 Large ribosomal subunit protein uL29 0.963 9 66 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7V1WRR1-F1-model_v4 Large ribosomal subunit protein uL29 0.9619 6 68 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1E4A9X1-F1-model_v4 Large ribosomal subunit protein uL29 0.9577 14 68 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A0G0WSV2-F1-model_v4 Large ribosomal subunit protein uL29 (50S ribosomal protein L29) 0.9553 6 68 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map