F451521

General Info

Members Datasets Scaffolds Average Seq Length
476 207 952 168

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10087914|Ga0099796_100879142
Length 161
Sequence MSESDYDRVWEIMDDIAICMVTTHAGGKMRSRPMHAVPDRPAGCIYFVTDTRGAKDDEIAAAPDVCLAFADIGDNTYLSVTGTAEMIRDPAKAEDLWSAEAQAWWPRGPNDPSVRVLRVVPEQAEYWDTRGNPITVALKLIAARVSGREPNLGENRKVTIR

Samples

Sample ID Description Type Environment
1 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
146 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
147 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
148 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
165 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
166 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
169 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
170 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
171 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
172 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
173 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
176 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
177 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
178 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
179 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
180 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
181 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
182 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
183 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
184 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
185 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
186 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
187 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
188 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
189 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
190 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
191 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
192 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
193 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
194 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
195 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
196 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
197 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
198 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
199 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
200 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.1
Rhizosphere 97.9
Stem 0
Stem Tuber 0
Unclassified 28.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099796_10087914 3300010159 Bacteria 1151
2 SwRhRL2b_contig_289222 2162886007 Eukaryota 1109
3 MBSR1b_contig_11416720 2162886012 Bacteria 1665
4 MBSR1b_contig_6896056 2162886012 Bacteria 1365
5 JGI24751J29686_10000008 3300002459 Bacteria 128004
6 JGI24751J29686_10000029 3300002459 Bacteria 93445
7 JGI25406J46586_10000909 3300003203 Bacteria 13912
8 Ga0065714_10264609 3300005288 Unclassified 739
9 Ga0065712_10040541 3300005290 Bacteria 913
10 Ga0065712_10087571 3300005290 Bacteria 2569
11 Ga0065712_10094938 3300005290 Bacteria 2235
12 Ga0065715_10004442 3300005293 Bacteria 3672
13 Ga0065715_10123909 3300005293 Unclassified 2166
14 Ga0065715_10148400 3300005293 Bacteria 1743
15 Ga0065715_10304436 3300005293 Bacteria 1034
16 Ga0065715_10360479 3300005293 Unclassified 936
17 Ga0065715_10679386 3300005293 Bacteria 656
18 Ga0065707_10082889 3300005295 Bacteria 11567
19 Ga0065707_10098941 3300005295 Bacteria 3044
20 Ga0065707_10116907 3300005295 Unclassified 2225
21 Ga0065707_10151937 3300005295 Bacteria 1649
22 Ga0065707_10184624 3300005295 Bacteria 1396
23 Ga0070690_100008645 3300005330 Bacteria 5871
24 Ga0070690_100134001 3300005330 Bacteria 1676
25 Ga0070670_100000441 3300005331 Bacteria 33901
26 Ga0070670_100382072 3300005331 Unclassified 1241
27 Ga0070670_100415333 3300005331 Bacteria 1189
28 Ga0070670_100571882 3300005331 Bacteria 1009
29 Ga0068869_100062801 3300005334 Bacteria 2727
30 Ga0068869_100491782 3300005334 Unclassified 1023
31 Ga0068869_100615256 3300005334 Bacteria 919
32 Ga0070680_100748061 3300005336 Unclassified 842
33 Ga0070682_100005342 3300005337 Bacteria 7147
34 Ga0070682_100009261 3300005337 Bacteria 5571
35 Ga0068868_100574438 3300005338 Unclassified 996
36 Ga0068868_100993412 3300005338 Unclassified 767
37 Ga0070689_100005531 3300005340 Bacteria 8642
38 Ga0070689_100434274 3300005340 Bacteria 1115
39 Ga0070689_100551650 3300005340 Unclassified 993
40 Ga0070689_100750549 3300005340 Unclassified 855
41 Ga0070687_100083917 3300005343 Unclassified 1745
42 Ga0070687_100118458 3300005343 Bacteria 1510
43 Ga0070687_100715754 3300005343 Bacteria 701
44 Ga0070692_10022689 3300005345 Unclassified 3068
45 Ga0070692_10028665 3300005345 Bacteria 2769
46 Ga0070692_10084950 3300005345 Bacteria 1712
47 Ga0070692_10359338 3300005345 Unclassified 907
48 Ga0070669_101000713 3300005353 Unclassified 717
49 Ga0070671_100085994 3300005355 Bacteria 2631
50 Ga0070673_100059276 3300005364 Bacteria 3029
51 Ga0070673_100064393 3300005364 Bacteria 2921
52 Ga0070673_100655524 3300005364 Unclassified 961
53 Ga0070703_10015116 3300005406 Bacteria 2206
54 Ga0070701_10028374 3300005438 Unclassified 2751
55 Ga0070705_100004106 3300005440 Bacteria 7110
56 Ga0070705_100166077 3300005440 Bacteria 1480
57 Ga0070705_100347667 3300005440 Unclassified 1080
58 Ga0070700_100000043 3300005441 Bacteria 98943
59 Ga0070700_100012314 3300005441 Bacteria 4767
60 Ga0070700_100048299 3300005441 Unclassified 2637
61 Ga0070700_100141606 3300005441 Bacteria 1635
62 Ga0070694_100002355 3300005444 Bacteria 11162
63 Ga0070694_100009364 3300005444 Bacteria 6011
64 Ga0070694_100019163 3300005444 Unclassified 4350
65 Ga0070694_100118066 3300005444 Unclassified 1899
66 Ga0070694_100210468 3300005444 Bacteria 1454
67 Ga0070694_100643135 3300005444 Bacteria 858
68 Ga0070694_100748128 3300005444 Unclassified 798
69 Ga0070681_10425976 3300005458 Unclassified 1239
70 Ga0068867_100021451 3300005459 Bacteria 4609
71 Ga0068867_100046187 3300005459 Bacteria 3198
72 Ga0070685_11130914 3300005466 Unclassified 593
73 Ga0070679_100067363 3300005530 Bacteria 3570
74 Ga0068853_100416300 3300005539 Bacteria 1260
75 Ga0070672_101266052 3300005543 Bacteria 658
76 Ga0070686_100074316 3300005544 Bacteria 2234
77 Ga0070695_100084096 3300005545 Unclassified 2110
78 Ga0070695_100257908 3300005545 Bacteria 1272
79 Ga0070695_100261847 3300005545 Bacteria 1263
80 Ga0070695_100930023 3300005545 Unclassified 704
81 Ga0070696_100166992 3300005546 Unclassified 1625
82 Ga0070696_100286600 3300005546 Bacteria 1257
83 Ga0070696_100353298 3300005546 Bacteria 1139
84 Ga0070696_100395004 3300005546 Bacteria 1081
85 Ga0070696_100945093 3300005546 Unclassified 717
86 Ga0070696_101085618 3300005546 Unclassified 672
87 Ga0070693_100004719 3300005547 Bacteria 6479
88 Ga0070693_100005353 3300005547 Bacteria 6153
89 Ga0070693_100266581 3300005547 Bacteria 1141
90 Ga0070693_100461280 3300005547 Unclassified 894
91 Ga0070693_100862152 3300005547 Unclassified 676
92 Ga0070693_101007109 3300005547 Bacteria 631
93 Ga0070704_100098091 3300005549 Unclassified 2201
94 Ga0070704_100117791 3300005549 Bacteria 2033
95 Ga0070704_100141750 3300005549 Unclassified 1878
96 Ga0068855_100949994 3300005563 Bacteria 905
97 Ga0068857_100061009 3300005577 Unclassified 3350
98 Ga0068857_100637670 3300005577 Bacteria 1009
99 Ga0068857_100667158 3300005577 Bacteria 986
100 Ga0068857_100815488 3300005577 Bacteria 892
101 Ga0068854_100363036 3300005578 Bacteria 1189
102 Ga0068854_100448733 3300005578 Bacteria 1077
103 Ga0070702_100003627 3300005615 Bacteria 6944
104 Ga0070702_100296414 3300005615 Bacteria 1117
105 Ga0070702_100377917 3300005615 Bacteria 1006
106 Ga0070702_100446627 3300005615 Unclassified 937
107 Ga0070702_100668855 3300005615 Bacteria 787
108 Ga0070702_100958298 3300005615 Bacteria 674
109 Ga0068852_100716188 3300005616 Bacteria 1011
110 Ga0068859_100006579 3300005617 Bacteria 11793
111 Ga0068859_100091197 3300005617 Bacteria 3098
112 Ga0068859_100113878 3300005617 Bacteria 2768
113 Ga0068859_100147981 3300005617 Bacteria 2424
114 Ga0068859_100245930 3300005617 Bacteria 1878
115 Ga0068859_100364819 3300005617 Unclassified 1539
116 Ga0068859_100371552 3300005617 Bacteria 1525
117 Ga0068859_100426894 3300005617 Bacteria 1422
118 Ga0068859_100661346 3300005617 Bacteria 1136
119 Ga0068859_101271184 3300005617 Bacteria 811
120 Ga0068864_100039237 3300005618 Bacteria 4047
121 Ga0068864_100369081 3300005618 Bacteria 1358
122 Ga0068864_100685262 3300005618 Unclassified 1000
123 Ga0068864_101368634 3300005618 Unclassified 709
124 Ga0068866_10518205 3300005718 Unclassified 792
125 Ga0068861_101462873 3300005719 Unclassified 669
126 Ga0068870_10008423 3300005840 Bacteria 4638
127 Ga0068870_10249925 3300005840 Unclassified 1099
128 Ga0068870_10362843 3300005840 Unclassified 933
129 Ga0068870_10691909 3300005840 Unclassified 702
130 Ga0068863_100008280 3300005841 Bacteria 10161
131 Ga0068863_100095573 3300005841 Bacteria 2820
132 Ga0068863_100286082 3300005841 Bacteria 1598
133 Ga0068863_100626495 3300005841 Bacteria 1066
134 Ga0068863_100740033 3300005841 Unclassified 979
135 Ga0068863_100989074 3300005841 Bacteria 844
136 Ga0068858_100027592 3300005842 Bacteria 5274
137 Ga0068858_100027671 3300005842 Bacteria 5267
138 Ga0068858_100073403 3300005842 Bacteria 3175
139 Ga0068858_100085054 3300005842 Unclassified 2942
140 Ga0068858_100128236 3300005842 Bacteria 2377
141 Ga0068858_100153321 3300005842 Bacteria 2167
142 Ga0068858_100985406 3300005842 Unclassified 826
143 Ga0068860_100051703 3300005843 Bacteria 3908
144 Ga0068860_100082117 3300005843 Bacteria 3065
145 Ga0068860_100103142 3300005843 Bacteria 2722
146 Ga0068860_100160053 3300005843 Bacteria 2171
147 Ga0068860_100168680 3300005843 Bacteria 2114
148 Ga0068860_100268195 3300005843 Unclassified 1665
149 Ga0068860_100294759 3300005843 Bacteria 1588
150 Ga0068860_100303689 3300005843 Bacteria 1564
151 Ga0068860_100304198 3300005843 Bacteria 1563
152 Ga0068860_100465814 3300005843 Bacteria 1258
153 Ga0068860_100701204 3300005843 Bacteria 1022
154 Ga0068860_100797248 3300005843 Bacteria 958
155 Ga0068862_100013369 3300005844 Bacteria 6791
156 Ga0068862_100058151 3300005844 Bacteria 3317
157 Ga0068862_100181948 3300005844 Unclassified 1887
158 Ga0068862_100453102 3300005844 Bacteria 1210
159 Ga0068862_100696927 3300005844 Bacteria 983
160 Ga0081539_10000697 3300005985 Bacteria 67380
161 Ga0075432_10129755 3300006058 Unclassified 954
162 Ga0097621_100074777 3300006237 Bacteria 2806
163 Ga0068871_100006324 3300006358 Bacteria 8370
164 Ga0068871_101035377 3300006358 Unclassified 766
165 Ga0075428_100042504 3300006844 Bacteria 4997
166 Ga0075430_100038251 3300006846 Bacteria 4065
167 Ga0075430_100356853 3300006846 Bacteria 1207
168 Ga0075431_100168972 3300006847 Bacteria 2248
169 Ga0075433_10009635 3300006852 Bacteria 7730
170 Ga0075433_10028054 3300006852 Plasmid 4782
171 Ga0075433_10572481 3300006852 Bacteria 992
172 Ga0075433_10627584 3300006852 Unclassified 943
173 Ga0075434_100155065 3300006871 Bacteria 2310
174 Ga0075434_101820110 3300006871 Unclassified 615
175 Ga0075429_100144058 3300006880 Bacteria 2085
176 Ga0068865_100328202 3300006881 Bacteria 1233
177 Ga0068865_100749821 3300006881 Bacteria 838
178 Ga0075436_100011505 3300006914 Bacteria 6071
179 Ga0097620_100006579 3300006931 Bacteria 11793
180 Ga0097620_100091195 3300006931 Bacteria 3098
181 Ga0097620_100113872 3300006931 Bacteria 2768
182 Ga0097620_100136088 3300006931 Bacteria 2530
183 Ga0097620_100147985 3300006931 Bacteria 2424
184 Ga0097620_100245918 3300006931 Bacteria 1878
185 Ga0097620_100364818 3300006931 Unclassified 1539
186 Ga0097620_100371528 3300006931 Bacteria 1525
187 Ga0097620_100426873 3300006931 Bacteria 1422
188 Ga0097620_100495019 3300006931 Bacteria 1318
189 Ga0097620_100661344 3300006931 Bacteria 1136
190 Ga0097620_101271121 3300006931 Bacteria 811
191 Ga0075435_100405501 3300007076 Bacteria 1173
192 Ga0099795_10292854 3300007788 Unclassified 714
193 Ga0111539_10012147 3300009094 Bacteria 10802
194 Ga0111539_10030330 3300009094 Bacteria 6574
195 Ga0105245_12338562 3300009098 Bacteria 588
196 Ga0105247_10000990 3300009101 Bacteria 21433
197 Ga0105247_10033567 3300009101 Bacteria 3122
198 Ga0105247_10078253 3300009101 Bacteria 2080
199 Ga0114129_10025842 3300009147 Bacteria 8316
200 Ga0114129_10320368 3300009147 Bacteria 2061
201 Ga0114129_10703979 3300009147 Unclassified 1298
202 Ga0114129_10968556 3300009147 Bacteria 1073
203 Ga0105243_10003025 3300009148 Bacteria 13862
204 Ga0105243_10148736 3300009148 Bacteria 2007
205 Ga0105243_10711463 3300009148 Bacteria 980
206 Ga0105243_10830000 3300009148 Bacteria 914
207 Ga0105241_10047635 3300009174 Bacteria 3260
208 Ga0105241_10131598 3300009174 Bacteria 2026
209 Ga0105241_10182566 3300009174 Bacteria 1741
210 Ga0105241_10265611 3300009174 Unclassified 1460
211 Ga0105241_10374969 3300009174 Bacteria 1242
212 Ga0105241_10458957 3300009174 Bacteria 1128
213 Ga0105241_10464216 3300009174 Bacteria 1122
214 Ga0105242_10060141 3300009176 Bacteria 3120
215 Ga0105248_10001585 3300009177 Bacteria 25333
216 Ga0105248_10119114 3300009177 Bacteria 2978
217 Ga0105248_10343385 3300009177 Unclassified 1680
218 Ga0105248_10417355 3300009177 Bacteria 1511
219 Ga0105248_10489744 3300009177 Bacteria 1386
220 Ga0105248_10626253 3300009177 Unclassified 1214
221 Ga0105248_10872889 3300009177 Bacteria 1016
222 Ga0105237_10001387 3300009545 Bacteria 32008
223 Ga0105237_10122955 3300009545 Bacteria 2589
224 Ga0105237_11928145 3300009545 Unclassified 599
225 Ga0105238_10002410 3300009551 Bacteria 18748
226 Ga0105238_10007298 3300009551 Bacteria 11065
227 Ga0105238_11096774 3300009551 Bacteria 819
228 Ga0105249_10010933 3300009553 Bacteria 7978
229 Ga0105249_10515883 3300009553 Bacteria 1242
230 Ga0105239_10085682 3300010375 Bacteria 3472
231 Ga0105239_10269062 3300010375 Bacteria 1916
232 Ga0105239_10819637 3300010375 Bacteria 1066
233 Ga0105239_11973173 3300010375 Unclassified 677
234 Ga0105246_10010236 3300011119 Bacteria 5792
235 Ga0105246_10012457 3300011119 Bacteria 5309
236 Ga0105246_10403617 3300011119 Unclassified 1136
237 Ga0157373_10090182 3300013100 Bacteria 2159
238 Ga0157374_10156046 3300013296 Bacteria 2221
239 Ga0157378_10025928 3300013297 Bacteria 5165
240 Ga0157378_10060571 3300013297 Bacteria 3377
241 Ga0157378_10400409 3300013297 Bacteria 1352
242 Ga0157378_10515309 3300013297 Bacteria 1197
243 Ga0157378_10531376 3300013297 Unclassified 1179
244 Ga0157378_10674263 3300013297 Bacteria 1051
245 Ga0157378_10721052 3300013297 Bacteria 1018
246 Ga0163162_10156813 3300013306 Bacteria 2397
247 Ga0163162_10210529 3300013306 Bacteria 2074
248 Ga0163162_10605251 3300013306 Bacteria 1222
249 Ga0163162_10921651 3300013306 Bacteria 986
250 Ga0157372_10017112 3300013307 Bacteria 7782
251 Ga0157372_10358899 3300013307 Unclassified 1698
252 Ga0157372_10606947 3300013307 Bacteria 1275
253 Ga0157375_10830739 3300013308 Bacteria 1071
254 Ga0163163_10005551 3300014325 Bacteria 10923
255 Ga0163163_10314542 3300014325 Unclassified 1619
256 Ga0163163_10516259 3300014325 Bacteria 1257
257 Ga0163163_10655742 3300014325 Bacteria 1113
258 Ga0163163_10895834 3300014325 Unclassified 951
259 Ga0157380_10023227 3300014326 Bacteria 4676
260 Ga0157380_10867646 3300014326 Unclassified 926
261 Ga0157377_10082655 3300014745 Unclassified 1880
262 Ga0157379_10933150 3300014968 Unclassified 825
263 Ga0157376_11612957 3300014969 Bacteria 683
264 Ga0182007_10158818 3300015262 Unclassified 772
265 Ga0163161_10181743 3300017792 Bacteria 1613
266 Ga0207697_10052136 3300025315 Bacteria 1692
267 Ga0207653_10029669 3300025885 Unclassified 1762
268 Ga0207653_10173758 3300025885 Bacteria 803
269 Ga0207710_10000370 3300025900 Bacteria 31536
270 Ga0207710_10109168 3300025900 Bacteria 1313
271 Ga0207710_10208996 3300025900 Bacteria 966
272 Ga0207647_10000950 3300025904 Bacteria 22415
273 Ga0207647_10081481 3300025904 Bacteria 1939
274 Ga0207647_10088312 3300025904 Unclassified 1851
275 Ga0207647_10509077 3300025904 Bacteria 671
276 Ga0207643_10001837 3300025908 Bacteria 11759
277 Ga0207643_10346087 3300025908 Unclassified 932
278 Ga0207654_10169286 3300025911 Unclassified 1417
279 Ga0207654_10320169 3300025911 Bacteria 1060
280 Ga0207654_10558210 3300025911 Unclassified 814
281 Ga0207707_10327846 3300025912 Bacteria 1321
282 Ga0207671_10002825 3300025914 Bacteria 18059
283 Ga0207660_10352818 3300025917 Unclassified 1179
284 Ga0207662_10036517 3300025918 Bacteria 2872
285 Ga0207662_10048946 3300025918 Bacteria 2506
286 Ga0207662_10097081 3300025918 Bacteria 1821
287 Ga0207662_10127902 3300025918 Unclassified 1599
288 Ga0207649_10643619 3300025920 Unclassified 818
289 Ga0207649_10743510 3300025920 Bacteria 763
290 Ga0207652_10036484 3300025921 Bacteria 4156
291 Ga0207681_10602758 3300025923 Unclassified 908
292 Ga0207681_10826649 3300025923 Bacteria 774
293 Ga0207694_10010849 3300025924 Bacteria 6878
294 Ga0207694_10014931 3300025924 Bacteria 5857
295 Ga0207694_10637101 3300025924 Bacteria 898
296 Ga0207650_10000087 3300025925 Bacteria 123505
297 Ga0207650_10020561 3300025925 Bacteria 4657
298 Ga0207650_10130252 3300025925 Bacteria 1968
299 Ga0207650_10702574 3300025925 Unclassified 854
300 Ga0207659_10563820 3300025926 Unclassified 969
301 Ga0207644_10183442 3300025931 Bacteria 1641
302 Ga0207690_10038043 3300025932 Unclassified 3128
303 Ga0207690_10895620 3300025932 Bacteria 736
304 Ga0207706_10249868 3300025933 Bacteria 1549
305 Ga0207686_10058202 3300025934 Unclassified 2436
306 Ga0207709_10001595 3300025935 Bacteria 15463
307 Ga0207670_10001652 3300025936 Bacteria 11636
308 Ga0207670_10747785 3300025936 Unclassified 812
309 Ga0207704_10286527 3300025938 Bacteria 1255
310 Ga0207704_10591678 3300025938 Bacteria 907
311 Ga0207704_10594600 3300025938 Bacteria 905
312 Ga0207704_10784524 3300025938 Unclassified 795
313 Ga0207665_10090688 3300025939 Unclassified 2119
314 Ga0207711_10006523 3300025941 Bacteria 9823
315 Ga0207711_10305483 3300025941 Bacteria 1468
316 Ga0207711_10521495 3300025941 Bacteria 1108
317 Ga0207689_10049818 3300025942 Bacteria 3455
318 Ga0207689_10130954 3300025942 Bacteria 2065
319 Ga0207689_10148596 3300025942 Bacteria 1931
320 Ga0207689_10326084 3300025942 Bacteria 1275
321 Ga0207689_10429596 3300025942 Bacteria 1103
322 Ga0207689_10594053 3300025942 Bacteria 931
323 Ga0207679_10076695 3300025945 Bacteria 2540
324 Ga0207679_10456936 3300025945 Unclassified 1133
325 Ga0207651_10040736 3300025960 Unclassified 3077
326 Ga0207651_10180987 3300025960 Bacteria 1672
327 Ga0207651_10336319 3300025960 Unclassified 1267
328 Ga0207651_10770027 3300025960 Unclassified 852
329 Ga0207712_10009970 3300025961 Bacteria 6021
330 Ga0207677_10495168 3300026023 Bacteria 1055
331 Ga0207703_10126316 3300026035 Bacteria 2203
332 Ga0207703_10133585 3300026035 Bacteria 2146
333 Ga0207703_10258456 3300026035 Bacteria 1573
334 Ga0207703_10667404 3300026035 Bacteria 987
335 Ga0207703_10913152 3300026035 Unclassified 841
336 Ga0207703_10913601 3300026035 Unclassified 841
337 Ga0207639_10418509 3300026041 Bacteria 1211
338 Ga0207639_10439780 3300026041 Unclassified 1182
339 Ga0207639_10614439 3300026041 Bacteria 1003
340 Ga0207708_10018681 3300026075 Bacteria 5221
341 Ga0207708_10020487 3300026075 Bacteria 4987
342 Ga0207708_10026896 3300026075 Bacteria 4356
343 Ga0207708_10049222 3300026075 Bacteria 3209
344 Ga0207708_10083008 3300026075 Bacteria 2463
345 Ga0207708_10092920 3300026075 Bacteria 2328
346 Ga0207641_10261825 3300026088 Bacteria 1620
347 Ga0207641_10768047 3300026088 Unclassified 952
348 Ga0207641_10854938 3300026088 Unclassified 902
349 Ga0207648_10041413 3300026089 Bacteria 4044
350 Ga0207648_10143205 3300026089 Bacteria 2108
351 Ga0207648_10486194 3300026089 Bacteria 1128
352 Ga0207676_10023699 3300026095 Bacteria 4533
353 Ga0207676_10132623 3300026095 Bacteria 2121
354 Ga0207676_10341178 3300026095 Bacteria 1382
355 Ga0207676_10368331 3300026095 Bacteria 1334
356 Ga0207676_10467558 3300026095 Bacteria 1192
357 Ga0207676_10717525 3300026095 Unclassified 970
358 Ga0207674_10032372 3300026116 Bacteria 5486
359 Ga0207674_10055614 3300026116 Unclassified 4022
360 Ga0207674_10184801 3300026116 Unclassified 2035
361 Ga0207674_10479632 3300026116 Bacteria 1202
362 Ga0207674_11479621 3300026116 Unclassified 648
363 Ga0207675_100124600 3300026118 Unclassified 2440
364 Ga0207675_100138385 3300026118 Bacteria 2311
365 Ga0207675_101405612 3300026118 Unclassified 718
366 Ga0207698_10799126 3300026142 Unclassified 945
367 Ga0207698_10800559 3300026142 Unclassified 945
368 Ga0207698_11119681 3300026142 Bacteria 800
369 Ga0207428_10196588 3300027907 Bacteria 1518
370 Ga0207428_10469672 3300027907 Bacteria 916
371 Ga0268265_10217069 3300028380 Bacteria 1671
372 Ga0268265_10400050 3300028380 Unclassified 1269
373 Ga0268265_10433798 3300028380 Bacteria 1223
374 Ga0268265_10467267 3300028380 Unclassified 1182
375 Ga0268265_10645625 3300028380 Unclassified 1017
376 Ga0268265_11608408 3300028380 Bacteria 655
377 Ga0268264_10110665 3300028381 Bacteria 2405
378 Ga0268264_10261151 3300028381 Bacteria 1613
379 Ga0268264_10264705 3300028381 Bacteria 1603
380 Ga0268264_10302123 3300028381 Bacteria 1507
381 Ga0268264_10386602 3300028381 Bacteria 1341
382 Ga0268264_10408799 3300028381 Bacteria 1306
383 Ga0268264_10434007 3300028381 Bacteria 1269
384 Ga0307408_100008744 3300031548 Bacteria 6684
385 Ga0307405_10006470 3300031731 Bacteria 5765
386 Ga0307413_10168169 3300031824 Bacteria 1548
387 Ga0307413_10584794 3300031824 Bacteria 911
388 Ga0307410_10002250 3300031852 Bacteria 9226
389 Ga0307410_10217218 3300031852 Bacteria 1469
390 Ga0307406_10004665 3300031901 Bacteria 7465
391 Ga0307406_11294607 3300031901 Bacteria 636
392 Ga0307412_10024994 3300031911 Bacteria 3694
393 Ga0307416_100003878 3300032002 Bacteria 8901
394 Ga0307416_100351532 3300032002 Unclassified 1492
395 Ga0307414_10004772 3300032004 Bacteria 7397
396 Ga0307414_10412949 3300032004 Bacteria 1175
397 Ga0307411_10015278 3300032005 Bacteria 4306
398 Ga0307415_100146440 3300032126 Bacteria 1811
399 Ga0373958_0145425 3300034819 Bacteria 590
400 Ga0373940_0039743 3300035088 Bacteria 1289
401 Ga0373949_0034603 3300035090 Bacteria 1218
402 Ga0373951_0220691 3300035091 Unclassified 559
403 Ga0373941_0051539 3300035115 Bacteria 1310
404 Ga0373942_0011851 3300035207 Unclassified 2073
405 Ga0373961_0031165 3300035241 Bacteria 1488
406 Ga0242420_017510 3300038996 Unclassified 1254
407 Ga0439458_0009512 3300042157 Bacteria 2164
408 Ga0439459_0002717 3300042438 Bacteria 2751
409 Ga0439464_0253711 3300042439 Unclassified 569
410 Ga0451577_0401094 3300042876 Bacteria 1245
411 Ga0453683_0807333 3300044673 Unclassified 618
412 Ga0496102_0156166 3300048905 Bacteria 2145
413 Ga0496103_0581339 3300048906 Bacteria 714
414 Ga0496106_0014908 3300048909 Bacteria 5749
415 Ga0496107_0350613 3300048910 Bacteria 1098
416 Ga0496112_0049220 3300048915 Unclassified 4131
417 Ga0496112_0263735 3300048915 Bacteria 1672
418 Ga0496112_0284629 3300048915 Bacteria 1600
419 Ga0496112_1174835 3300048915 Unclassified 684
420 Ga0496112_1212496 3300048915 Unclassified 671
421 Ga0496113_1331715 3300048916 Unclassified 558
422 Ga0501292_001526 3300049515 Bacteria 2859
423 Ga0501295_102352 3300049518 Unclassified 673
424 Ga0501296_052366 3300049519 Unclassified 600
425 Ga0501038_0001998 3300049574 Bacteria 18813
426 Ga0501198_104460 3300049649 Unclassified 578
427 Ga0501202_000509 3300049652 Bacteria 5583
428 Ga0501207_003292 3300049654 Bacteria 2145
429 Ga0501207_043362 3300049654 Unclassified 787
430 Ga0501209_012242 3300049656 Bacteria 1823
431 Ga0501209_041815 3300049656 Unclassified 1215
432 Ga0501214_005396 3300049659 Unclassified 1228
433 Ga0501216_024410 3300049660 Bacteria 1080
434 Ga0501217_000420 3300049661 Bacteria 6885
435 Ga0501217_125716 3300049661 Unclassified 748
436 Ga0501223_002090 3300049663 Bacteria 4482
437 Ga0501224_000536 3300049664 Bacteria 4653
438 Ga0501224_024825 3300049664 Unclassified 896
439 Ga0501227_001492 3300049665 Bacteria 5216
440 Ga0501233_155358 3300049668 Unclassified 641
441 Ga0501235_000841 3300049669 Bacteria 6291
442 Ga0501236_036350 3300049670 Unclassified 800
443 Ga0501240_015226 3300049673 Unclassified 1091
444 Ga0501243_002349 3300049675 Bacteria 2762
445 Ga0501247_006971 3300049677 Bacteria 1290
446 Ga0501249_002147 3300049679 Bacteria 4014
447 Ga0501250_006293 3300049680 Bacteria 1251
448 Ga0501252_046568 3300049682 Unclassified 644
449 Ga0501257_021758 3300049686 Bacteria 1514
450 Ga0501260_012001 3300049689 Unclassified 882
451 Ga0501261_058135 3300049690 Unclassified 650
452 Ga0501221_004020 3300049704 Bacteria 2430
453 Ga0501225_0001788 3300049705 Bacteria 6727
454 Ga0501229_008930 3300049706 Unclassified 1257
455 Ga0501229_010205 3300049706 Bacteria 1184
456 Ga0501234_021079 3300049707 Bacteria 1037
457 Ga0501245_047892 3300049708 Unclassified 750
458 Ga0501268_002026 3300049765 Bacteria 2613
459 Ga0501272_014028 3300049769 Unclassified 922
460 Ga0501273_009655 3300049770 Unclassified 1175
461 Ga0501273_012545 3300049770 Bacteria 1069
462 Ga0501273_049863 3300049770 Unclassified 638
463 Ga0501204_000758 3300049850 Bacteria 2955
464 Ga0501212_003366 3300049851 Bacteria 2002
465 Ga0501226_000660 3300049853 Bacteria 4676
466 nmdc:mga05p37_1340353_c1 3300050507 Bacteria 726
467 nmdc:mga05p37_177665_c1 3300050507 Bacteria 2593
468 nmdc:mga0qj67_105574_c1 3300050509 Bacteria 2273
469 nmdc:mga06r32_584819_c1 3300050510 Bacteria 1088
470 nmdc:mga06r32_707539_c1 3300050510 Bacteria 973
471 nmdc:mga08y16_1574_c1 3300050511 Bacteria 23031
472 nmdc:mga08y16_47001_c1 3300050511 Bacteria 4518
473 nmdc:mga0n895_46041_c1 3300050512 Bacteria 4260
474 nmdc:mga08x19_81992_c1 3300050514 Bacteria 2119
475 nmdc:mga0a205_206772_c1 3300050515 Bacteria 1852
476 nmdc:mga0a205_305099_c1 3300050515 Bacteria 1464
477 Ga0099796_10087914
478 SwRhRL2b_contig_289222
479 MBSR1b_contig_11416720
480 MBSR1b_contig_6896056
481 JGI24751J29686_10000008
482 JGI24751J29686_10000029
483 JGI25406J46586_10000909
484 Ga0065714_10264609
485 Ga0065712_10040541
486 Ga0065712_10087571
487 Ga0065712_10094938
488 Ga0065715_10004442
489 Ga0065715_10123909
490 Ga0065715_10148400
491 Ga0065715_10304436
492 Ga0065715_10360479
493 Ga0065715_10679386
494 Ga0065707_10082889
495 Ga0065707_10098941
496 Ga0065707_10116907
497 Ga0065707_10151937
498 Ga0065707_10184624
499 Ga0070690_100008645
500 Ga0070690_100134001
501 Ga0070670_100000441
502 Ga0070670_100382072
503 Ga0070670_100415333
504 Ga0070670_100571882
505 Ga0068869_100062801
506 Ga0068869_100491782
507 Ga0068869_100615256
508 Ga0070680_100748061
509 Ga0070682_100005342
510 Ga0070682_100009261
511 Ga0068868_100574438
512 Ga0068868_100993412
513 Ga0070689_100005531
514 Ga0070689_100434274
515 Ga0070689_100551650
516 Ga0070689_100750549
517 Ga0070687_100083917
518 Ga0070687_100118458
519 Ga0070687_100715754
520 Ga0070692_10022689
521 Ga0070692_10028665
522 Ga0070692_10084950
523 Ga0070692_10359338
524 Ga0070669_101000713
525 Ga0070671_100085994
526 Ga0070673_100059276
527 Ga0070673_100064393
528 Ga0070673_100655524
529 Ga0070703_10015116
530 Ga0070701_10028374
531 Ga0070705_100004106
532 Ga0070705_100166077
533 Ga0070705_100347667
534 Ga0070700_100000043
535 Ga0070700_100012314
536 Ga0070700_100048299
537 Ga0070700_100141606
538 Ga0070694_100002355
539 Ga0070694_100009364
540 Ga0070694_100019163
541 Ga0070694_100118066
542 Ga0070694_100210468
543 Ga0070694_100643135
544 Ga0070694_100748128
545 Ga0070681_10425976
546 Ga0068867_100021451
547 Ga0068867_100046187
548 Ga0070685_11130914
549 Ga0070679_100067363
550 Ga0068853_100416300
551 Ga0070672_101266052
552 Ga0070686_100074316
553 Ga0070695_100084096
554 Ga0070695_100257908
555 Ga0070695_100261847
556 Ga0070695_100930023
557 Ga0070696_100166992
558 Ga0070696_100286600
559 Ga0070696_100353298
560 Ga0070696_100395004
561 Ga0070696_100945093
562 Ga0070696_101085618
563 Ga0070693_100004719
564 Ga0070693_100005353
565 Ga0070693_100266581
566 Ga0070693_100461280
567 Ga0070693_100862152
568 Ga0070693_101007109
569 Ga0070704_100098091
570 Ga0070704_100117791
571 Ga0070704_100141750
572 Ga0068855_100949994
573 Ga0068857_100061009
574 Ga0068857_100637670
575 Ga0068857_100667158
576 Ga0068857_100815488
577 Ga0068854_100363036
578 Ga0068854_100448733
579 Ga0070702_100003627
580 Ga0070702_100296414
581 Ga0070702_100377917
582 Ga0070702_100446627
583 Ga0070702_100668855
584 Ga0070702_100958298
585 Ga0068852_100716188
586 Ga0068859_100006579
587 Ga0068859_100091197
588 Ga0068859_100113878
589 Ga0068859_100147981
590 Ga0068859_100245930
591 Ga0068859_100364819
592 Ga0068859_100371552
593 Ga0068859_100426894
594 Ga0068859_100661346
595 Ga0068859_101271184
596 Ga0068864_100039237
597 Ga0068864_100369081
598 Ga0068864_100685262
599 Ga0068864_101368634
600 Ga0068866_10518205
601 Ga0068861_101462873
602 Ga0068870_10008423
603 Ga0068870_10249925
604 Ga0068870_10362843
605 Ga0068870_10691909
606 Ga0068863_100008280
607 Ga0068863_100095573
608 Ga0068863_100286082
609 Ga0068863_100626495
610 Ga0068863_100740033
611 Ga0068863_100989074
612 Ga0068858_100027592
613 Ga0068858_100027671
614 Ga0068858_100073403
615 Ga0068858_100085054
616 Ga0068858_100128236
617 Ga0068858_100153321
618 Ga0068858_100985406
619 Ga0068860_100051703
620 Ga0068860_100082117
621 Ga0068860_100103142
622 Ga0068860_100160053
623 Ga0068860_100168680
624 Ga0068860_100268195
625 Ga0068860_100294759
626 Ga0068860_100303689
627 Ga0068860_100304198
628 Ga0068860_100465814
629 Ga0068860_100701204
630 Ga0068860_100797248
631 Ga0068862_100013369
632 Ga0068862_100058151
633 Ga0068862_100181948
634 Ga0068862_100453102
635 Ga0068862_100696927
636 Ga0081539_10000697
637 Ga0075432_10129755
638 Ga0097621_100074777
639 Ga0068871_100006324
640 Ga0068871_101035377
641 Ga0075428_100042504
642 Ga0075430_100038251
643 Ga0075430_100356853
644 Ga0075431_100168972
645 Ga0075433_10009635
646 Ga0075433_10028054
647 Ga0075433_10572481
648 Ga0075433_10627584
649 Ga0075434_100155065
650 Ga0075434_101820110
651 Ga0075429_100144058
652 Ga0068865_100328202
653 Ga0068865_100749821
654 Ga0075436_100011505
655 Ga0097620_100006579
656 Ga0097620_100091195
657 Ga0097620_100113872
658 Ga0097620_100136088
659 Ga0097620_100147985
660 Ga0097620_100245918
661 Ga0097620_100364818
662 Ga0097620_100371528
663 Ga0097620_100426873
664 Ga0097620_100495019
665 Ga0097620_100661344
666 Ga0097620_101271121
667 Ga0075435_100405501
668 Ga0099795_10292854
669 Ga0111539_10012147
670 Ga0111539_10030330
671 Ga0105245_12338562
672 Ga0105247_10000990
673 Ga0105247_10033567
674 Ga0105247_10078253
675 Ga0114129_10025842
676 Ga0114129_10320368
677 Ga0114129_10703979
678 Ga0114129_10968556
679 Ga0105243_10003025
680 Ga0105243_10148736
681 Ga0105243_10711463
682 Ga0105243_10830000
683 Ga0105241_10047635
684 Ga0105241_10131598
685 Ga0105241_10182566
686 Ga0105241_10265611
687 Ga0105241_10374969
688 Ga0105241_10458957
689 Ga0105241_10464216
690 Ga0105242_10060141
691 Ga0105248_10001585
692 Ga0105248_10119114
693 Ga0105248_10343385
694 Ga0105248_10417355
695 Ga0105248_10489744
696 Ga0105248_10626253
697 Ga0105248_10872889
698 Ga0105237_10001387
699 Ga0105237_10122955
700 Ga0105237_11928145
701 Ga0105238_10002410
702 Ga0105238_10007298
703 Ga0105238_11096774
704 Ga0105249_10010933
705 Ga0105249_10515883
706 Ga0105239_10085682
707 Ga0105239_10269062
708 Ga0105239_10819637
709 Ga0105239_11973173
710 Ga0105246_10010236
711 Ga0105246_10012457
712 Ga0105246_10403617
713 Ga0157373_10090182
714 Ga0157374_10156046
715 Ga0157378_10025928
716 Ga0157378_10060571
717 Ga0157378_10400409
718 Ga0157378_10515309
719 Ga0157378_10531376
720 Ga0157378_10674263
721 Ga0157378_10721052
722 Ga0163162_10156813
723 Ga0163162_10210529
724 Ga0163162_10605251
725 Ga0163162_10921651
726 Ga0157372_10017112
727 Ga0157372_10358899
728 Ga0157372_10606947
729 Ga0157375_10830739
730 Ga0163163_10005551
731 Ga0163163_10314542
732 Ga0163163_10516259
733 Ga0163163_10655742
734 Ga0163163_10895834
735 Ga0157380_10023227
736 Ga0157380_10867646
737 Ga0157377_10082655
738 Ga0157379_10933150
739 Ga0157376_11612957
740 Ga0182007_10158818
741 Ga0163161_10181743
742 Ga0207697_10052136
743 Ga0207653_10029669
744 Ga0207653_10173758
745 Ga0207710_10000370
746 Ga0207710_10109168
747 Ga0207710_10208996
748 Ga0207647_10000950
749 Ga0207647_10081481
750 Ga0207647_10088312
751 Ga0207647_10509077
752 Ga0207643_10001837
753 Ga0207643_10346087
754 Ga0207654_10169286
755 Ga0207654_10320169
756 Ga0207654_10558210
757 Ga0207707_10327846
758 Ga0207671_10002825
759 Ga0207660_10352818
760 Ga0207662_10036517
761 Ga0207662_10048946
762 Ga0207662_10097081
763 Ga0207662_10127902
764 Ga0207649_10643619
765 Ga0207649_10743510
766 Ga0207652_10036484
767 Ga0207681_10602758
768 Ga0207681_10826649
769 Ga0207694_10010849
770 Ga0207694_10014931
771 Ga0207694_10637101
772 Ga0207650_10000087
773 Ga0207650_10020561
774 Ga0207650_10130252
775 Ga0207650_10702574
776 Ga0207659_10563820
777 Ga0207644_10183442
778 Ga0207690_10038043
779 Ga0207690_10895620
780 Ga0207706_10249868
781 Ga0207686_10058202
782 Ga0207709_10001595
783 Ga0207670_10001652
784 Ga0207670_10747785
785 Ga0207704_10286527
786 Ga0207704_10591678
787 Ga0207704_10594600
788 Ga0207704_10784524
789 Ga0207665_10090688
790 Ga0207711_10006523
791 Ga0207711_10305483
792 Ga0207711_10521495
793 Ga0207689_10049818
794 Ga0207689_10130954
795 Ga0207689_10148596
796 Ga0207689_10326084
797 Ga0207689_10429596
798 Ga0207689_10594053
799 Ga0207679_10076695
800 Ga0207679_10456936
801 Ga0207651_10040736
802 Ga0207651_10180987
803 Ga0207651_10336319
804 Ga0207651_10770027
805 Ga0207712_10009970
806 Ga0207677_10495168
807 Ga0207703_10126316
808 Ga0207703_10133585
809 Ga0207703_10258456
810 Ga0207703_10667404
811 Ga0207703_10913152
812 Ga0207703_10913601
813 Ga0207639_10418509
814 Ga0207639_10439780
815 Ga0207639_10614439
816 Ga0207708_10018681
817 Ga0207708_10020487
818 Ga0207708_10026896
819 Ga0207708_10049222
820 Ga0207708_10083008
821 Ga0207708_10092920
822 Ga0207641_10261825
823 Ga0207641_10768047
824 Ga0207641_10854938
825 Ga0207648_10041413
826 Ga0207648_10143205
827 Ga0207648_10486194
828 Ga0207676_10023699
829 Ga0207676_10132623
830 Ga0207676_10341178
831 Ga0207676_10368331
832 Ga0207676_10467558
833 Ga0207676_10717525
834 Ga0207674_10032372
835 Ga0207674_10055614
836 Ga0207674_10184801
837 Ga0207674_10479632
838 Ga0207674_11479621
839 Ga0207675_100124600
840 Ga0207675_100138385
841 Ga0207675_101405612
842 Ga0207698_10799126
843 Ga0207698_10800559
844 Ga0207698_11119681
845 Ga0207428_10196588
846 Ga0207428_10469672
847 Ga0268265_10217069
848 Ga0268265_10400050
849 Ga0268265_10433798
850 Ga0268265_10467267
851 Ga0268265_10645625
852 Ga0268265_11608408
853 Ga0268264_10110665
854 Ga0268264_10261151
855 Ga0268264_10264705
856 Ga0268264_10302123
857 Ga0268264_10386602
858 Ga0268264_10408799
859 Ga0268264_10434007
860 Ga0307408_100008744
861 Ga0307405_10006470
862 Ga0307413_10168169
863 Ga0307413_10584794
864 Ga0307410_10002250
865 Ga0307410_10217218
866 Ga0307406_10004665
867 Ga0307406_11294607
868 Ga0307412_10024994
869 Ga0307416_100003878
870 Ga0307416_100351532
871 Ga0307414_10004772
872 Ga0307414_10412949
873 Ga0307411_10015278
874 Ga0307415_100146440
875 Ga0373958_0145425
876 Ga0373940_0039743
877 Ga0373949_0034603
878 Ga0373951_0220691
879 Ga0373941_0051539
880 Ga0373942_0011851
881 Ga0373961_0031165
882 Ga0242420_017510
883 Ga0439458_0009512
884 Ga0439459_0002717
885 Ga0439464_0253711
886 Ga0451577_0401094
887 Ga0453683_0807333
888 Ga0496102_0156166
889 Ga0496103_0581339
890 Ga0496106_0014908
891 Ga0496107_0350613
892 Ga0496112_0049220
893 Ga0496112_0263735
894 Ga0496112_0284629
895 Ga0496112_1174835
896 Ga0496112_1212496
897 Ga0496113_1331715
898 Ga0501292_001526
899 Ga0501295_102352
900 Ga0501296_052366
901 Ga0501038_0001998
902 Ga0501198_104460
903 Ga0501202_000509
904 Ga0501207_003292
905 Ga0501207_043362
906 Ga0501209_012242
907 Ga0501209_041815
908 Ga0501214_005396
909 Ga0501216_024410
910 Ga0501217_000420
911 Ga0501217_125716
912 Ga0501223_002090
913 Ga0501224_000536
914 Ga0501224_024825
915 Ga0501227_001492
916 Ga0501233_155358
917 Ga0501235_000841
918 Ga0501236_036350
919 Ga0501240_015226
920 Ga0501243_002349
921 Ga0501247_006971
922 Ga0501249_002147
923 Ga0501250_006293
924 Ga0501252_046568
925 Ga0501257_021758
926 Ga0501260_012001
927 Ga0501261_058135
928 Ga0501221_004020
929 Ga0501225_0001788
930 Ga0501229_008930
931 Ga0501229_010205
932 Ga0501234_021079
933 Ga0501245_047892
934 Ga0501268_002026
935 Ga0501272_014028
936 Ga0501273_009655
937 Ga0501273_012545
938 Ga0501273_049863
939 Ga0501204_000758
940 Ga0501212_003366
941 Ga0501226_000660
942 nmdc:mga05p37_1340353_c1
943 nmdc:mga05p37_177665_c1
944 nmdc:mga0qj67_105574_c1
945 nmdc:mga06r32_584819_c1
946 nmdc:mga06r32_707539_c1
947 nmdc:mga08y16_1574_c1
948 nmdc:mga08y16_47001_c1
949 nmdc:mga0n895_46041_c1
950 nmdc:mga08x19_81992_c1
951 nmdc:mga0a205_206772_c1
952 nmdc:mga0a205_305099_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16242

Pyrid_ox_like

Pyridoxamine 5'-phosphate oxidase like

4

151

0.98

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

7

91

0.92

PF12900

Pyridox_ox_2

Pyridoxamine 5'-phosphate oxidase

5

127

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i02-assembly1.cif.gz_A crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.9401 23 184
2i02-assembly1.cif.gz_B crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.9393 24 184
2i02-assembly1.cif.gz_A crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.927 23 184
2i02-assembly1.cif.gz_B crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.92 24 184
2re7-assembly1.cif.gz_A-2 crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution 0.9108 28 153
ID Description Score Start End Superfamily
2i02B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9373 24 184 2.30.110.10
2i02B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9176 24 184 2.30.110.10
2re7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9087 28 153 2.30.110.10
af_Q2FVN7_2_129_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8732 24 153 2.30.110.10
2re7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.863 28 153 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A1W6E2U4-F1-model_v4 deleted 0.975 42 152
AF-A0A3L7NSA2-F1-model_v4 General stress protein 0.9739 26 152
AF-A0A7W2A0N9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9731 21 149
AF-A0A1W6E2U4-F1-model_v4 deleted 0.9664 42 152
AF-A0A4V3GFS2-F1-model_v4 General stress protein 26 0.9661 26 155

Map