F451627

General Info

Members Datasets Scaffolds Average Seq Length
477 281 954 177

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10003702|JGI25404J52841_100037022
Length 177
Sequence MSVVTADAKPLTFVFEDDGLIPNNPMPFLVYKGAIDVANGHPEKTIEGLFGANGWGAMWRNGVYDFDFVHYHATVHEVLGIARGHAKVRFGGERGKVLEIAAGDVAILPAGTGHQCISSSDDFSVVGAYPPGPPMDLVRPTKEAHARALKTIPKVAVPKTDPVLGADGPLVRLWKRG

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
269 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
270 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
271 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
272 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
273 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
274 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
275 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
276 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
277 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
278 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
279 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
280 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
281 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 1.05
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.5
Nodule 1.26
Rhizoplane 8.6
Rhizosphere 79.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10003702 3300003659 Bacteria 3041
2 JGI25406J46586_10071203 3300003203 Bacteria 1091
3 JGI25404J52841_10006723 3300003659 Bacteria 2414
4 JGI25404J52841_10018517 3300003659 Bacteria 1510
5 Ga0070658_10046728 3300005327 Bacteria 3503
6 Ga0070683_100002275 3300005329 Bacteria 15212
7 Ga0070670_100296020 3300005331 Bacteria 1415
8 Ga0068869_100041213 3300005334 Bacteria 3305
9 Ga0068869_100051649 3300005334 Bacteria 2982
10 Ga0070666_10178249 3300005335 Bacteria 1490
11 Ga0070666_10277551 3300005335 Bacteria 1191
12 Ga0070682_100103546 3300005337 Bacteria 1884
13 Ga0068868_100018419 3300005338 Bacteria 5221
14 Ga0070660_100147542 3300005339 Bacteria 1890
15 Ga0070661_100329025 3300005344 Bacteria 1195
16 Ga0070668_100426248 3300005347 Bacteria 1136
17 Ga0070668_100524801 3300005347 Bacteria 1028
18 Ga0070668_100583910 3300005347 Bacteria 976
19 Ga0070669_100852418 3300005353 Bacteria 776
20 Ga0070675_101108768 3300005354 Bacteria 728
21 Ga0070671_100783308 3300005355 Bacteria 830
22 Ga0070671_100921487 3300005355 Bacteria 764
23 Ga0070671_100964766 3300005355 Bacteria 746
24 Ga0070674_100297473 3300005356 Bacteria 1285
25 Ga0070673_100566694 3300005364 Bacteria 1033
26 Ga0070688_101358555 3300005365 Bacteria 575
27 Ga0070659_100166716 3300005366 Bacteria 1803
28 Ga0070659_100641634 3300005366 Bacteria 915
29 Ga0070667_100067769 3300005367 Bacteria 3035
30 Ga0070709_10112944 3300005434 Bacteria 1829
31 Ga0070714_100124931 3300005435 Bacteria 2293
32 Ga0070714_100520822 3300005435 Bacteria 1136
33 Ga0070711_100182983 3300005439 Bacteria 1605
34 Ga0070711_100587705 3300005439 Bacteria 928
35 Ga0070663_100012548 3300005455 Bacteria 5365
36 Ga0070663_100016538 3300005455 Bacteria 4796
37 Ga0070663_100103987 3300005455 Bacteria 2123
38 Ga0070663_100417815 3300005455 Bacteria 1099
39 Ga0070663_100780797 3300005455 Bacteria 818
40 Ga0070678_100165724 3300005456 Bacteria 1795
41 Ga0070678_100334775 3300005456 Bacteria 1297
42 Ga0070678_100689325 3300005456 Bacteria 919
43 Ga0070662_100183305 3300005457 Bacteria 1652
44 Ga0070681_10006922 3300005458 Bacteria 11040
45 Ga0070681_10024758 3300005458 Bacteria 6038
46 Ga0070681_10230219 3300005458 Bacteria 1768
47 Ga0070681_11370010 3300005458 Bacteria 631
48 Ga0068867_100625310 3300005459 Bacteria 942
49 Ga0068867_101531036 3300005459 Bacteria 622
50 Ga0070706_100341229 3300005467 Bacteria 1397
51 Ga0070707_100831851 3300005468 Bacteria 887
52 Ga0070679_100009813 3300005530 Bacteria 9057
53 Ga0070679_100013572 3300005530 Bacteria 7806
54 Ga0070679_100062202 3300005530 Bacteria 3721
55 Ga0070684_100181142 3300005535 Bacteria 1916
56 Ga0070684_100188642 3300005535 Bacteria 1876
57 Ga0070684_100514870 3300005535 Bacteria 1109
58 Ga0070684_100555240 3300005535 Bacteria 1066
59 Ga0068853_100062039 3300005539 Bacteria 3234
60 Ga0070672_100478726 3300005543 Bacteria 1075
61 Ga0070696_100035206 3300005546 Bacteria 3446
62 Ga0070693_100076288 3300005547 Bacteria 1987
63 Ga0070693_100744096 3300005547 Bacteria 722
64 Ga0070665_100030391 3300005548 Bacteria 5436
65 Ga0070665_100035144 3300005548 Bacteria 5038
66 Ga0070665_100164853 3300005548 Bacteria 2218
67 Ga0070665_100177651 3300005548 Bacteria 2130
68 Ga0070665_100197834 3300005548 Bacteria 2011
69 Ga0070665_100451022 3300005548 Bacteria 1296
70 Ga0068855_100005422 3300005563 Bacteria 15556
71 Ga0068855_100098719 3300005563 Bacteria 3364
72 Ga0068855_100347754 3300005563 Bacteria 1634
73 Ga0068855_100392590 3300005563 Bacteria 1522
74 Ga0068854_100115965 3300005578 Bacteria 2027
75 Ga0068856_100152357 3300005614 Bacteria 2321
76 Ga0070702_100117447 3300005615 Bacteria 1660
77 Ga0070702_100211964 3300005615 Bacteria 1290
78 Ga0068852_100156777 3300005616 Bacteria 2122
79 Ga0068859_100083077 3300005617 Bacteria 3245
80 Ga0068859_100865187 3300005617 Bacteria 990
81 Ga0068864_100012099 3300005618 Bacteria 7128
82 Ga0068866_10348005 3300005718 Bacteria 941
83 Ga0068861_100813147 3300005719 Bacteria 878
84 Ga0068851_10060247 3300005834 Bacteria 1943
85 Ga0068863_100551628 3300005841 Bacteria 1138
86 Ga0068860_100042654 3300005843 Bacteria 4331
87 Ga0068860_100112851 3300005843 Bacteria 2598
88 Ga0068860_100143409 3300005843 Bacteria 2297
89 Ga0068860_100341819 3300005843 Bacteria 1472
90 Ga0068862_100061945 3300005844 Bacteria 3216
91 Ga0068862_100200575 3300005844 Bacteria 1799
92 Ga0068862_100279868 3300005844 Bacteria 1529
93 Ga0081455_10010099 3300005937 Bacteria 9624
94 Ga0081455_10020967 3300005937 Bacteria 6141
95 Ga0081455_10080612 3300005937 Bacteria 2668
96 Ga0081540_1001023 3300005983 Bacteria 25059
97 Ga0081540_1007899 3300005983 Bacteria 7515
98 Ga0081540_1008647 3300005983 Bacteria 7094
99 Ga0081540_1011018 3300005983 Bacteria 6072
100 Ga0081540_1011097 3300005983 Bacteria 6048
101 Ga0081540_1018880 3300005983 Bacteria 4212
102 Ga0081540_1037276 3300005983 Bacteria 2580
103 Ga0081540_1257723 3300005983 Bacteria 607
104 Ga0081539_10039425 3300005985 Bacteria 2787
105 Ga0081539_10076871 3300005985 Bacteria 1767
106 Ga0070717_10163083 3300006028 Bacteria 1935
107 Ga0075368_10009789 3300006042 Bacteria 3456
108 Ga0075363_100151000 3300006048 Bacteria 1311
109 Ga0075363_100179041 3300006048 Bacteria 1205
110 Ga0075364_10011767 3300006051 Bacteria 5328
111 Ga0075364_10312552 3300006051 Bacteria 1070
112 Ga0075432_10083821 3300006058 Bacteria 1159
113 Ga0070715_10192333 3300006163 Bacteria 1031
114 Ga0070712_100015691 3300006175 Bacteria 4882
115 Ga0070712_101362482 3300006175 Bacteria 619
116 Ga0075362_10362579 3300006177 Bacteria 727
117 Ga0075362_10411775 3300006177 Bacteria 683
118 Ga0075367_10036072 3300006178 Bacteria 2865
119 Ga0075367_10047152 3300006178 Bacteria 2534
120 Ga0075367_10212270 3300006178 Bacteria 1210
121 Ga0075369_10105467 3300006186 Bacteria 1267
122 Ga0075366_10073943 3300006195 Bacteria 2032
123 Ga0097621_100021587 3300006237 Bacteria 4984
124 Ga0097621_100222611 3300006237 Bacteria 1645
125 Ga0097621_100414011 3300006237 Bacteria 1209
126 Ga0075370_10384141 3300006353 Bacteria 841
127 Ga0068871_100246869 3300006358 Bacteria 1554
128 Ga0068865_100203612 3300006881 Bacteria 1538
129 Ga0097620_100083080 3300006931 Bacteria 3245
130 Ga0097620_100865177 3300006931 Bacteria 990
131 Ga0099794_10064670 3300007265 Bacteria 1783
132 Ga0099795_10228351 3300007788 Bacteria 795
133 Ga0099795_10253877 3300007788 Bacteria 759
134 Ga0105250_10023033 3300009092 Bacteria 2509
135 Ga0105250_10264106 3300009092 Bacteria 738
136 Ga0105240_10061317 3300009093 Bacteria 4687
137 Ga0105240_10088002 3300009093 Bacteria 3802
138 Ga0105240_10136295 3300009093 Bacteria 2940
139 Ga0105240_10914472 3300009093 Bacteria 943
140 Ga0111539_10030875 3300009094 Bacteria 6512
141 Ga0105245_10047122 3300009098 Bacteria 3852
142 Ga0105245_10454555 3300009098 Bacteria 1290
143 Ga0105247_10053631 3300009101 Bacteria 2488
144 Ga0105243_10275512 3300009148 Bacteria 1513
145 Ga0105243_10474683 3300009148 Bacteria 1179
146 Ga0105243_10804869 3300009148 Bacteria 927
147 Ga0105241_10136464 3300009174 Bacteria 1992
148 Ga0105241_10391625 3300009174 Bacteria 1217
149 Ga0105242_10468971 3300009176 Bacteria 1191
150 Ga0105242_12136302 3300009176 Bacteria 604
151 Ga0105248_10047356 3300009177 Bacteria 4820
152 Ga0105248_10587079 3300009177 Bacteria 1257
153 Ga0105237_10245724 3300009545 Bacteria 1791
154 Ga0105237_10249767 3300009545 Bacteria 1776
155 Ga0105237_10344014 3300009545 Bacteria 1496
156 Ga0105238_10049242 3300009551 Bacteria 4244
157 Ga0105238_10077577 3300009551 Bacteria 3313
158 Ga0105238_10279638 3300009551 Bacteria 1650
159 Ga0105249_10046745 3300009553 Bacteria 3940
160 Ga0105239_10210918 3300010375 Bacteria 2177
161 Ga0105239_10360476 3300010375 Bacteria 1642
162 Ga0105239_11233045 3300010375 Bacteria 862
163 Ga0105246_10030347 3300011119 Bacteria 3569
164 Ga0105246_10179638 3300011119 Bacteria 1628
165 Ga0157370_10045650 3300013104 Bacteria 4202
166 Ga0157370_10708381 3300013104 Bacteria 919
167 Ga0157369_10017758 3300013105 Bacteria 7989
168 Ga0157369_10108352 3300013105 Bacteria 2954
169 Ga0157374_10031293 3300013296 Bacteria 4835
170 Ga0157374_10037475 3300013296 Bacteria 4450
171 Ga0157374_10227169 3300013296 Bacteria 1833
172 Ga0157378_11322611 3300013297 Bacteria 762
173 Ga0163162_10056973 3300013306 Bacteria 3935
174 Ga0163162_10223466 3300013306 Bacteria 2013
175 Ga0157372_10132775 3300013307 Bacteria 2866
176 Ga0157375_10039780 3300013308 Bacteria 4528
177 Ga0157375_10774902 3300013308 Bacteria 1109
178 Ga0157375_10948871 3300013308 Bacteria 1002
179 Ga0163163_10121025 3300014325 Bacteria 2651
180 Ga0163163_10209559 3300014325 Bacteria 1998
181 Ga0157380_10354220 3300014326 Bacteria 1375
182 Ga0182008_10518936 3300014497 Bacteria 658
183 Ga0157377_10419246 3300014745 Bacteria 916
184 Ga0157379_10325246 3300014968 Bacteria 1404
185 Ga0157379_10636869 3300014968 Bacteria 997
186 Ga0163161_10096561 3300017792 Bacteria 2194
187 Ga0197907_10182446 3300020069 Bacteria 1236
188 Ga0206356_11744018 3300020070 Bacteria 696
189 Ga0206350_10372985 3300020080 Bacteria 1003
190 Ga0206353_10865648 3300020082 Bacteria 1327
191 Ga0213876_10079340 3300021384 Bacteria 1735
192 Ga0224712_10064395 3300022467 Bacteria 1470
193 Ga0209758_1004032 3300025297 Bacteria 12667
194 Ga0207692_10126878 3300025898 Bacteria 1436
195 Ga0207642_10286547 3300025899 Bacteria 949
196 Ga0207688_10068374 3300025901 Bacteria 2011
197 Ga0207705_10117640 3300025909 Bacteria 1969
198 Ga0207654_10088789 3300025911 Bacteria 1879
199 Ga0207654_10155595 3300025911 Bacteria 1472
200 Ga0207654_10178676 3300025911 Bacteria 1383
201 Ga0207707_10001660 3300025912 Bacteria 20546
202 Ga0207707_10220417 3300025912 Bacteria 1651
203 Ga0207707_10652711 3300025912 Bacteria 887
204 Ga0207695_10084358 3300025913 Bacteria 3208
205 Ga0207695_10085491 3300025913 Bacteria 3183
206 Ga0207695_10128369 3300025913 Bacteria 2495
207 Ga0207671_10182737 3300025914 Bacteria 1632
208 Ga0207671_10503073 3300025914 Bacteria 966
209 Ga0207671_10697449 3300025914 Bacteria 807
210 Ga0207693_10399484 3300025915 Bacteria 1074
211 Ga0207663_10023383 3300025916 Bacteria 3545
212 Ga0207663_10130179 3300025916 Bacteria 1737
213 Ga0207657_10196301 3300025919 Bacteria 1626
214 Ga0207649_10139543 3300025920 Bacteria 1657
215 Ga0207652_10011572 3300025921 Bacteria 7115
216 Ga0207652_10430838 3300025921 Bacteria 1189
217 Ga0207681_10179658 3300025923 Bacteria 1611
218 Ga0207694_10494583 3300025924 Bacteria 1024
219 Ga0207694_10735606 3300025924 Bacteria 832
220 Ga0207650_10394147 3300025925 Bacteria 1145
221 Ga0207659_10689031 3300025926 Bacteria 875
222 Ga0207687_10038359 3300025927 Bacteria 3274
223 Ga0207687_10058484 3300025927 Bacteria 2712
224 Ga0207664_10520617 3300025929 Bacteria 1066
225 Ga0207644_10399734 3300025931 Bacteria 1123
226 Ga0207706_10088727 3300025933 Bacteria 2718
227 Ga0207706_10105252 3300025933 Bacteria 2483
228 Ga0207686_10173578 3300025934 Bacteria 1522
229 Ga0207709_10201989 3300025935 Bacteria 1420
230 Ga0207709_10543056 3300025935 Bacteria 913
231 Ga0207709_10713341 3300025935 Bacteria 803
232 Ga0207669_10031112 3300025937 Bacteria 2977
233 Ga0207704_10285827 3300025938 Bacteria 1256
234 Ga0207704_10331822 3300025938 Bacteria 1177
235 Ga0207665_10143303 3300025939 Bacteria 1706
236 Ga0207665_10281412 3300025939 Bacteria 1238
237 Ga0207691_10238940 3300025940 Bacteria 1571
238 Ga0207691_10383206 3300025940 Bacteria 1200
239 Ga0207711_10062873 3300025941 Bacteria 3203
240 Ga0207711_10536315 3300025941 Bacteria 1091
241 Ga0207689_10033168 3300025942 Bacteria 4291
242 Ga0207689_10178760 3300025942 Bacteria 1750
243 Ga0207689_10839844 3300025942 Bacteria 775
244 Ga0207661_10002756 3300025944 Bacteria 12095
245 Ga0207661_10005694 3300025944 Bacteria 8788
246 Ga0207679_10063648 3300025945 Bacteria 2754
247 Ga0207667_10004411 3300025949 Bacteria 17229
248 Ga0207667_10164284 3300025949 Bacteria 2283
249 Ga0207667_10200044 3300025949 Bacteria 2050
250 Ga0207667_10314201 3300025949 Bacteria 1600
251 Ga0207667_10324577 3300025949 Bacteria 1572
252 Ga0207651_10413201 3300025960 Bacteria 1150
253 Ga0207668_10010591 3300025972 Bacteria 5577
254 Ga0207668_10397618 3300025972 Bacteria 1164
255 Ga0207668_10590416 3300025972 Bacteria 966
256 Ga0207668_11086044 3300025972 Bacteria 717
257 Ga0207658_10067225 3300025986 Bacteria 2699
258 Ga0207677_10010661 3300026023 Bacteria 5208
259 Ga0207677_10301865 3300026023 Bacteria 1323
260 Ga0207703_10278094 3300026035 Bacteria 1519
261 Ga0207639_10073975 3300026041 Bacteria 2673
262 Ga0207639_10215165 3300026041 Bacteria 1656
263 Ga0207678_10009069 3300026067 Bacteria 8757
264 Ga0207678_10048746 3300026067 Bacteria 3661
265 Ga0207678_10061431 3300026067 Bacteria 3232
266 Ga0207708_10765434 3300026075 Bacteria 829
267 Ga0207702_10462044 3300026078 Bacteria 1233
268 Ga0207702_10488938 3300026078 Bacteria 1198
269 Ga0207702_11158217 3300026078 Bacteria 767
270 Ga0207641_10713423 3300026088 Bacteria 988
271 Ga0207676_10069987 3300026095 Bacteria 2812
272 Ga0207675_100056140 3300026118 Bacteria 3673
273 Ga0207675_100194799 3300026118 Bacteria 1945
274 Ga0207683_10008827 3300026121 Bacteria 8596
275 Ga0207683_10059162 3300026121 Bacteria 3366
276 Ga0207698_10192498 3300026142 Bacteria 1818
277 Ga0207698_10984953 3300026142 Bacteria 853
278 Ga0207428_10263488 3300027907 Bacteria 1283
279 Ga0268266_10005448 3300028379 Bacteria 11859
280 Ga0268266_10144364 3300028379 Bacteria 2138
281 Ga0268266_10341519 3300028379 Bacteria 1405
282 Ga0268266_10497138 3300028379 Bacteria 1164
283 Ga0268265_10017587 3300028380 Bacteria 4938
284 Ga0268265_10133324 3300028380 Bacteria 2068
285 Ga0268264_10132597 3300028381 Bacteria 2211
286 Ga0307517_10000196 3300028786 Bacteria 102384
287 Ga0307517_10084379 3300028786 Bacteria 2674
288 Ga0307515_10020023 3300028794 Bacteria 11980
289 Ga0265325_10035853 3300031241 Bacteria 2631
290 Ga0265339_10135122 3300031249 Bacteria 1258
291 Ga0307513_10232551 3300031456 Bacteria 1655
292 Ga0307513_10266723 3300031456 Bacteria 1498
293 Ga0265342_10213489 3300031712 Bacteria 1042
294 Ga0307413_10513053 3300031824 Bacteria 965
295 Ga0307406_10124251 3300031901 Bacteria 1800
296 Ga0307409_100635335 3300031995 Bacteria 1059
297 Ga0307416_100527906 3300032002 Bacteria 1250
298 Ga0307416_101944510 3300032002 Bacteria 691
299 Ga0373950_0054102 3300034818 Bacteria 794
300 Ga0373926_0022160 3300035083 Bacteria 2204
301 Ga0373926_0047999 3300035083 Bacteria 1535
302 Ga0373944_0099654 3300035089 Bacteria 980
303 Ga0373949_0218415 3300035090 Bacteria 579
304 Ga0373923_0000309 3300035111 Bacteria 10866
305 Ga0373923_0055964 3300035111 Bacteria 1664
306 Ga0373936_0057564 3300035113 Bacteria 1581
307 Ga0373953_0199395 3300035117 Bacteria 865
308 Ga0373954_0207681 3300035118 Bacteria 962
309 Ga0373960_0205111 3300035121 Bacteria 699
310 Ga0373946_0029849 3300035171 Bacteria 2173
311 Ga0373955_0013380 3300035172 Bacteria 3967
312 Ga0373942_0035490 3300035207 Bacteria 1338
313 Ga0373962_0054299 3300035242 Bacteria 1161
314 Ga0373924_0029065 3300035410 Bacteria 2207
315 Ga0373931_0261087 3300035691 Bacteria 1057
316 Ga0373935_0188131 3300035692 Bacteria 1421
317 Ga0373935_0376104 3300035692 Bacteria 1016
318 Ga0373927_0021630 3300035695 Bacteria 4217
319 Ga0373927_0073847 3300035695 Bacteria 2208
320 Ga0373927_0230784 3300035695 Bacteria 1216
321 Ga0373927_0484200 3300035695 Bacteria 817
322 Ga0373933_0242808 3300035724 Bacteria 1158
323 Ga0373947_0543786 3300035725 Bacteria 790
324 Ga0373937_0087582 3300036401 Bacteria 2882
325 Ga0373937_0498700 3300036401 Bacteria 1157
326 Ga0373925_0077456 3300037068 Bacteria 2523
327 Ga0373925_0310707 3300037068 Bacteria 1274
328 Ga0395900_0012874 3300037418 Bacteria 8544
329 Ga0395900_1027036 3300037418 Bacteria 744
330 Ga0395898_0008054 3300037466 Bacteria 11168
331 Ga0395905_0347159 3300037471 Bacteria 1376
332 Ga0395905_0724640 3300037471 Bacteria 897
333 Ga0395901_0218254 3300038443 Bacteria 1994
334 Ga0395901_0860664 3300038443 Bacteria 891
335 Ga0436365_0439872 3300039437 Bacteria 1999
336 Ga0436365_0729527 3300039437 Bacteria 937
337 Ga0436363_0251880 3300039450 Bacteria 1631
338 Ga0451853_1794490 3300041512 Bacteria 1307
339 Ga0466967_0237730 3300045976 Bacteria 1736
340 Ga0466967_1106753 3300045976 Bacteria 789
341 Ga0495603_0048070 3300046455 Bacteria 2540
342 Ga0495629_0284389 3300046459 Bacteria 1134
343 Ga0495580_0649608 3300046472 Bacteria 694
344 Ga0495605_0431096 3300046474 Bacteria 545
345 Ga0495639_0105960 3300046475 Bacteria 1331
346 Ga0495664_0016515 3300046477 Bacteria 4207
347 Ga0495664_0081705 3300046477 Bacteria 1937
348 Ga0495664_0518234 3300046477 Bacteria 711
349 Ga0495585_0082948 3300046492 Bacteria 1735
350 Ga0495607_0276299 3300046501 Bacteria 799
351 Ga0495608_0669660 3300046511 Bacteria 619
352 Ga0495618_0262664 3300046514 Bacteria 1081
353 Ga0495630_0598305 3300046517 Bacteria 845
354 Ga0495631_0132980 3300046518 Bacteria 1069
355 Ga0495652_0191355 3300046529 Bacteria 1561
356 Ga0495665_0022480 3300046531 Bacteria 3390
357 Ga0495586_0086595 3300046535 Bacteria 1727
358 Ga0495586_0141230 3300046535 Bacteria 1352
359 Ga0495598_0251989 3300046537 Bacteria 654
360 Ga0495621_0126726 3300046539 Bacteria 991
361 Ga0495645_0004496 3300046543 Bacteria 9511
362 Ga0495645_0234435 3300046543 Bacteria 1228
363 Ga0495645_0263596 3300046543 Bacteria 1140
364 Ga0495656_0065680 3300046615 Bacteria 1596
365 Ga0495668_0094057 3300046616 Bacteria 1641
366 Ga0495668_0370900 3300046616 Bacteria 786
367 Ga0495634_0618528 3300046642 Bacteria 627
368 Ga0495635_0134943 3300046663 Bacteria 1682
369 Ga0495635_0601637 3300046663 Bacteria 718
370 Ga0495599_0065593 3300046678 Bacteria 2268
371 Ga0495599_0353385 3300046678 Bacteria 881
372 Ga0495647_0077895 3300046681 Bacteria 1339
373 Ga0495669_0006323 3300046684 Bacteria 4948
374 Ga0495669_0120743 3300046684 Bacteria 1228
375 Ga0495624_0214325 3300046690 Bacteria 1168
376 Ga0495624_0458377 3300046690 Bacteria 764
377 Ga0495671_0407568 3300046692 Bacteria 651
378 Ga0495589_0192392 3300046794 Bacteria 965
379 Ga0495600_0064953 3300046809 Bacteria 2386
380 Ga0495581_0046175 3300047315 Bacteria 2516
381 Ga0495581_0062551 3300047315 Bacteria 2151
382 Ga0495581_0641322 3300047315 Bacteria 614
383 Ga0495636_0208143 3300047318 Bacteria 895
384 Ga0495674_0009235 3300047319 Bacteria 9370
385 Ga0495675_0408515 3300047444 Bacteria 791
386 Ga0495684_0004006 3300047471 Bacteria 11492
387 Ga0495686_0142415 3300047472 Bacteria 1414
388 Ga0496100_0011382 3300048903 Bacteria 5063
389 Ga0496100_0037122 3300048903 Bacteria 3078
390 Ga0496100_0175084 3300048903 Bacteria 1548
391 Ga0496101_0002155 3300048904 Bacteria 12022
392 Ga0496101_0019887 3300048904 Bacteria 4591
393 Ga0496101_0557361 3300048904 Bacteria 906
394 Ga0496102_0026719 3300048905 Bacteria 5151
395 Ga0496102_0061947 3300048905 Bacteria 3425
396 Ga0496102_0715430 3300048905 Bacteria 924
397 Ga0496102_0935595 3300048905 Bacteria 788
398 Ga0496103_0018497 3300048906 Bacteria 4179
399 Ga0496105_0025831 3300048908 Bacteria 4784
400 Ga0496105_0060063 3300048908 Bacteria 3136
401 Ga0496105_0941167 3300048908 Bacteria 649
402 Ga0496106_0002840 3300048909 Bacteria 12855
403 Ga0496106_0013613 3300048909 Bacteria 6005
404 Ga0496106_0577250 3300048909 Bacteria 901
405 Ga0496107_0002239 3300048910 Bacteria 12464
406 Ga0496107_0042226 3300048910 Bacteria 3275
407 Ga0496107_0452828 3300048910 Bacteria 953
408 Ga0496107_0455807 3300048910 Bacteria 950
409 Ga0496108_0016657 3300048911 Bacteria 6003
410 Ga0496108_0210361 3300048911 Bacteria 1688
411 Ga0496108_0302093 3300048911 Bacteria 1394
412 Ga0496109_0104065 3300048912 Bacteria 2635
413 Ga0496109_0141812 3300048912 Bacteria 2247
414 Ga0496109_0152166 3300048912 Bacteria 2166
415 Ga0496109_0484013 3300048912 Bacteria 1168
416 Ga0496110_0018834 3300048913 Bacteria 5799
417 Ga0496110_0019982 3300048913 Bacteria 5646
418 Ga0496110_0034906 3300048913 Bacteria 4359
419 Ga0496111_0046980 3300048914 Bacteria 3109
420 Ga0496111_0258643 3300048914 Bacteria 1292
421 Ga0496112_0016426 3300048915 Bacteria 6934
422 Ga0496112_0090517 3300048915 Bacteria 3028
423 Ga0496112_0124661 3300048915 Bacteria 2547
424 Ga0496113_0090333 3300048916 Bacteria 2359
425 Ga0496113_0118500 3300048916 Bacteria 2067
426 Ga0496114_0145608 3300048917 Bacteria 2053
427 Ga0496114_0522321 3300048917 Bacteria 1050
428 Ga0496115_0005149 3300048918 Bacteria 9512
429 Ga0496121_0037770 3300048924 Bacteria 4284
430 Ga0496121_0411375 3300048924 Bacteria 883
431 Ga0496123_0282581 3300048926 Bacteria 801
432 Ga0496126_0005900 3300048929 Bacteria 13814
433 Ga0496126_0009574 3300048929 Bacteria 10276
434 Ga0496126_0013365 3300048929 Bacteria 8355
435 Ga0496126_0171874 3300048929 Bacteria 1845
436 Ga0496126_0204370 3300048929 Bacteria 1666
437 Ga0496126_0651582 3300048929 Bacteria 824
438 Ga0501046_0013515 3300049580 Bacteria 6910
439 Ga0501047_0225812 3300049581 Bacteria 1727
440 Ga0501067_0366385 3300049583 Bacteria 803
441 Ga0501075_0369678 3300049591 Bacteria 1093
442 Ga0501076_0312573 3300049592 Bacteria 1289
443 Ga0501076_0625342 3300049592 Bacteria 888
444 Ga0501080_0044802 3300049742 Bacteria 4117
445 Ga0501044_0049522 3300049823 Bacteria 4337
446 nmdc:mga03n38_109595_c1 3300050490 Bacteria 1343
447 nmdc:mga00v17_286084_c1 3300050491 Bacteria 1070
448 nmdc:mga0yw44_333349_c1 3300050492 Bacteria 644
449 nmdc:mga0yw44_507531_c1 3300050492 Bacteria 818
450 nmdc:mga06z11_139242_c1 3300050494 Bacteria 1370
451 nmdc:mga06z11_281812_c1 3300050494 Bacteria 985
452 nmdc:mga06z11_510777_c1 3300050494 Bacteria 728
453 nmdc:mga07m45_6805_c1 3300050496 Bacteria 5808
454 nmdc:mga09592_1129596_c1 3300050508 Bacteria 650
455 nmdc:mga08y16_300437_c1 3300050511 Bacteria 1655
456 nmdc:mga0n895_169038_c1 3300050512 Bacteria 2218
457 nmdc:mga0rr50_318202_c1 3300050513 Bacteria 1304
458 nmdc:mga0sz30_229638_c1 3300050516 Bacteria 825
459 nmdc:mga0sz30_5739_c2 3300050516 Bacteria 1055
460 Ga0495601_0044071 3300053077 Bacteria 2804
461 Ga0495601_0265541 3300053077 Bacteria 1120
462 Ga0495612_0063641 3300053078 Bacteria 1530
463 Ga0495595_0010841 3300053084 Bacteria 3801
464 Ga0500566_0016522 3300053094 Bacteria 4333
465 Ga0500595_002094 3300053119 Bacteria 10199
466 Ga0500658_0101381 3300053134 Bacteria 1257
467 Ga0500638_034572 3300053162 Bacteria 2446
468 Ga0500636_0121759 3300053177 Bacteria 1463
469 Ga0500637_0203911 3300053178 Bacteria 1124
470 Ga0500661_001267 3300055283 Bacteria 4714
471 2524469128 2524023210 Bacteria 9029266
472 2728751957 2728368998 Bacteria 8720350
473 2903771451 2903768456 Bacteria 9749579
474 2935636253 2935630451 Bacteria 8169952
475 2941512884 2941507105 Bacteria 8166816
476 2941520814 2941515067 Bacteria 8166720
477 2941528829 2941523033 Bacteria 8169134
478 JGI25404J52841_10003702
479 JGI25406J46586_10071203
480 JGI25404J52841_10006723
481 JGI25404J52841_10018517
482 Ga0070658_10046728
483 Ga0070683_100002275
484 Ga0070670_100296020
485 Ga0068869_100041213
486 Ga0068869_100051649
487 Ga0070666_10178249
488 Ga0070666_10277551
489 Ga0070682_100103546
490 Ga0068868_100018419
491 Ga0070660_100147542
492 Ga0070661_100329025
493 Ga0070668_100426248
494 Ga0070668_100524801
495 Ga0070668_100583910
496 Ga0070669_100852418
497 Ga0070675_101108768
498 Ga0070671_100783308
499 Ga0070671_100921487
500 Ga0070671_100964766
501 Ga0070674_100297473
502 Ga0070673_100566694
503 Ga0070688_101358555
504 Ga0070659_100166716
505 Ga0070659_100641634
506 Ga0070667_100067769
507 Ga0070709_10112944
508 Ga0070714_100124931
509 Ga0070714_100520822
510 Ga0070711_100182983
511 Ga0070711_100587705
512 Ga0070663_100012548
513 Ga0070663_100016538
514 Ga0070663_100103987
515 Ga0070663_100417815
516 Ga0070663_100780797
517 Ga0070678_100165724
518 Ga0070678_100334775
519 Ga0070678_100689325
520 Ga0070662_100183305
521 Ga0070681_10006922
522 Ga0070681_10024758
523 Ga0070681_10230219
524 Ga0070681_11370010
525 Ga0068867_100625310
526 Ga0068867_101531036
527 Ga0070706_100341229
528 Ga0070707_100831851
529 Ga0070679_100009813
530 Ga0070679_100013572
531 Ga0070679_100062202
532 Ga0070684_100181142
533 Ga0070684_100188642
534 Ga0070684_100514870
535 Ga0070684_100555240
536 Ga0068853_100062039
537 Ga0070672_100478726
538 Ga0070696_100035206
539 Ga0070693_100076288
540 Ga0070693_100744096
541 Ga0070665_100030391
542 Ga0070665_100035144
543 Ga0070665_100164853
544 Ga0070665_100177651
545 Ga0070665_100197834
546 Ga0070665_100451022
547 Ga0068855_100005422
548 Ga0068855_100098719
549 Ga0068855_100347754
550 Ga0068855_100392590
551 Ga0068854_100115965
552 Ga0068856_100152357
553 Ga0070702_100117447
554 Ga0070702_100211964
555 Ga0068852_100156777
556 Ga0068859_100083077
557 Ga0068859_100865187
558 Ga0068864_100012099
559 Ga0068866_10348005
560 Ga0068861_100813147
561 Ga0068851_10060247
562 Ga0068863_100551628
563 Ga0068860_100042654
564 Ga0068860_100112851
565 Ga0068860_100143409
566 Ga0068860_100341819
567 Ga0068862_100061945
568 Ga0068862_100200575
569 Ga0068862_100279868
570 Ga0081455_10010099
571 Ga0081455_10020967
572 Ga0081455_10080612
573 Ga0081540_1001023
574 Ga0081540_1007899
575 Ga0081540_1008647
576 Ga0081540_1011018
577 Ga0081540_1011097
578 Ga0081540_1018880
579 Ga0081540_1037276
580 Ga0081540_1257723
581 Ga0081539_10039425
582 Ga0081539_10076871
583 Ga0070717_10163083
584 Ga0075368_10009789
585 Ga0075363_100151000
586 Ga0075363_100179041
587 Ga0075364_10011767
588 Ga0075364_10312552
589 Ga0075432_10083821
590 Ga0070715_10192333
591 Ga0070712_100015691
592 Ga0070712_101362482
593 Ga0075362_10362579
594 Ga0075362_10411775
595 Ga0075367_10036072
596 Ga0075367_10047152
597 Ga0075367_10212270
598 Ga0075369_10105467
599 Ga0075366_10073943
600 Ga0097621_100021587
601 Ga0097621_100222611
602 Ga0097621_100414011
603 Ga0075370_10384141
604 Ga0068871_100246869
605 Ga0068865_100203612
606 Ga0097620_100083080
607 Ga0097620_100865177
608 Ga0099794_10064670
609 Ga0099795_10228351
610 Ga0099795_10253877
611 Ga0105250_10023033
612 Ga0105250_10264106
613 Ga0105240_10061317
614 Ga0105240_10088002
615 Ga0105240_10136295
616 Ga0105240_10914472
617 Ga0111539_10030875
618 Ga0105245_10047122
619 Ga0105245_10454555
620 Ga0105247_10053631
621 Ga0105243_10275512
622 Ga0105243_10474683
623 Ga0105243_10804869
624 Ga0105241_10136464
625 Ga0105241_10391625
626 Ga0105242_10468971
627 Ga0105242_12136302
628 Ga0105248_10047356
629 Ga0105248_10587079
630 Ga0105237_10245724
631 Ga0105237_10249767
632 Ga0105237_10344014
633 Ga0105238_10049242
634 Ga0105238_10077577
635 Ga0105238_10279638
636 Ga0105249_10046745
637 Ga0105239_10210918
638 Ga0105239_10360476
639 Ga0105239_11233045
640 Ga0105246_10030347
641 Ga0105246_10179638
642 Ga0157370_10045650
643 Ga0157370_10708381
644 Ga0157369_10017758
645 Ga0157369_10108352
646 Ga0157374_10031293
647 Ga0157374_10037475
648 Ga0157374_10227169
649 Ga0157378_11322611
650 Ga0163162_10056973
651 Ga0163162_10223466
652 Ga0157372_10132775
653 Ga0157375_10039780
654 Ga0157375_10774902
655 Ga0157375_10948871
656 Ga0163163_10121025
657 Ga0163163_10209559
658 Ga0157380_10354220
659 Ga0182008_10518936
660 Ga0157377_10419246
661 Ga0157379_10325246
662 Ga0157379_10636869
663 Ga0163161_10096561
664 Ga0197907_10182446
665 Ga0206356_11744018
666 Ga0206350_10372985
667 Ga0206353_10865648
668 Ga0213876_10079340
669 Ga0224712_10064395
670 Ga0209758_1004032
671 Ga0207692_10126878
672 Ga0207642_10286547
673 Ga0207688_10068374
674 Ga0207705_10117640
675 Ga0207654_10088789
676 Ga0207654_10155595
677 Ga0207654_10178676
678 Ga0207707_10001660
679 Ga0207707_10220417
680 Ga0207707_10652711
681 Ga0207695_10084358
682 Ga0207695_10085491
683 Ga0207695_10128369
684 Ga0207671_10182737
685 Ga0207671_10503073
686 Ga0207671_10697449
687 Ga0207693_10399484
688 Ga0207663_10023383
689 Ga0207663_10130179
690 Ga0207657_10196301
691 Ga0207649_10139543
692 Ga0207652_10011572
693 Ga0207652_10430838
694 Ga0207681_10179658
695 Ga0207694_10494583
696 Ga0207694_10735606
697 Ga0207650_10394147
698 Ga0207659_10689031
699 Ga0207687_10038359
700 Ga0207687_10058484
701 Ga0207664_10520617
702 Ga0207644_10399734
703 Ga0207706_10088727
704 Ga0207706_10105252
705 Ga0207686_10173578
706 Ga0207709_10201989
707 Ga0207709_10543056
708 Ga0207709_10713341
709 Ga0207669_10031112
710 Ga0207704_10285827
711 Ga0207704_10331822
712 Ga0207665_10143303
713 Ga0207665_10281412
714 Ga0207691_10238940
715 Ga0207691_10383206
716 Ga0207711_10062873
717 Ga0207711_10536315
718 Ga0207689_10033168
719 Ga0207689_10178760
720 Ga0207689_10839844
721 Ga0207661_10002756
722 Ga0207661_10005694
723 Ga0207679_10063648
724 Ga0207667_10004411
725 Ga0207667_10164284
726 Ga0207667_10200044
727 Ga0207667_10314201
728 Ga0207667_10324577
729 Ga0207651_10413201
730 Ga0207668_10010591
731 Ga0207668_10397618
732 Ga0207668_10590416
733 Ga0207668_11086044
734 Ga0207658_10067225
735 Ga0207677_10010661
736 Ga0207677_10301865
737 Ga0207703_10278094
738 Ga0207639_10073975
739 Ga0207639_10215165
740 Ga0207678_10009069
741 Ga0207678_10048746
742 Ga0207678_10061431
743 Ga0207708_10765434
744 Ga0207702_10462044
745 Ga0207702_10488938
746 Ga0207702_11158217
747 Ga0207641_10713423
748 Ga0207676_10069987
749 Ga0207675_100056140
750 Ga0207675_100194799
751 Ga0207683_10008827
752 Ga0207683_10059162
753 Ga0207698_10192498
754 Ga0207698_10984953
755 Ga0207428_10263488
756 Ga0268266_10005448
757 Ga0268266_10144364
758 Ga0268266_10341519
759 Ga0268266_10497138
760 Ga0268265_10017587
761 Ga0268265_10133324
762 Ga0268264_10132597
763 Ga0307517_10000196
764 Ga0307517_10084379
765 Ga0307515_10020023
766 Ga0265325_10035853
767 Ga0265339_10135122
768 Ga0307513_10232551
769 Ga0307513_10266723
770 Ga0265342_10213489
771 Ga0307413_10513053
772 Ga0307406_10124251
773 Ga0307409_100635335
774 Ga0307416_100527906
775 Ga0307416_101944510
776 Ga0373950_0054102
777 Ga0373926_0022160
778 Ga0373926_0047999
779 Ga0373944_0099654
780 Ga0373949_0218415
781 Ga0373923_0000309
782 Ga0373923_0055964
783 Ga0373936_0057564
784 Ga0373953_0199395
785 Ga0373954_0207681
786 Ga0373960_0205111
787 Ga0373946_0029849
788 Ga0373955_0013380
789 Ga0373942_0035490
790 Ga0373962_0054299
791 Ga0373924_0029065
792 Ga0373931_0261087
793 Ga0373935_0188131
794 Ga0373935_0376104
795 Ga0373927_0021630
796 Ga0373927_0073847
797 Ga0373927_0230784
798 Ga0373927_0484200
799 Ga0373933_0242808
800 Ga0373947_0543786
801 Ga0373937_0087582
802 Ga0373937_0498700
803 Ga0373925_0077456
804 Ga0373925_0310707
805 Ga0395900_0012874
806 Ga0395900_1027036
807 Ga0395898_0008054
808 Ga0395905_0347159
809 Ga0395905_0724640
810 Ga0395901_0218254
811 Ga0395901_0860664
812 Ga0436365_0439872
813 Ga0436365_0729527
814 Ga0436363_0251880
815 Ga0451853_1794490
816 Ga0466967_0237730
817 Ga0466967_1106753
818 Ga0495603_0048070
819 Ga0495629_0284389
820 Ga0495580_0649608
821 Ga0495605_0431096
822 Ga0495639_0105960
823 Ga0495664_0016515
824 Ga0495664_0081705
825 Ga0495664_0518234
826 Ga0495585_0082948
827 Ga0495607_0276299
828 Ga0495608_0669660
829 Ga0495618_0262664
830 Ga0495630_0598305
831 Ga0495631_0132980
832 Ga0495652_0191355
833 Ga0495665_0022480
834 Ga0495586_0086595
835 Ga0495586_0141230
836 Ga0495598_0251989
837 Ga0495621_0126726
838 Ga0495645_0004496
839 Ga0495645_0234435
840 Ga0495645_0263596
841 Ga0495656_0065680
842 Ga0495668_0094057
843 Ga0495668_0370900
844 Ga0495634_0618528
845 Ga0495635_0134943
846 Ga0495635_0601637
847 Ga0495599_0065593
848 Ga0495599_0353385
849 Ga0495647_0077895
850 Ga0495669_0006323
851 Ga0495669_0120743
852 Ga0495624_0214325
853 Ga0495624_0458377
854 Ga0495671_0407568
855 Ga0495589_0192392
856 Ga0495600_0064953
857 Ga0495581_0046175
858 Ga0495581_0062551
859 Ga0495581_0641322
860 Ga0495636_0208143
861 Ga0495674_0009235
862 Ga0495675_0408515
863 Ga0495684_0004006
864 Ga0495686_0142415
865 Ga0496100_0011382
866 Ga0496100_0037122
867 Ga0496100_0175084
868 Ga0496101_0002155
869 Ga0496101_0019887
870 Ga0496101_0557361
871 Ga0496102_0026719
872 Ga0496102_0061947
873 Ga0496102_0715430
874 Ga0496102_0935595
875 Ga0496103_0018497
876 Ga0496105_0025831
877 Ga0496105_0060063
878 Ga0496105_0941167
879 Ga0496106_0002840
880 Ga0496106_0013613
881 Ga0496106_0577250
882 Ga0496107_0002239
883 Ga0496107_0042226
884 Ga0496107_0452828
885 Ga0496107_0455807
886 Ga0496108_0016657
887 Ga0496108_0210361
888 Ga0496108_0302093
889 Ga0496109_0104065
890 Ga0496109_0141812
891 Ga0496109_0152166
892 Ga0496109_0484013
893 Ga0496110_0018834
894 Ga0496110_0019982
895 Ga0496110_0034906
896 Ga0496111_0046980
897 Ga0496111_0258643
898 Ga0496112_0016426
899 Ga0496112_0090517
900 Ga0496112_0124661
901 Ga0496113_0090333
902 Ga0496113_0118500
903 Ga0496114_0145608
904 Ga0496114_0522321
905 Ga0496115_0005149
906 Ga0496121_0037770
907 Ga0496121_0411375
908 Ga0496123_0282581
909 Ga0496126_0005900
910 Ga0496126_0009574
911 Ga0496126_0013365
912 Ga0496126_0171874
913 Ga0496126_0204370
914 Ga0496126_0651582
915 Ga0501046_0013515
916 Ga0501047_0225812
917 Ga0501067_0366385
918 Ga0501075_0369678
919 Ga0501076_0312573
920 Ga0501076_0625342
921 Ga0501080_0044802
922 Ga0501044_0049522
923 nmdc:mga03n38_109595_c1
924 nmdc:mga00v17_286084_c1
925 nmdc:mga0yw44_333349_c1
926 nmdc:mga0yw44_507531_c1
927 nmdc:mga06z11_139242_c1
928 nmdc:mga06z11_281812_c1
929 nmdc:mga06z11_510777_c1
930 nmdc:mga07m45_6805_c1
931 nmdc:mga09592_1129596_c1
932 nmdc:mga08y16_300437_c1
933 nmdc:mga0n895_169038_c1
934 nmdc:mga0rr50_318202_c1
935 nmdc:mga0sz30_229638_c1
936 nmdc:mga0sz30_5739_c2
937 Ga0495601_0044071
938 Ga0495601_0265541
939 Ga0495612_0063641
940 Ga0495595_0010841
941 Ga0500566_0016522
942 Ga0500595_002094
943 Ga0500658_0101381
944 Ga0500638_034572
945 Ga0500636_0121759
946 Ga0500637_0203911
947 Ga0500661_001267
948 2524469128
949 2728751957
950 2903771451
951 2935636253
952 2941512884
953 2941520814
954 2941528829

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dl3-assembly4.cif.gz_I crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 . 0.7951 63 127
6dq9-assembly1.cif.gz_A linked kdm5a jmj domain bound to the covalent inhibitor n69 i.e. [2-((3-acrylamidophenyl)(2-(piperidin-1-yl)ethoxy)methyl)thieno[3,2-b]pyridine-7-carboxylic acid] 0.7693 58 128
3ksc-assembly2.cif.gz_F crystal structure of pea prolegumin, an 11s seed globulin from pisum sativum l. 0.7659 66 137
3ksc-assembly2.cif.gz_D crystal structure of pea prolegumin, an 11s seed globulin from pisum sativum l. 0.7622 66 137
6dq8-assembly1.cif.gz_A linked kdm5a jmj domain bound to the inhibitor n49 i.e. 2-((2-chlorophenyl)(2-(1-methylpyrrolidin-2-yl)ethoxy)methyl)thieno[3,2-b]pyridine-7-carboxylic acid 0.761 56 128
ID Description Score Start End Superfamily
af_A0A1D6KN98_1_91_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8042 68 135 2.60.120.10
af_P37673_1_152_2.60.120.370 Mainly Beta;Sandwich;Jelly Rolls;YhcH/YjgK/YiaL 0.7879 58 128 2.60.120.370
3al6C01 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.783 66 132 2.60.120.650
3dl3I00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7804 63 127 2.60.120.10
af_P09377_6_85_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7724 57 126 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0R3DI04-F1-model_v4 deleted 0.9795 1 174
AF-A0A6P1REI5-F1-model_v4 Cupin domain-containing protein 0.9774 1 172
AF-A0A0S6UIS9-F1-model_v4 Uncharacterized protein containing double-stranded beta helix domain 0.9762 15 172
AF-A0A0R3DI04-F1-model_v4 deleted 0.974 1 174
AF-A0A849TI05-F1-model_v4 Cupin 0.973 9 164

Map