F451583

General Info

Members Datasets Scaffolds Average Seq Length
476 269 449 200

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0035954|Ga0495672_0035954_726_1415
Length 229
Sequence MIELFYPVQIISFEPAGLLRTPMTSLPNLLTSARLILALFMFVALAAAAGAMPYLSAQLTPGMQFALERWAFIAFVVAAVTDFFDGWLARKLHATSVWGAILDPIGDKVLVCGAVLALLALGPQPMVVLPAGLILFREFTVSALREVGAGKGVKLPVTLLAKWKTTLQLTALGFELFVACWGAFGLPDSPQVQGPVAAVAHGLFWLAALVTLITGVQYWEQTRKALKGL

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
18 2818991435 Caulobacter henricii 536 Isolate Unclassified
19 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
20 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
21 2849560528 Caulobacter zeae 410 Isolate Unclassified
22 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
23 2851153111 Caulobacter radicis 736 Isolate Unclassified
24 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
25 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
26 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
27 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
159 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
240 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
241 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
242 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
243 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
244 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
245 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
248 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
249 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
250 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
251 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
252 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
253 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
254 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
255 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
256 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
257 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
258 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
259 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
260 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
261 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
265 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
266 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
267 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
268 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
269 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.33
Metatranscriptomes 0
Isolates 5.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.8
Nodule 0
Rhizoplane 3.15
Rhizosphere 67.44
Stem 0
Stem Tuber 0
Unclassified 8.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10085298 3300003215 Bacteria 776
2 Ga0055537_1002067 3300003773 Bacteria 7067
3 Ga0055524_1020102 3300003775 Bacteria 2261
4 Ga0055528_1004560 3300003790 Bacteria 6643
5 Ga0055530_10000762 3300003791 Bacteria 26807
6 Ga0055540_1039737 3300003792 Bacteria 1023
7 Ga0055531_10000915 3300003794 Bacteria 23931
8 Ga0055531_10001299 3300003794 Bacteria 18822
9 Ga0065165_1000897 3300005262 Bacteria 38449
10 Ga0065165_1005319 3300005262 Bacteria 7316
11 Ga0070658_10164836 3300005327 Bacteria 1860
12 Ga0070670_100000122 3300005331 Bacteria 72250
13 Ga0070670_100045106 3300005331 Bacteria 3789
14 Ga0070670_100313192 3300005331 Bacteria 1374
15 Ga0070670_100363680 3300005331 Bacteria 1273
16 Ga0070666_10065158 3300005335 Bacteria 2472
17 Ga0070666_10149353 3300005335 Bacteria 1630
18 Ga0070680_100025970 3300005336 Bacteria 4684
19 Ga0070660_100020149 3300005339 Bacteria 4897
20 Ga0070668_100001050 3300005347 Bacteria 19390
21 Ga0070668_100091341 3300005347 Bacteria 2400
22 Ga0070668_100141884 3300005347 Bacteria 1937
23 Ga0070669_100128817 3300005353 Bacteria 1939
24 Ga0070671_100009492 3300005355 Bacteria 7809
25 Ga0070671_100219862 3300005355 Bacteria 1611
26 Ga0070673_100286620 3300005364 Bacteria 1446
27 Ga0070659_100001580 3300005366 Bacteria 16403
28 Ga0070659_100006490 3300005366 Bacteria 8443
29 Ga0070667_100000305 3300005367 Bacteria 54805
30 Ga0070667_100001243 3300005367 Bacteria 23143
31 Ga0070667_100016487 3300005367 Bacteria 6114
32 Ga0070667_100299465 3300005367 Bacteria 1448
33 Ga0070667_100508122 3300005367 Bacteria 1105
34 Ga0070681_10039891 3300005458 Bacteria 4707
35 Ga0070681_10107042 3300005458 Bacteria 2737
36 Ga0070679_100011555 3300005530 Bacteria 8415
37 Ga0070679_100389727 3300005530 Bacteria 1339
38 Ga0068853_100120604 3300005539 Bacteria 2339
39 Ga0068853_100194682 3300005539 Bacteria 1843
40 Ga0068853_100221362 3300005539 Bacteria 1729
41 Ga0068853_100336052 3300005539 Bacteria 1403
42 Ga0070665_100000144 3300005548 Bacteria 132302
43 Ga0070665_100000476 3300005548 Bacteria 57814
44 Ga0070665_100001606 3300005548 Bacteria 26020
45 Ga0068855_100042580 3300005563 Bacteria 5380
46 Ga0068855_100125553 3300005563 Bacteria 2934
47 Ga0068855_100140493 3300005563 Bacteria 2754
48 Ga0068855_100275643 3300005563 Bacteria 1869
49 Ga0068855_100874605 3300005563 Bacteria 951
50 Ga0068852_100551084 3300005616 Bacteria 1153
51 Ga0068859_100002564 3300005617 Bacteria 18451
52 Ga0068859_100246917 3300005617 Bacteria 1875
53 Ga0068864_100006338 3300005618 Bacteria 9703
54 Ga0068864_100008015 3300005618 Bacteria 8712
55 Ga0068863_100000061 3300005841 Bacteria 121811
56 Ga0068863_100000158 3300005841 Bacteria 71918
57 Ga0068863_100002175 3300005841 Bacteria 19429
58 Ga0068863_100065431 3300005841 Bacteria 3439
59 Ga0068863_100131697 3300005841 Bacteria 2388
60 Ga0068858_100000149 3300005842 Bacteria 73242
61 Ga0068858_100002646 3300005842 Bacteria 18033
62 Ga0068858_100008495 3300005842 Bacteria 9868
63 Ga0068858_100242738 3300005842 Bacteria 1710
64 Ga0068860_100000104 3300005843 Bacteria 138111
65 Ga0068860_100000123 3300005843 Bacteria 124700
66 Ga0068860_100017098 3300005843 Bacteria 7070
67 Ga0068860_100056466 3300005843 Bacteria 3732
68 Ga0068862_100009458 3300005844 Bacteria 8064
69 Ga0068862_100014999 3300005844 Bacteria 6435
70 Ga0068862_100024938 3300005844 Bacteria 5019
71 Ga0068862_100033354 3300005844 Bacteria 4351
72 Ga0068862_100114357 3300005844 Bacteria 2372
73 Ga0075368_10038631 3300006042 Bacteria 1869
74 Ga0075363_100092189 3300006048 Bacteria 1668
75 Ga0075364_10002042 3300006051 Bacteria 11260
76 Ga0075362_10078533 3300006177 Bacteria 1518
77 Ga0075367_10032387 3300006178 Bacteria 3008
78 Ga0075369_10031468 3300006186 Bacteria 2240
79 Ga0075369_10167865 3300006186 Bacteria 1007
80 Ga0075366_10069008 3300006195 Bacteria 2103
81 Ga0075370_10011033 3300006353 Bacteria 4738
82 Ga0068865_100007103 3300006881 Bacteria 6876
83 Ga0097620_100002563 3300006931 Bacteria 18451
84 Ga0097620_100246909 3300006931 Bacteria 1875
85 Ga0105240_10007401 3300009093 Bacteria 15960
86 Ga0105240_10016041 3300009093 Bacteria 10155
87 Ga0105240_10027695 3300009093 Bacteria 7416
88 Ga0105240_10059365 3300009093 Bacteria 4774
89 Ga0105240_10062554 3300009093 Bacteria 4633
90 Ga0105240_10189206 3300009093 Bacteria 2422
91 Ga0105240_10615119 3300009093 Bacteria 1195
92 Ga0105245_10291364 3300009098 Bacteria 1599
93 Ga0105241_10261822 3300009174 Bacteria 1470
94 Ga0105242_10305430 3300009176 Bacteria 1454
95 Ga0105248_10029003 3300009177 Bacteria 6169
96 Ga0105248_10035954 3300009177 Bacteria 5540
97 Ga0105248_10045313 3300009177 Bacteria 4932
98 Ga0105248_11321867 3300009177 Bacteria 815
99 Ga0105238_10032390 3300009551 Bacteria 5320
100 Ga0105238_10063039 3300009551 Bacteria 3707
101 Ga0105238_10552962 3300009551 Bacteria 1155
102 Ga0105249_10005705 3300009553 Bacteria 10764
103 Ga0105249_10139617 3300009553 Bacteria 2322
104 Ga0105249_10732160 3300009553 Bacteria 1050
105 Ga0105239_10422990 3300010375 Bacteria 1509
106 Ga0157327_1010712 3300012512 Bacteria 871
107 Ga0157370_10303472 3300013104 Bacteria 1473
108 Ga0157370_10484040 3300013104 Bacteria 1137
109 Ga0163162_10187224 3300013306 Bacteria 2197
110 Ga0163162_10422878 3300013306 Bacteria 1464
111 Ga0157372_10241395 3300013307 Bacteria 2096
112 Ga0157372_10315098 3300013307 Bacteria 1821
113 Ga0157375_10142603 3300013308 Bacteria 2524
114 Ga0163163_10001426 3300014325 Bacteria 20233
115 Ga0163163_10025471 3300014325 Bacteria 5639
116 Ga0163163_10579718 3300014325 Bacteria 1185
117 Ga0157379_10001376 3300014968 Bacteria 19905
118 Ga0157379_10002428 3300014968 Bacteria 15596
119 Ga0157376_10307480 3300014969 Bacteria 1503
120 Ga0209026_1002042 3300025250 Bacteria 7979
121 Ga0209026_1007955 3300025250 Bacteria 2287
122 Ga0209565_1000628 3300025263 Bacteria 23231
123 Ga0209676_1000119 3300025292 Bacteria 201094
124 Ga0209676_1000282 3300025292 Bacteria 105777
125 Ga0209564_1003228 3300025295 Bacteria 11428
126 Ga0209564_1008829 3300025295 Bacteria 4905
127 Ga0209758_1001985 3300025297 Bacteria 22071
128 Ga0209758_1002235 3300025297 Bacteria 20121
129 Ga0209758_1037568 3300025297 Bacteria 1870
130 Ga0209050_1000029 3300025298 Bacteria 465801
131 Ga0209050_1000745 3300025298 Bacteria 46839
132 Ga0209050_1004996 3300025298 Bacteria 8626
133 Ga0209256_1001853 3300025299 Bacteria 19596
134 Ga0209256_1006887 3300025299 Bacteria 5827
135 Ga0209256_1009220 3300025299 Bacteria 4372
136 Ga0209051_1008286 3300025303 Bacteria 5519
137 Ga0209257_1000246 3300025304 Bacteria 125942
138 Ga0209257_1000332 3300025304 Bacteria 98632
139 Ga0209257_1000714 3300025304 Bacteria 51177
140 Ga0209257_1002008 3300025304 Bacteria 21768
141 Ga0209257_1008424 3300025304 Bacteria 5866
142 Ga0207710_10082367 3300025900 Bacteria 1494
143 Ga0207680_10023672 3300025903 Bacteria 3358
144 Ga0207680_10163207 3300025903 Bacteria 1496
145 Ga0207705_10727364 3300025909 Bacteria 771
146 Ga0207707_10150579 3300025912 Bacteria 2034
147 Ga0207707_10373159 3300025912 Bacteria 1227
148 Ga0207707_10842917 3300025912 Bacteria 761
149 Ga0207695_10002805 3300025913 Bacteria 25333
150 Ga0207695_10005469 3300025913 Bacteria 16822
151 Ga0207695_10005806 3300025913 Bacteria 16245
152 Ga0207695_10007148 3300025913 Bacteria 14286
153 Ga0207695_10043783 3300025913 Bacteria 4766
154 Ga0207695_10059949 3300025913 Bacteria 3943
155 Ga0207695_10199182 3300025913 Bacteria 1917
156 Ga0207671_10667770 3300025914 Bacteria 827
157 Ga0207660_10056096 3300025917 Bacteria 2818
158 Ga0207657_10029393 3300025919 Bacteria 5003
159 Ga0207681_10003041 3300025923 Bacteria 10544
160 Ga0207694_10025769 3300025924 Bacteria 4470
161 Ga0207694_10106556 3300025924 Bacteria 2226
162 Ga0207694_10337703 3300025924 Bacteria 1245
163 Ga0207650_10000031 3300025925 Bacteria 230128
164 Ga0207650_10221291 3300025925 Bacteria 1524
165 Ga0207650_10246133 3300025925 Bacteria 1446
166 Ga0207687_10152973 3300025927 Bacteria 1762
167 Ga0207644_10000926 3300025931 Bacteria 18647
168 Ga0207644_10196898 3300025931 Bacteria 1587
169 Ga0207690_10001660 3300025932 Bacteria 13755
170 Ga0207706_10048384 3300025933 Bacteria 3761
171 Ga0207670_10425728 3300025936 Bacteria 1066
172 Ga0207704_10045187 3300025938 Bacteria 2615
173 Ga0207711_10003343 3300025941 Bacteria 13904
174 Ga0207711_10041093 3300025941 Bacteria 3937
175 Ga0207711_10051793 3300025941 Bacteria 3517
176 Ga0207711_10176049 3300025941 Bacteria 1943
177 Ga0207689_10453979 3300025942 Bacteria 1071
178 Ga0207661_11079576 3300025944 Bacteria 739
179 Ga0207679_10299481 3300025945 Bacteria 1386
180 Ga0207667_10024568 3300025949 Bacteria 6612
181 Ga0207667_10069240 3300025949 Bacteria 3673
182 Ga0207667_10090458 3300025949 Bacteria 3163
183 Ga0207667_10533452 3300025949 Bacteria 1188
184 Ga0207667_11055465 3300025949 Bacteria 797
185 Ga0207651_10038737 3300025960 Bacteria 3136
186 Ga0207712_10003143 3300025961 Bacteria 10530
187 Ga0207668_10000087 3300025972 Bacteria 69565
188 Ga0207668_10015685 3300025972 Bacteria 4712
189 Ga0207668_10048397 3300025972 Bacteria 2917
190 Ga0207668_10131987 3300025972 Bacteria 1908
191 Ga0207640_10315368 3300025981 Bacteria 1243
192 Ga0207658_10000084 3300025986 Bacteria 104409
193 Ga0207658_10002911 3300025986 Bacteria 12260
194 Ga0207658_10019906 3300025986 Bacteria 4644
195 Ga0207658_10503381 3300025986 Bacteria 1079
196 Ga0207658_10536590 3300025986 Bacteria 1045
197 Ga0207703_10000050 3300026035 Bacteria 145849
198 Ga0207703_10007302 3300026035 Bacteria 8784
199 Ga0207703_10320746 3300026035 Bacteria 1419
200 Ga0207639_10012577 3300026041 Bacteria 5898
201 Ga0207639_10157490 3300026041 Bacteria 1910
202 Ga0207708_10281305 3300026075 Bacteria 1348
203 Ga0207702_10170693 3300026078 Bacteria 1994
204 Ga0207641_10000118 3300026088 Bacteria 117721
205 Ga0207641_10001468 3300026088 Bacteria 23134
206 Ga0207641_10017102 3300026088 Bacteria 5932
207 Ga0207641_10021662 3300026088 Bacteria 5280
208 Ga0207676_10000055 3300026095 Bacteria 124678
209 Ga0207676_10000312 3300026095 Bacteria 41651
210 Ga0207676_10023463 3300026095 Bacteria 4552
211 Ga0207676_10033650 3300026095 Bacteria 3874
212 Ga0207674_10252047 3300026116 Bacteria 1712
213 Ga0207675_100109161 3300026118 Bacteria 2610
214 Ga0209813_10003067 3300027866 Bacteria 3884
215 Ga0268266_10000003 3300028379 Bacteria 1701703
216 Ga0268266_10001390 3300028379 Bacteria 29066
217 Ga0268266_10021941 3300028379 Bacteria 5441
218 Ga0268266_10080511 3300028379 Bacteria 2838
219 Ga0268265_10000532 3300028380 Bacteria 38863
220 Ga0268265_10003232 3300028380 Bacteria 11833
221 Ga0268265_10017497 3300028380 Bacteria 4948
222 Ga0268265_10017510 3300028380 Bacteria 4946
223 Ga0268265_10052302 3300028380 Bacteria 3088
224 Ga0268264_10000008 3300028381 Bacteria 773387
225 Ga0268264_10000861 3300028381 Bacteria 32169
226 Ga0268264_10018799 3300028381 Bacteria 5649
227 Ga0268264_11177325 3300028381 Bacteria 776
228 Ga0307515_10029406 3300028794 Bacteria 9287
229 Ga0265338_10035506 3300028800 Bacteria 4790
230 Ga0307511_10028992 3300030521 Bacteria 5009
231 Ga0265331_10047241 3300031250 Bacteria 2072
232 Ga0265327_10000541 3300031251 Bacteria 64650
233 Ga0265327_10000942 3300031251 Bacteria 42420
234 Ga0307513_10000069 3300031456 Bacteria 140558
235 Ga0307513_10004628 3300031456 Bacteria 18315
236 Ga0307513_10005422 3300031456 Bacteria 16855
237 Ga0307508_10475001 3300031616 Bacteria 844
238 Ga0265314_10288062 3300031711 Bacteria 926
239 Ga0307516_10000001 3300031730 Bacteria 510338
240 Ga0307510_10000636 3300033180 Bacteria 35583
241 Ga0307510_10287929 3300033180 Bacteria 1110
242 Ga0373929_0115431 3300035085 Bacteria 691
243 Ga0373936_0020037 3300035113 Bacteria 2595
244 Ga0373943_0057582 3300035170 Bacteria 1932
245 Ga0373943_0227224 3300035170 Bacteria 1041
246 Ga0373931_0228297 3300035691 Bacteria 1124
247 Ga0373927_0000200 3300035695 Bacteria 48402
248 Ga0373947_0023732 3300035725 Bacteria 3570
249 Ga0373925_0000032 3300037068 Bacteria 145357
250 Ga0373925_0284969 3300037068 Bacteria 1331
251 Ga0395899_0000680 3300037312 Bacteria 34408
252 Ga0395900_0000111 3300037418 Bacteria 145390
253 Ga0395900_0067463 3300037418 Bacteria 3675
254 Ga0395900_0162580 3300037418 Bacteria 2276
255 Ga0395898_0066194 3300037466 Bacteria 3501
256 Ga0395898_0108327 3300037466 Bacteria 2664
257 Ga0395898_0152109 3300037466 Bacteria 2214
258 Ga0395905_0048463 3300037471 Bacteria 3981
259 Ga0395905_0068511 3300037471 Bacteria 3323
260 Ga0395905_0310135 3300037471 Bacteria 1466
261 Ga0395905_1142066 3300037471 Bacteria 682
262 Ga0395901_0000032 3300038443 Bacteria 235172
263 Ga0436365_0605416 3300039437 Bacteria 2003
264 Ga0436365_1485855 3300039437 Bacteria 4475
265 Ga0436360_0968391 3300039438 Bacteria 870
266 Ga0436362_0316661 3300039453 Bacteria 1026
267 Ga0436362_0532073 3300039453 Bacteria 1285
268 Ga0451835_0757524 3300041492 Bacteria 920
269 Ga0439446_0023096 3300042156 Bacteria 1767
270 Ga0466964_0048000 3300044706 Bacteria 1745
271 Ga0453684_0207944 3300044712 Bacteria 2277
272 Ga0495627_000351 3300046453 Bacteria 43304
273 Ga0495592_0439881 3300046454 Bacteria 819
274 Ga0495590_0017418 3300046457 Bacteria 2587
275 Ga0495638_0000545 3300046460 Bacteria 43284
276 Ga0495638_0000685 3300046460 Bacteria 36856
277 Ga0495638_0009943 3300046460 Bacteria 6632
278 Ga0495638_0010026 3300046460 Bacteria 6605
279 Ga0495638_0012313 3300046460 Bacteria 5866
280 Ga0495638_0073193 3300046460 Bacteria 2092
281 Ga0495638_0131958 3300046460 Bacteria 1466
282 Ga0495650_0000024 3300046471 Bacteria 496674
283 Ga0495585_0098758 3300046492 Bacteria 1564
284 Ga0495585_0129359 3300046492 Bacteria 1330
285 Ga0495583_0000013 3300046506 Bacteria 323372
286 Ga0495606_0006006 3300046507 Bacteria 11379
287 Ga0495606_0078478 3300046507 Bacteria 2059
288 Ga0495610_0001121 3300046512 Bacteria 24422
289 Ga0495610_0002163 3300046512 Bacteria 16707
290 Ga0495610_0016059 3300046512 Bacteria 4327
291 Ga0495610_0016617 3300046512 Bacteria 4227
292 Ga0495616_0000053 3300046513 Bacteria 104389
293 Ga0495620_0118978 3300046515 Bacteria 1042
294 Ga0495631_0000964 3300046518 Bacteria 17911
295 Ga0495631_0078759 3300046518 Bacteria 1423
296 Ga0495632_0001769 3300046519 Bacteria 17472
297 Ga0495632_0063460 3300046519 Bacteria 1788
298 Ga0495637_0004547 3300046520 Bacteria 7173
299 Ga0495637_0012479 3300046520 Bacteria 4063
300 Ga0495637_0041926 3300046520 Bacteria 1961
301 Ga0495643_0021271 3300046522 Bacteria 3724
302 Ga0495648_0000343 3300046524 Bacteria 51341
303 Ga0495648_0024883 3300046524 Bacteria 4065
304 Ga0495663_0041861 3300046525 Bacteria 1395
305 Ga0495663_0091779 3300046525 Bacteria 990
306 Ga0495654_0000026 3300046530 Bacteria 234940
307 Ga0495654_0040433 3300046530 Bacteria 2324
308 Ga0495654_0074016 3300046530 Bacteria 1610
309 Ga0495609_0030230 3300046538 Bacteria 2465
310 Ga0495621_0197884 3300046539 Bacteria 808
311 Ga0495597_0007906 3300046542 Bacteria 5359
312 Ga0495597_0055971 3300046542 Bacteria 1728
313 Ga0495645_0505160 3300046543 Bacteria 755
314 Ga0495622_0000427 3300046557 Bacteria 27809
315 Ga0495633_0180380 3300046558 Bacteria 972
316 Ga0495668_0000200 3300046616 Bacteria 88508
317 Ga0495668_0005226 3300046616 Bacteria 8897
318 Ga0495668_0053567 3300046616 Bacteria 2230
319 Ga0495668_0063262 3300046616 Bacteria 2038
320 Ga0495668_0166305 3300046616 Bacteria 1208
321 Ga0495668_0449326 3300046616 Bacteria 709
322 Ga0495625_0002238 3300046660 Bacteria 21363
323 Ga0495625_0078921 3300046660 Bacteria 2297
324 Ga0495625_0082013 3300046660 Bacteria 2244
325 Ga0495658_0393640 3300046683 Bacteria 883
326 Ga0495669_0000147 3300046684 Bacteria 45027
327 Ga0495669_0001558 3300046684 Bacteria 9426
328 Ga0495669_0247440 3300046684 Bacteria 856
329 Ga0495613_0403716 3300046689 Bacteria 932
330 Ga0495671_0103341 3300046692 Bacteria 1392
331 Ga0495660_0068695 3300046810 Bacteria 1885
332 Ga0495660_0118378 3300046810 Bacteria 1343
333 Ga0495636_0140833 3300047318 Bacteria 1077
334 Ga0495672_0002232 3300047320 Bacteria 18018
335 Ga0495672_0035954 3300047320 Bacteria 3046
336 Ga0495683_0056110 3300047323 Bacteria 1960
337 Ga0495687_015852 3300047443 Bacteria 3812
338 Ga0495687_159711 3300047443 Bacteria 760
339 Ga0495677_0019033 3300047445 Bacteria 2490
340 Ga0495679_007009 3300047446 Bacteria 4765
341 Ga0495673_0000306 3300047469 Bacteria 64744
342 Ga0495673_0000348 3300047469 Bacteria 58039
343 Ga0495673_0007603 3300047469 Bacteria 6203
344 Ga0495686_0009291 3300047472 Bacteria 7099
345 Ga0495686_0017558 3300047472 Bacteria 4815
346 Ga0495686_0057709 3300047472 Bacteria 2422
347 Ga0495686_0186499 3300047472 Bacteria 1198
348 Ga0495593_0011251 3300047673 Bacteria 5143
349 Ga0495602_0288760 3300048088 Bacteria 1205
350 Ga0496101_0175371 3300048904 Bacteria 1649
351 Ga0496102_0035165 3300048905 Bacteria 4508
352 Ga0496102_0083480 3300048905 Bacteria 2948
353 Ga0496106_0003198 3300048909 Bacteria 12255
354 Ga0496106_0049476 3300048909 Bacteria 3167
355 Ga0496107_0000888 3300048910 Bacteria 17610
356 Ga0496108_0031412 3300048911 Bacteria 4407
357 Ga0496109_0059157 3300048912 Bacteria 3501
358 Ga0496112_0079140 3300048915 Bacteria 3251
359 Ga0496113_0108919 3300048916 Bacteria 2154
360 Ga0496114_0432699 3300048917 Bacteria 1165
361 Ga0496115_0000328 3300048918 Bacteria 40551
362 Ga0496115_0013944 3300048918 Bacteria 6081
363 Ga0496115_0021682 3300048918 Bacteria 4965
364 Ga0496115_0069029 3300048918 Bacteria 2862
365 Ga0496116_0112426 3300048919 Bacteria 1596
366 Ga0496118_0003882 3300048921 Bacteria 18351
367 Ga0496119_0004972 3300048922 Bacteria 12987
368 Ga0496121_0000059 3300048924 Bacteria 278177
369 Ga0496121_0012911 3300048924 Bacteria 9030
370 Ga0496121_0230607 3300048924 Bacteria 1297
371 Ga0496121_0449751 3300048924 Bacteria 830
372 Ga0496124_0087231 3300048927 Bacteria 2552
373 Ga0496125_0058559 3300048928 Bacteria 3111
374 Ga0496126_0001880 3300048929 Bacteria 30537
375 Ga0495678_000749 3300049459 Bacteria 29488
376 Ga0495682_0072895 3300049460 Bacteria 1236
377 Ga0501032_0144488 3300049569 Bacteria 1566
378 Ga0501033_0049764 3300049570 Bacteria 3111
379 Ga0501033_0759951 3300049570 Bacteria 657
380 Ga0501034_0101676 3300049571 Bacteria 2868
381 Ga0501034_0582331 3300049571 Bacteria 1026
382 Ga0501034_0623544 3300049571 Bacteria 982
383 Ga0501037_0404878 3300049573 Bacteria 935
384 Ga0501038_0834863 3300049574 Bacteria 683
385 Ga0501043_0451722 3300049579 Bacteria 965
386 Ga0501047_0002685 3300049581 Bacteria 16927
387 Ga0501047_0058603 3300049581 Bacteria 3720
388 Ga0501257_005546 3300049686 Bacteria 2784
389 Ga0501035_0122171 3300049822 Bacteria 2276
390 Ga0501044_0008562 3300049823 Bacteria 11209
391 nmdc:mga03n38_19214_c1 3300050490 Bacteria 2711
392 nmdc:mga00v17_1701_c1 3300050491 Bacteria 11451
393 nmdc:mga0k408_212549_c1 3300050493 Bacteria 1155
394 nmdc:mga0k408_61316_c1 3300050493 Bacteria 2186
395 nmdc:mga06z11_50463_c1 3300050494 Bacteria 2127
396 nmdc:mga04h51_3362_c1 3300050495 Bacteria 3884
397 nmdc:mga07m45_21481_c1 3300050496 Bacteria 3515
398 nmdc:mga07m45_24258_c2 3300050496 Bacteria 1696
399 nmdc:mga07m45_5131_c1 3300050496 Bacteria 6486
400 nmdc:mga0sz30_157149_c1 3300050516 Bacteria 1007
401 nmdc:mga0sz30_7122_c2 3300050516 Bacteria 3811
402 Ga0500635_0000223 3300053080 Bacteria 25999
403 Ga0500578_0000171 3300053086 Bacteria 77445
404 Ga0500578_0071962 3300053086 Bacteria 2204
405 Ga0500578_0291160 3300053086 Bacteria 971
406 Ga0500643_013981 3300053087 Bacteria 2808
407 Ga0500643_034216 3300053087 Bacteria 1532
408 Ga0500643_041481 3300053087 Bacteria 1352
409 Ga0500644_0000068 3300053088 Bacteria 61502
410 Ga0500647_0185979 3300053091 Bacteria 950
411 Ga0500651_0003569 3300053093 Bacteria 8523
412 Ga0500651_0083952 3300053093 Bacteria 1970
413 Ga0500566_0008225 3300053094 Bacteria 6175
414 Ga0500641_0055343 3300053096 Bacteria 1642
415 Ga0500641_0079404 3300053096 Bacteria 1391
416 Ga0500554_003013 3300053102 Bacteria 3390
417 Ga0500555_009264 3300053103 Bacteria 2815
418 Ga0500556_0001043 3300053104 Bacteria 14364
419 Ga0500562_002223 3300053108 Bacteria 4846
420 Ga0500562_010991 3300053108 Bacteria 2297
421 Ga0500562_038306 3300053108 Bacteria 1273
422 Ga0500572_039669 3300053111 Bacteria 1359
423 Ga0500594_0000180 3300053118 Bacteria 16058
424 Ga0500595_002070 3300053119 Bacteria 10248
425 Ga0500608_000022 3300053122 Bacteria 72979
426 Ga0500608_000862 3300053122 Bacteria 10960
427 Ga0500614_001143 3300053123 Bacteria 6520
428 Ga0500618_000397 3300053125 Bacteria 29986
429 Ga0500642_0285387 3300053130 Bacteria 749
430 Ga0500658_0011510 3300053134 Bacteria 3260
431 Ga0500658_0048899 3300053134 Bacteria 1721
432 Ga0500559_0000100 3300053136 Bacteria 67173
433 Ga0500559_0004746 3300053136 Bacteria 6378
434 Ga0500559_0007999 3300053136 Bacteria 4657
435 Ga0500559_0008969 3300053136 Bacteria 4352
436 Ga0500564_000012 3300053138 Bacteria 55012
437 Ga0500590_069993 3300053148 Bacteria 1745
438 Ga0500616_0025110 3300053153 Bacteria 3306
439 Ga0500622_0000588 3300053156 Bacteria 33052
440 Ga0500622_0012486 3300053156 Bacteria 4598
441 Ga0500622_0015753 3300053156 Bacteria 4046
442 Ga0500622_0020255 3300053156 Bacteria 3532
443 Ga0500636_0004757 3300053177 Bacteria 7698
444 Ga0500637_0015890 3300053178 Bacteria 4001
445 Ga0500625_032323 3300053729 Bacteria 2484
446 Ga0500645_001121 3300053730 Bacteria 14610
447 Ga0500645_002703 3300053730 Bacteria 7702
448 Ga0500609_004298 3300053731 Bacteria 1974
449 Ga0500596_000092 3300053735 Bacteria 12251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031711 Ga0265314_10288062 Ga0265314_102880621 177
2 3300013306 Ga0163162_10422878 Ga0163162_104228783 188
3 3300049570 Ga0501033_0759951 Ga0501033_0759951_11_577 188
4 3300033180 Ga0307510_10000636 Ga0307510_100006367 189
5 3300035691 Ga0373931_0228297 Ga0373931_0228297_508_1098 189
6 3300046684 Ga0495669_0000147 Ga0495669_0000147_18358_18981 189
7 3300005347 Ga0070668_100001050 Ga0070668_1000010508 190
8 3300005548 Ga0070665_100000476 Ga0070665_1000004768 190
9 3300009098 Ga0105245_10291364 Ga0105245_102913642 190
10 3300025927 Ga0207687_10152973 Ga0207687_101529732 190
11 3300025972 Ga0207668_10000087 Ga0207668_1000008765 190
12 3300028379 Ga0268266_10001390 Ga0268266_1000139032 190
13 3300028380 Ga0268265_10017510 Ga0268265_100175102 190
14 3300005331 Ga0070670_100313192 Ga0070670_1003131921 191
15 3300005335 Ga0070666_10149353 Ga0070666_101493532 191
16 3300005355 Ga0070671_100009492 Ga0070671_1000094922 191
17 3300005364 Ga0070673_100286620 Ga0070673_1002866202 191
18 3300005367 Ga0070667_100001243 Ga0070667_1000012433 191
19 3300005367 Ga0070667_100016487 Ga0070667_1000164872 191
20 3300005367 Ga0070667_100508122 Ga0070667_1005081221 191
21 3300005458 Ga0070681_10107042 Ga0070681_101070425 191
22 3300005530 Ga0070679_100011555 Ga0070679_10001155510 191
23 3300005539 Ga0068853_100336052 Ga0068853_1003360521 191
24 3300005563 Ga0068855_100275643 Ga0068855_1002756433 191
25 3300005617 Ga0068859_100002564 Ga0068859_1000025646 191
26 3300005618 Ga0068864_100008015 Ga0068864_1000080153 191
27 3300005841 Ga0068863_100002175 Ga0068863_10000217510 191
28 3300005841 Ga0068863_100131697 Ga0068863_1001316971 191
29 3300005842 Ga0068858_100008495 Ga0068858_1000084955 191
30 3300005843 Ga0068860_100017098 Ga0068860_1000170985 191
31 3300005844 Ga0068862_100014999 Ga0068862_1000149992 191
32 3300005844 Ga0068862_100114357 Ga0068862_1001143572 191
33 3300006931 Ga0097620_100002563 Ga0097620_1000025636 191
34 3300009093 Ga0105240_10059365 Ga0105240_100593653 191
35 3300009177 Ga0105248_10029003 Ga0105248_100290037 191
36 3300009177 Ga0105248_10035954 Ga0105248_100359544 191
37 3300009551 Ga0105238_10032390 Ga0105238_100323906 191
38 3300013308 Ga0157375_10142603 Ga0157375_101426032 191
39 3300014325 Ga0163163_10001426 Ga0163163_1000142610 191
40 3300014968 Ga0157379_10001376 Ga0157379_100013766 191
41 3300025900 Ga0207710_10082367 Ga0207710_100823672 191
42 3300025903 Ga0207680_10163207 Ga0207680_101632072 191
43 3300025912 Ga0207707_10373159 Ga0207707_103731592 191
44 3300025913 Ga0207695_10005469 Ga0207695_1000546911 191
45 3300025913 Ga0207695_10043783 Ga0207695_100437835 191
46 3300025923 Ga0207681_10003041 Ga0207681_100030419 191
47 3300025925 Ga0207650_10221291 Ga0207650_102212912 191
48 3300025925 Ga0207650_10246133 Ga0207650_102461333 191
49 3300025931 Ga0207644_10000926 Ga0207644_100009262 191
50 3300025931 Ga0207644_10196898 Ga0207644_101968981 191
51 3300025933 Ga0207706_10048384 Ga0207706_100483845 191
52 3300025936 Ga0207670_10425728 Ga0207670_104257281 191
53 3300025941 Ga0207711_10041093 Ga0207711_100410934 191
54 3300025941 Ga0207711_10176049 Ga0207711_101760493 191
55 3300025945 Ga0207679_10299481 Ga0207679_102994812 191
56 3300025949 Ga0207667_10533452 Ga0207667_105334522 191
57 3300025960 Ga0207651_10038737 Ga0207651_100387372 191
58 3300025972 Ga0207668_10015685 Ga0207668_100156855 191
59 3300025986 Ga0207658_10002911 Ga0207658_100029118 191
60 3300025986 Ga0207658_10019906 Ga0207658_100199062 191
61 3300025986 Ga0207658_10503381 Ga0207658_105033811 191
62 3300026035 Ga0207703_10007302 Ga0207703_100073023 191
63 3300026075 Ga0207708_10281305 Ga0207708_102813052 191
64 3300026088 Ga0207641_10017102 Ga0207641_100171025 191
65 3300026088 Ga0207641_10021662 Ga0207641_100216624 191
66 3300026095 Ga0207676_10023463 Ga0207676_100234632 191
67 3300028380 Ga0268265_10017497 Ga0268265_100174975 191
68 3300028381 Ga0268264_11177325 Ga0268264_111773251 191
69 3300031456 Ga0307513_10005422 Ga0307513_1000542210 191
70 3300035113 Ga0373936_0020037 Ga0373936_0020037_1675_2298 191
71 3300041492 Ga0451835_0757524 Ga0451835_0757524_19_594 191
72 3300044706 Ga0466964_0048000 Ga0466964_0048000_156_776 191
73 3300046525 Ga0495663_0041861 Ga0495663_0041861_566_1189 191
74 3300046616 Ga0495668_0063262 Ga0495668_0063262_621_1241 191
75 3300046616 Ga0495668_0449326 Ga0495668_0449326_47_667 191
76 3300047318 Ga0495636_0140833 Ga0495636_0140833_133_753 191
77 3300048904 Ga0496101_0175371 Ga0496101_0175371_618_1238 191
78 3300048905 Ga0496102_0083480 Ga0496102_0083480_1064_1684 191
79 3300048909 Ga0496106_0049476 Ga0496106_0049476_1531_2151 191
80 3300048911 Ga0496108_0031412 Ga0496108_0031412_1090_1710 191
81 3300048912 Ga0496109_0059157 Ga0496109_0059157_2751_3371 191
82 3300048915 Ga0496112_0079140 Ga0496112_0079140_206_826 191
83 3300048916 Ga0496113_0108919 Ga0496113_0108919_96_716 191
84 3300053080 Ga0500635_0000223 Ga0500635_0000223_6165_6785 191
85 3300053087 Ga0500643_041481 Ga0500643_041481_448_1080 191
86 3300053091 Ga0500647_0185979 Ga0500647_0185979_201_821 191
87 3300053108 Ga0500562_002223 Ga0500562_002223_2464_3078 191
88 3300053177 Ga0500636_0004757 Ga0500636_0004757_6850_7470 191
89 3300053178 Ga0500637_0015890 Ga0500637_0015890_1241_1861 191
90 3300009093 Ga0105240_10007401 Ga0105240_1000740117 192
91 3300009093 Ga0105240_10062554 Ga0105240_100625546 192
92 3300009176 Ga0105242_10305430 Ga0105242_103054302 192
93 3300025909 Ga0207705_10727364 Ga0207705_107273641 192
94 3300025913 Ga0207695_10005806 Ga0207695_1000580612 192
95 3300025913 Ga0207695_10059949 Ga0207695_100599494 192
96 3300028800 Ga0265338_10035506 Ga0265338_100355064 192
97 3300035085 Ga0373929_0115431 Ga0373929_0115431_30_650 192
98 3300039453 Ga0436362_0532073 Ga0436362_0532073_571_1182 192
99 3300049569 Ga0501032_0144488 Ga0501032_0144488_151_774 192
100 3300005331 Ga0070670_100000122 Ga0070670_10000012263 193
101 3300005335 Ga0070666_10065158 Ga0070666_100651582 193
102 3300005367 Ga0070667_100000305 Ga0070667_1000003057 193
103 3300005548 Ga0070665_100001606 Ga0070665_10000160620 193
104 3300005563 Ga0068855_100140493 Ga0068855_1001404933 193
105 3300005618 Ga0068864_100006338 Ga0068864_1000063383 193
106 3300005841 Ga0068863_100000061 Ga0068863_1000000611 193
107 3300005842 Ga0068858_100002646 Ga0068858_10000264620 193
108 3300005843 Ga0068860_100000123 Ga0068860_100000123118 193
109 3300005844 Ga0068862_100009458 Ga0068862_1000094582 193
110 3300006881 Ga0068865_100007103 Ga0068865_1000071034 193
111 3300009093 Ga0105240_10615119 Ga0105240_106151191 193
112 3300009177 Ga0105248_10045313 Ga0105248_100453135 193
113 3300009553 Ga0105249_10005705 Ga0105249_100057052 193
114 3300013306 Ga0163162_10187224 Ga0163162_101872242 193
115 3300013307 Ga0157372_10315098 Ga0157372_103150983 193
116 3300014325 Ga0163163_10579718 Ga0163163_105797182 193
117 3300014968 Ga0157379_10002428 Ga0157379_100024289 193
118 3300014969 Ga0157376_10307480 Ga0157376_103074802 193
119 3300025903 Ga0207680_10023672 Ga0207680_100236722 193
120 3300025924 Ga0207694_10106556 Ga0207694_101065561 193
121 3300025925 Ga0207650_10000031 Ga0207650_100000317 193
122 3300025938 Ga0207704_10045187 Ga0207704_100451872 193
123 3300025941 Ga0207711_10051793 Ga0207711_100517933 193
124 3300025949 Ga0207667_10090458 Ga0207667_100904584 193
125 3300025961 Ga0207712_10003143 Ga0207712_100031438 193
126 3300025972 Ga0207668_10048397 Ga0207668_100483972 193
127 3300025986 Ga0207658_10000084 Ga0207658_1000008443 193
128 3300026035 Ga0207703_10320746 Ga0207703_103207462 193
129 3300026088 Ga0207641_10001468 Ga0207641_1000146820 193
130 3300026095 Ga0207676_10000055 Ga0207676_100000553 193
131 3300028379 Ga0268266_10021941 Ga0268266_100219415 193
132 3300028380 Ga0268265_10003232 Ga0268265_1000323210 193
133 3300028381 Ga0268264_10000861 Ga0268264_100008617 193
134 3300031250 Ga0265331_10047241 Ga0265331_100472413 193
135 3300031251 Ga0265327_10000541 Ga0265327_100005416 193
136 3300039438 Ga0436360_0968391 Ga0436360_0968391_193_813 193
137 3300046492 Ga0495585_0098758 Ga0495585_0098758_916_1536 193
138 3300046543 Ga0495645_0505160 Ga0495645_0505160_82_702 193
139 3300048905 Ga0496102_0035165 Ga0496102_0035165_1123_1743 193
140 3300048918 Ga0496115_0069029 Ga0496115_0069029_1907_2530 193
141 3300053103 Ga0500555_009264 Ga0500555_009264_1392_2090 193
142 3300053130 Ga0500642_0285387 Ga0500642_0285387_113_733 193
143 3300005841 Ga0068863_100000158 Ga0068863_1000001581 194
144 3300005842 Ga0068858_100000149 Ga0068858_1000001499 194
145 3300009093 Ga0105240_10189206 Ga0105240_101892062 194
146 3300014325 Ga0163163_10025471 Ga0163163_100254711 194
147 3300025913 Ga0207695_10199182 Ga0207695_101991822 194
148 3300025914 Ga0207671_10667770 Ga0207671_106677701 194
149 3300025941 Ga0207711_10003343 Ga0207711_100033439 194
150 3300025942 Ga0207689_10453979 Ga0207689_104539791 194
151 3300026035 Ga0207703_10000050 Ga0207703_1000005064 194
152 3300026078 Ga0207702_10170693 Ga0207702_101706932 194
153 3300026088 Ga0207641_10000118 Ga0207641_1000011881 194
154 3300026095 Ga0207676_10000312 Ga0207676_100003121 194
155 3300037312 Ga0395899_0000680 Ga0395899_0000680_25646_26266 194
156 3300037418 Ga0395900_0000111 Ga0395900_0000111_46016_46636 194
157 3300037466 Ga0395898_0066194 Ga0395898_0066194_809_1429 194
158 3300037471 Ga0395905_0048463 Ga0395905_0048463_809_1429 194
159 3300038443 Ga0395901_0000032 Ga0395901_0000032_177242_177862 194
160 3300039437 Ga0436365_1485855 Ga0436365_1485855_1183_1803 194
161 3300046454 Ga0495592_0439881 Ga0495592_0439881_119_742 194
162 3300046512 Ga0495610_0016617 Ga0495610_0016617_1468_2088 194
163 3300046520 Ga0495637_0041926 Ga0495637_0041926_418_1038 194
164 3300046522 Ga0495643_0021271 Ga0495643_0021271_2967_3587 194
165 3300046530 Ga0495654_0074016 Ga0495654_0074016_891_1511 194
166 3300046538 Ga0495609_0030230 Ga0495609_0030230_1818_2438 194
167 3300046542 Ga0495597_0007906 Ga0495597_0007906_4500_5120 194
168 3300046557 Ga0495622_0000427 Ga0495622_0000427_23226_23846 194
169 3300046683 Ga0495658_0393640 Ga0495658_0393640_109_732 194
170 3300046684 Ga0495669_0247440 Ga0495669_0247440_56_676 194
171 3300046689 Ga0495613_0403716 Ga0495613_0403716_148_768 194
172 3300047443 Ga0495687_015852 Ga0495687_015852_2481_3101 194
173 3300047673 Ga0495593_0011251 Ga0495593_0011251_847_1467 194
174 3300048088 Ga0495602_0288760 Ga0495602_0288760_556_1176 194
175 3300048918 Ga0496115_0000328 Ga0496115_0000328_23582_24202 194
176 3300048919 Ga0496116_0112426 Ga0496116_0112426_610_1230 194
177 3300048921 Ga0496118_0003882 Ga0496118_0003882_15164_15784 194
178 3300048922 Ga0496119_0004972 Ga0496119_0004972_2133_2753 194
179 3300048924 Ga0496121_0000059 Ga0496121_0000059_147011_147631 194
180 3300049460 Ga0495682_0072895 Ga0495682_0072895_512_1132 194
181 3300053086 Ga0500578_0071962 Ga0500578_0071962_263_883 194
182 3300053093 Ga0500651_0003569 Ga0500651_0003569_4318_4938 194
183 3300053094 Ga0500566_0008225 Ga0500566_0008225_4676_5296 194
184 3300053111 Ga0500572_039669 Ga0500572_039669_724_1344 194
185 3300053119 Ga0500595_002070 Ga0500595_002070_4521_5141 194
186 3300053122 Ga0500608_000022 Ga0500608_000022_49885_50520 194
187 3300053122 Ga0500608_000862 Ga0500608_000862_4098_4718 194
188 3300053123 Ga0500614_001143 Ga0500614_001143_426_1046 194
189 3300053134 Ga0500658_0048899 Ga0500658_0048899_639_1259 194
190 3300053136 Ga0500559_0004746 Ga0500559_0004746_2872_3489 194
191 3300053136 Ga0500559_0008969 Ga0500559_0008969_695_1315 194
192 3300053148 Ga0500590_069993 Ga0500590_069993_415_1035 194
193 3300053156 Ga0500622_0012486 Ga0500622_0012486_903_1538 194
194 3300053729 Ga0500625_032323 Ga0500625_032323_1453_2073 194
195 3300053735 Ga0500596_000092 Ga0500596_000092_6822_7442 194
196 3300006042 Ga0075368_10038631 Ga0075368_100386312 195
197 3300006048 Ga0075363_100092189 Ga0075363_1000921892 195
198 3300006051 Ga0075364_10002042 Ga0075364_100020426 195
199 3300006178 Ga0075367_10032387 Ga0075367_100323872 195
200 3300006186 Ga0075369_10167865 Ga0075369_101678652 195
201 3300006195 Ga0075366_10069008 Ga0075366_100690082 195
202 3300025295 Ga0209564_1008829 Ga0209564_10088298 195
203 3300027866 Ga0209813_10003067 Ga0209813_100030672 195
204 3300046460 Ga0495638_0073193 Ga0495638_0073193_158_775 195
205 3300046507 Ga0495606_0078478 Ga0495606_0078478_265_882 195
206 3300046542 Ga0495597_0055971 Ga0495597_0055971_47_664 195
207 3300046616 Ga0495668_0053567 Ga0495668_0053567_1548_2165 195
208 3300050490 nmdc:mga03n38_19214_c1 nmdc:mga03n38_19214_c1_785_1405 195
209 3300050491 nmdc:mga00v17_1701_c1 nmdc:mga00v17_1701_c1_716_1336 195
210 3300050493 nmdc:mga0k408_212549_c1 nmdc:mga0k408_212549_c1_444_1064 195
211 3300050493 nmdc:mga0k408_61316_c1 nmdc:mga0k408_61316_c1_41_658 195
212 3300050494 nmdc:mga06z11_50463_c1 nmdc:mga06z11_50463_c1_353_973 195
213 3300050495 nmdc:mga04h51_3362_c1 nmdc:mga04h51_3362_c1_2163_2783 195
214 3300050496 nmdc:mga07m45_24258_c2 nmdc:mga07m45_24258_c2_222_842 195
215 3300050496 nmdc:mga07m45_5131_c1 nmdc:mga07m45_5131_c1_3056_3676 195
216 3300050516 nmdc:mga0sz30_157149_c1 nmdc:mga0sz30_157149_c1_246_866 195
217 3300053096 Ga0500641_0055343 Ga0500641_0055343_914_1528 195
218 3300053156 Ga0500622_0015753 Ga0500622_0015753_3397_4014 195
219 3300049686 Ga0501257_005546 Ga0501257_005546_1926_2546 196
220 3300031456 Ga0307513_10000069 Ga0307513_1000006974 197
221 3300031456 Ga0307513_10004628 Ga0307513_100046285 197
222 iso_pu_bacteria 2510917020 2511121823 201
223 iso_pu_bacteria 2582581279 2585147723 201
224 iso_pu_bacteria 2582581280 2585152930 201
225 iso_pu_bacteria 2582581293 2585195111 201
226 iso_pu_bacteria 2585428106 2587917413 201
227 iso_pu_bacteria 2643221545 2643747097 201
228 iso_pu_bacteria 2643221552 2643781437 201
229 iso_pu_bacteria 2643221583 2643924397 201
230 iso_pu_bacteria 2643221584 2643929090 201
231 iso_pu_bacteria 2643221640 2644227067 201
232 iso_pu_bacteria 2643221642 2644233466 201
233 iso_pu_bacteria 2643221691 2644507705 201
234 iso_pu_bacteria 2791355048 2792458758 201
235 iso_pu_bacteria 2818991435 2819536415 201
236 iso_pu_bacteria 2818991454 2819644670 201
237 iso_pu_bacteria 2843744320 2843746987 201
238 iso_pu_bacteria 2849560528 2849565497 201
239 iso_pu_bacteria 2849573788 2849574532 201
240 iso_pu_bacteria 2851153111 2851154887 201
241 iso_pu_bacteria 2857504554 2857508366 201
242 iso_pu_bacteria 2884960567 2884962028 201
243 iso_pu_bacteria 2898329390 2898333139 201
244 iso_pu_bacteria 2928531327 2928533431 201
245 iso_pu_bacteria 2643221598 2643998486 202
246 iso_pu_bacteria 2643221614 2644086632 202
247 iso_pu_bacteria 2643221661 2644341586 202
248 iso_pu_bacteria 2643221666 2644367873 202
249 3300005563 Ga0068855_100042580 Ga0068855_1000425807 203
250 3300009551 Ga0105238_10552962 Ga0105238_105529622 203
251 3300025949 Ga0207667_10069240 Ga0207667_100692404 203
252 3300028379 Ga0268266_10080511 Ga0268266_100805112 203
253 3300037418 Ga0395900_0067463 Ga0395900_0067463_51_662 203
254 3300037466 Ga0395898_0108327 Ga0395898_0108327_2007_2618 203
255 3300037471 Ga0395905_0068511 Ga0395905_0068511_1011_1622 203
256 3300037471 Ga0395905_0310135 Ga0395905_0310135_295_906 203
257 3300005331 Ga0070670_100045106 Ga0070670_1000451063 204
258 3300005347 Ga0070668_100091341 Ga0070668_1000913412 204
259 3300005347 Ga0070668_100141884 Ga0070668_1001418843 204
260 3300005353 Ga0070669_100128817 Ga0070669_1001288172 204
261 3300005355 Ga0070671_100219862 Ga0070671_1002198622 204
262 3300005367 Ga0070667_100299465 Ga0070667_1002994652 204
263 3300005617 Ga0068859_100246917 Ga0068859_1002469172 204
264 3300005841 Ga0068863_100065431 Ga0068863_1000654312 204
265 3300005842 Ga0068858_100242738 Ga0068858_1002427383 204
266 3300005843 Ga0068860_100000104 Ga0068860_10000010481 204
267 3300005843 Ga0068860_100056466 Ga0068860_1000564662 204
268 3300005844 Ga0068862_100024938 Ga0068862_1000249382 204
269 3300005844 Ga0068862_100033354 Ga0068862_1000333543 204
270 3300006931 Ga0097620_100246909 Ga0097620_1002469092 204
271 3300009553 Ga0105249_10139617 Ga0105249_101396172 204
272 3300025250 Ga0209026_1007955 Ga0209026_10079553 204
273 3300025972 Ga0207668_10131987 Ga0207668_101319872 204
274 3300025986 Ga0207658_10536590 Ga0207658_105365902 204
275 3300026118 Ga0207675_100109161 Ga0207675_1001091613 204
276 3300028380 Ga0268265_10000532 Ga0268265_1000053217 204
277 3300028380 Ga0268265_10052302 Ga0268265_100523024 204
278 3300028381 Ga0268264_10000008 Ga0268264_10000008405 204
279 3300028381 Ga0268264_10018799 Ga0268264_100187994 204
280 3300031251 Ga0265327_10000942 Ga0265327_1000094231 204
281 3300031616 Ga0307508_10475001 Ga0307508_104750011 204
282 3300031730 Ga0307516_10000001 Ga0307516_1000000175 204
283 3300039453 Ga0436362_0316661 Ga0436362_0316661_69_689 204
284 3300049574 Ga0501038_0834863 Ga0501038_0834863_42_659 204
285 3300003773 Ga0055537_1002067 Ga0055537_10020674 205
286 3300003775 Ga0055524_1020102 Ga0055524_10201023 205
287 3300003790 Ga0055528_1004560 Ga0055528_10045607 205
288 3300003792 Ga0055540_1039737 Ga0055540_10397372 205
289 3300003794 Ga0055531_10000915 Ga0055531_1000091519 205
290 3300003794 Ga0055531_10001299 Ga0055531_1000129916 205
291 3300005262 Ga0065165_1005319 Ga0065165_10053192 205
292 3300005458 Ga0070681_10039891 Ga0070681_100398916 205
293 3300005563 Ga0068855_100125553 Ga0068855_1001255534 205
294 3300005616 Ga0068852_100551084 Ga0068852_1005510842 205
295 3300006186 Ga0075369_10031468 Ga0075369_100314682 205
296 3300009093 Ga0105240_10027695 Ga0105240_1002769510 205
297 3300012512 Ga0157327_1010712 Ga0157327_10107121 205
298 3300013307 Ga0157372_10241395 Ga0157372_102413952 205
299 3300025263 Ga0209565_1000628 Ga0209565_10006283 205
300 3300025292 Ga0209676_1000119 Ga0209676_100011957 205
301 3300025292 Ga0209676_1000282 Ga0209676_100028277 205
302 3300025295 Ga0209564_1003228 Ga0209564_10032286 205
303 3300025297 Ga0209758_1001985 Ga0209758_100198520 205
304 3300025297 Ga0209758_1002235 Ga0209758_10022358 205
305 3300025298 Ga0209050_1000745 Ga0209050_100074534 205
306 3300025298 Ga0209050_1004996 Ga0209050_10049969 205
307 3300025299 Ga0209256_1001853 Ga0209256_100185315 205
308 3300025299 Ga0209256_1006887 Ga0209256_10068873 205
309 3300025299 Ga0209256_1009220 Ga0209256_10092203 205
310 3300025303 Ga0209051_1008286 Ga0209051_10082864 205
311 3300025304 Ga0209257_1000246 Ga0209257_100024694 205
312 3300025304 Ga0209257_1000332 Ga0209257_100033271 205
313 3300025304 Ga0209257_1008424 Ga0209257_10084242 205
314 3300025912 Ga0207707_10842917 Ga0207707_108429171 205
315 3300025913 Ga0207695_10002805 Ga0207695_1000280520 205
316 3300025917 Ga0207660_10056096 Ga0207660_100560962 205
317 3300025944 Ga0207661_11079576 Ga0207661_110795761 205
318 3300025949 Ga0207667_10024568 Ga0207667_100245683 205
319 3300028794 Ga0307515_10029406 Ga0307515_100294068 205
320 3300035170 Ga0373943_0227224 Ga0373943_0227224_392_1012 205
321 3300035725 Ga0373947_0023732 Ga0373947_0023732_2755_3375 205
322 3300037068 Ga0373925_0284969 Ga0373925_0284969_29_649 205
323 3300037418 Ga0395900_0162580 Ga0395900_0162580_1048_1665 205
324 3300037466 Ga0395898_0152109 Ga0395898_0152109_876_1493 205
325 3300042156 Ga0439446_0023096 Ga0439446_0023096_232_849 205
326 3300046453 Ga0495627_000351 Ga0495627_000351_42417_43034 205
327 3300046457 Ga0495590_0017418 Ga0495590_0017418_1898_2515 205
328 3300046460 Ga0495638_0000545 Ga0495638_0000545_21849_22466 205
329 3300046460 Ga0495638_0000685 Ga0495638_0000685_7644_8261 205
330 3300046460 Ga0495638_0009943 Ga0495638_0009943_4981_5598 205
331 3300046460 Ga0495638_0010026 Ga0495638_0010026_2220_2837 205
332 3300046460 Ga0495638_0012313 Ga0495638_0012313_1752_2369 205
333 3300046460 Ga0495638_0131958 Ga0495638_0131958_82_699 205
334 3300046471 Ga0495650_0000024 Ga0495650_0000024_375154_375771 205
335 3300046492 Ga0495585_0129359 Ga0495585_0129359_622_1239 205
336 3300046506 Ga0495583_0000013 Ga0495583_0000013_251190_251807 205
337 3300046507 Ga0495606_0006006 Ga0495606_0006006_1363_1980 205
338 3300046512 Ga0495610_0001121 Ga0495610_0001121_6310_6927 205
339 3300046512 Ga0495610_0002163 Ga0495610_0002163_1750_2367 205
340 3300046512 Ga0495610_0016059 Ga0495610_0016059_3636_4253 205
341 3300046513 Ga0495616_0000053 Ga0495616_0000053_101216_101833 205
342 3300046515 Ga0495620_0118978 Ga0495620_0118978_12_629 205
343 3300046518 Ga0495631_0000964 Ga0495631_0000964_917_1534 205
344 3300046518 Ga0495631_0078759 Ga0495631_0078759_136_753 205
345 3300046519 Ga0495632_0001769 Ga0495632_0001769_3846_4463 205
346 3300046519 Ga0495632_0063460 Ga0495632_0063460_620_1237 205
347 3300046520 Ga0495637_0004547 Ga0495637_0004547_2640_3257 205
348 3300046520 Ga0495637_0012479 Ga0495637_0012479_2234_2851 205
349 3300046524 Ga0495648_0000343 Ga0495648_0000343_5668_6285 205
350 3300046524 Ga0495648_0024883 Ga0495648_0024883_2236_2853 205
351 3300046525 Ga0495663_0091779 Ga0495663_0091779_197_814 205
352 3300046530 Ga0495654_0000026 Ga0495654_0000026_91360_91977 205
353 3300046530 Ga0495654_0040433 Ga0495654_0040433_539_1156 205
354 3300046558 Ga0495633_0180380 Ga0495633_0180380_121_738 205
355 3300046616 Ga0495668_0000200 Ga0495668_0000200_58773_59390 205
356 3300046616 Ga0495668_0005226 Ga0495668_0005226_1033_1650 205
357 3300046660 Ga0495625_0002238 Ga0495625_0002238_11556_12173 205
358 3300046660 Ga0495625_0078921 Ga0495625_0078921_1088_1705 205
359 3300046692 Ga0495671_0103341 Ga0495671_0103341_669_1286 205
360 3300046810 Ga0495660_0068695 Ga0495660_0068695_491_1108 205
361 3300046810 Ga0495660_0118378 Ga0495660_0118378_612_1229 205
362 3300047320 Ga0495672_0002232 Ga0495672_0002232_14167_14784 205
363 3300047323 Ga0495683_0056110 Ga0495683_0056110_1256_1891 205
364 3300047446 Ga0495679_007009 Ga0495679_007009_3602_4219 205
365 3300047469 Ga0495673_0000306 Ga0495673_0000306_7906_8523 205
366 3300047469 Ga0495673_0000348 Ga0495673_0000348_52319_52936 205
367 3300047469 Ga0495673_0007603 Ga0495673_0007603_2753_3370 205
368 3300047472 Ga0495686_0009291 Ga0495686_0009291_5520_6137 205
369 3300047472 Ga0495686_0057709 Ga0495686_0057709_1021_1638 205
370 3300047472 Ga0495686_0186499 Ga0495686_0186499_525_1142 205
371 3300048909 Ga0496106_0003198 Ga0496106_0003198_9064_9681 205
372 3300048910 Ga0496107_0000888 Ga0496107_0000888_10901_11518 205
373 3300048917 Ga0496114_0432699 Ga0496114_0432699_522_1139 205
374 3300048918 Ga0496115_0013944 Ga0496115_0013944_354_971 205
375 3300048924 Ga0496121_0012911 Ga0496121_0012911_3634_4251 205
376 3300048924 Ga0496121_0230607 Ga0496121_0230607_477_1094 205
377 3300048924 Ga0496121_0449751 Ga0496121_0449751_157_774 205
378 3300048927 Ga0496124_0087231 Ga0496124_0087231_1908_2525 205
379 3300048928 Ga0496125_0058559 Ga0496125_0058559_29_646 205
380 3300048929 Ga0496126_0001880 Ga0496126_0001880_29843_30460 205
381 3300049459 Ga0495678_000749 Ga0495678_000749_19650_20267 205
382 3300049571 Ga0501034_0623544 Ga0501034_0623544_241_861 205
383 3300049581 Ga0501047_0002685 Ga0501047_0002685_12858_13478 205
384 3300050516 nmdc:mga0sz30_7122_c2 nmdc:mga0sz30_7122_c2_2803_3420 205
385 3300053086 Ga0500578_0000171 Ga0500578_0000171_21892_22509 205
386 3300053086 Ga0500578_0291160 Ga0500578_0291160_62_679 205
387 3300053087 Ga0500643_013981 Ga0500643_013981_1987_2604 205
388 3300053087 Ga0500643_034216 Ga0500643_034216_15_632 205
389 3300053088 Ga0500644_0000068 Ga0500644_0000068_55714_56331 205
390 3300053093 Ga0500651_0083952 Ga0500651_0083952_1173_1790 205
391 3300053096 Ga0500641_0079404 Ga0500641_0079404_735_1352 205
392 3300053102 Ga0500554_003013 Ga0500554_003013_100_717 205
393 3300053104 Ga0500556_0001043 Ga0500556_0001043_5097_5714 205
394 3300053108 Ga0500562_038306 Ga0500562_038306_89_706 205
395 3300053118 Ga0500594_0000180 Ga0500594_0000180_8403_9020 205
396 3300053125 Ga0500618_000397 Ga0500618_000397_15315_15932 205
397 3300053134 Ga0500658_0011510 Ga0500658_0011510_167_784 205
398 3300053136 Ga0500559_0000100 Ga0500559_0000100_61007_61624 205
399 3300053136 Ga0500559_0007999 Ga0500559_0007999_2006_2623 205
400 3300053138 Ga0500564_000012 Ga0500564_000012_8212_8829 205
401 3300053153 Ga0500616_0025110 Ga0500616_0025110_52_669 205
402 3300053156 Ga0500622_0000588 Ga0500622_0000588_16013_16630 205
403 3300053156 Ga0500622_0020255 Ga0500622_0020255_2353_2970 205
404 3300053730 Ga0500645_002703 Ga0500645_002703_6961_7578 205
405 3300053731 Ga0500609_004298 Ga0500609_004298_141_758 205
406 3300003215 JGI25153J46596_10085298 JGI25153J46596_100852981 206
407 3300003791 Ga0055530_10000762 Ga0055530_1000076210 206
408 3300005262 Ga0065165_1000897 Ga0065165_100089724 206
409 3300005327 Ga0070658_10164836 Ga0070658_101648362 206
410 3300005331 Ga0070670_100363680 Ga0070670_1003636802 206
411 3300005336 Ga0070680_100025970 Ga0070680_1000259706 206
412 3300005339 Ga0070660_100020149 Ga0070660_1000201494 206
413 3300005366 Ga0070659_100001580 Ga0070659_1000015802 206
414 3300005366 Ga0070659_100006490 Ga0070659_1000064904 206
415 3300005530 Ga0070679_100389727 Ga0070679_1003897272 206
416 3300005539 Ga0068853_100120604 Ga0068853_1001206042 206
417 3300005539 Ga0068853_100194682 Ga0068853_1001946822 206
418 3300005539 Ga0068853_100221362 Ga0068853_1002213622 206
419 3300005548 Ga0070665_100000144 Ga0070665_100000144117 206
420 3300005563 Ga0068855_100874605 Ga0068855_1008746051 206
421 3300006177 Ga0075362_10078533 Ga0075362_100785332 206
422 3300006353 Ga0075370_10011033 Ga0075370_100110335 206
423 3300009093 Ga0105240_10016041 Ga0105240_1001604110 206
424 3300009174 Ga0105241_10261822 Ga0105241_102618222 206
425 3300009177 Ga0105248_11321867 Ga0105248_113218671 206
426 3300009551 Ga0105238_10063039 Ga0105238_100630393 206
427 3300009553 Ga0105249_10732160 Ga0105249_107321601 206
428 3300010375 Ga0105239_10422990 Ga0105239_104229901 206
429 3300013104 Ga0157370_10303472 Ga0157370_103034721 206
430 3300013104 Ga0157370_10484040 Ga0157370_104840401 206
431 3300025250 Ga0209026_1002042 Ga0209026_10020424 206
432 3300025297 Ga0209758_1037568 Ga0209758_10375682 206
433 3300025298 Ga0209050_1000029 Ga0209050_1000029316 206
434 3300025304 Ga0209257_1000714 Ga0209257_100071454 206
435 3300025304 Ga0209257_1002008 Ga0209257_100200811 206
436 3300025912 Ga0207707_10150579 Ga0207707_101505792 206
437 3300025913 Ga0207695_10007148 Ga0207695_100071485 206
438 3300025919 Ga0207657_10029393 Ga0207657_100293934 206
439 3300025924 Ga0207694_10025769 Ga0207694_100257692 206
440 3300025924 Ga0207694_10337703 Ga0207694_103377033 206
441 3300025932 Ga0207690_10001660 Ga0207690_100016607 206
442 3300025949 Ga0207667_11055465 Ga0207667_110554651 206
443 3300025981 Ga0207640_10315368 Ga0207640_103153682 206
444 3300026041 Ga0207639_10012577 Ga0207639_100125775 206
445 3300026041 Ga0207639_10157490 Ga0207639_101574902 206
446 3300026095 Ga0207676_10033650 Ga0207676_100336502 206
447 3300026116 Ga0207674_10252047 Ga0207674_102520471 206
448 3300028379 Ga0268266_10000003 Ga0268266_10000003408 206
449 3300030521 Ga0307511_10028992 Ga0307511_100289924 206
450 3300033180 Ga0307510_10287929 Ga0307510_102879292 206
451 3300035170 Ga0373943_0057582 Ga0373943_0057582_49_669 206
452 3300035695 Ga0373927_0000200 Ga0373927_0000200_14094_14714 206
453 3300037068 Ga0373925_0000032 Ga0373925_0000032_24560_25180 206
454 3300037471 Ga0395905_1142066 Ga0395905_1142066_16_636 206
455 3300039437 Ga0436365_0605416 Ga0436365_0605416_157_777 206
456 3300044712 Ga0453684_0207944 Ga0453684_0207944_725_1345 206
457 3300046539 Ga0495621_0197884 Ga0495621_0197884_124_744 206
458 3300046616 Ga0495668_0166305 Ga0495668_0166305_172_792 206
459 3300046660 Ga0495625_0082013 Ga0495625_0082013_923_1543 206
460 3300046684 Ga0495669_0001558 Ga0495669_0001558_3013_3636 206
461 3300047320 Ga0495672_0035954 Ga0495672_0035954_726_1415 206
462 3300047443 Ga0495687_159711 Ga0495687_159711_107_727 206
463 3300047445 Ga0495677_0019033 Ga0495677_0019033_1051_1674 206
464 3300047472 Ga0495686_0017558 Ga0495686_0017558_2311_2931 206
465 3300048918 Ga0496115_0021682 Ga0496115_0021682_2728_3354 206
466 3300049570 Ga0501033_0049764 Ga0501033_0049764_2126_2752 206
467 3300049571 Ga0501034_0101676 Ga0501034_0101676_1432_2055 206
468 3300049571 Ga0501034_0582331 Ga0501034_0582331_242_865 206
469 3300049573 Ga0501037_0404878 Ga0501037_0404878_62_688 206
470 3300049579 Ga0501043_0451722 Ga0501043_0451722_277_903 206
471 3300049581 Ga0501047_0058603 Ga0501047_0058603_2131_2757 206
472 3300049822 Ga0501035_0122171 Ga0501035_0122171_1204_1830 206
473 3300049823 Ga0501044_0008562 Ga0501044_0008562_10296_10922 206
474 3300050496 nmdc:mga07m45_21481_c1 nmdc:mga07m45_21481_c1_1487_2110 206
475 3300053108 Ga0500562_010991 Ga0500562_010991_124_747 206
476 3300053730 Ga0500645_001121 Ga0500645_001121_8523_9143 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

24

214

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7687 5 198
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7462 5 198
6wmv-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.6825 2 199
5d92-assembly2.cif.gz_B structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.6272 12 205
5d91-assembly1.cif.gz_A structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.6243 12 205
ID Description Score Start End Superfamily
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8819 2 204 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8797 5 203 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8566 5 203 1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8456 2 204 1.20.120.1760
af_A0A1D6JYP0_117_317_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.7997 4 204 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A258KTJ9-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9743 1 159 GO:0005886
GO:0008444
GO:0046474
AF-A0A257J375-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9688 1 206 GO:0005886
GO:0008444
GO:0046474
AF-A0A257J375-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9641 1 206 GO:0005886
GO:0008444
GO:0046474
AF-A0A258KTJ9-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9625 1 159 GO:0005886
GO:0008444
GO:0046474
AF-A0A1F8IFA6-F1-model_v4 deleted 0.9586 36 205

Feature Viewer

pLDDT pTM Quality
88.39 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map