F451513
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 476 | 353 | 952 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10149691|Ga0099794_101496912 |
| Length | 200 |
| Sequence | MSTRPFNVLFLCTGNSARSIMAEVLLNSVGHGKFRAYSAGSRPKGEVHPLALELIESNRLPAAGLRSKSWSEFAEPDAPEMDFVFTVCGQAAGEICPVWPGQPMTAHWGIDDPAVVEGDEAHRRGAFFEAFNALQNRLLIFVSLPLAKLDRHLLQRRLDEIGKLSAEDESATNLSDRIRAAGRPLRLNARRRGADPDRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 147 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 150 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 156 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 166 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 167 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 185 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 186 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 187 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 188 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 189 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 190 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 191 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 192 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 193 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 194 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 195 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 196 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 197 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 198 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 199 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 200 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 201 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 202 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 203 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 204 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 205 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 206 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 207 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 208 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 209 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 210 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 211 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 212 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 219 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 223 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 267 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 277 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 278 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 279 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 280 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 281 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 284 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 285 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 286 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 287 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 288 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 289 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 290 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 291 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 292 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 293 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 294 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 295 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 296 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 297 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 298 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 299 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 300 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 301 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 302 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 303 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 304 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 305 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 306 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 307 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 308 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 309 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 310 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 311 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 312 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 313 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 314 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 315 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 316 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 317 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 318 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 319 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 320 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 321 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 322 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 323 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 324 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 325 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 326 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 327 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 328 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 329 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 330 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 331 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 332 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 333 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 334 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 335 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 336 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 337 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 338 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 339 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 340 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 341 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 342 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 343 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 344 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 345 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 346 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 347 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 348 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 349 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 350 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 351 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 352 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 353 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.87 |
| Metatranscriptomes | 0.42 |
| Isolates | 14.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.52 |
| Nodule | 12.39 |
| Rhizoplane | 3.57 |
| Rhizosphere | 76.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0099794_10149691 | 3300007265 | Bacteria | 1184 |
| 2 | MBSR1b_contig_3608504 | 2162886012 | Bacteria | 1354 |
| 3 | MBSR1b_contig_4766410 | 2162886012 | Bacteria | 1226 |
| 4 | JGI24749J21850_1017037 | 3300002076 | Bacteria | 1022 |
| 5 | JGI24035J26624_1024662 | 3300002126 | Bacteria | 643 |
| 6 | JGI24034J26672_10010494 | 3300002239 | Bacteria | 1377 |
| 7 | Ga0065165_1060513 | 3300005262 | Bacteria | 1039 |
| 8 | Ga0065712_10139797 | 3300005290 | Bacteria | 1461 |
| 9 | Ga0065712_10338387 | 3300005290 | Bacteria | 804 |
| 10 | Ga0065715_10111214 | 3300005293 | Bacteria | 2583 |
| 11 | Ga0065707_10090951 | 3300005295 | Bacteria | 4033 |
| 12 | Ga0070676_10049121 | 3300005328 | Bacteria | 2468 |
| 13 | Ga0070683_100332396 | 3300005329 | Bacteria | 1447 |
| 14 | Ga0070690_100012295 | 3300005330 | Bacteria | 5036 |
| 15 | Ga0070670_100017285 | 3300005331 | Bacteria | 6186 |
| 16 | Ga0070670_100346875 | 3300005331 | Bacteria | 1304 |
| 17 | Ga0070677_10004187 | 3300005333 | Bacteria | 4694 |
| 18 | Ga0070677_10032351 | 3300005333 | Bacteria | 2006 |
| 19 | Ga0068869_100102094 | 3300005334 | Bacteria | 2170 |
| 20 | Ga0070666_10143817 | 3300005335 | Bacteria | 1662 |
| 21 | Ga0070666_10673564 | 3300005335 | Bacteria | 757 |
| 22 | Ga0068868_100247154 | 3300005338 | Bacteria | 1500 |
| 23 | Ga0070660_100172416 | 3300005339 | Bacteria | 1748 |
| 24 | Ga0070661_101053713 | 3300005344 | Bacteria | 676 |
| 25 | Ga0070692_10042164 | 3300005345 | Bacteria | 2342 |
| 26 | Ga0070668_100000058 | 3300005347 | Bacteria | 69744 |
| 27 | Ga0070668_100119126 | 3300005347 | Bacteria | 2108 |
| 28 | Ga0070668_101228033 | 3300005347 | Bacteria | 680 |
| 29 | Ga0070669_100004006 | 3300005353 | Bacteria | 10650 |
| 30 | Ga0070669_100255561 | 3300005353 | Bacteria | 1396 |
| 31 | Ga0070675_100241871 | 3300005354 | Bacteria | 1577 |
| 32 | Ga0070675_100758454 | 3300005354 | Bacteria | 886 |
| 33 | Ga0070671_100038707 | 3300005355 | Bacteria | 3957 |
| 34 | Ga0070674_100021635 | 3300005356 | Bacteria | 4134 |
| 35 | Ga0070688_100239326 | 3300005365 | Bacteria | 1287 |
| 36 | Ga0070667_100147289 | 3300005367 | Bacteria | 2066 |
| 37 | Ga0070667_100953839 | 3300005367 | Bacteria | 799 |
| 38 | Ga0070667_101178949 | 3300005367 | Bacteria | 717 |
| 39 | Ga0070703_10020136 | 3300005406 | Bacteria | 1939 |
| 40 | Ga0070701_10157930 | 3300005438 | Bacteria | 1311 |
| 41 | Ga0070705_100163670 | 3300005440 | Bacteria | 1490 |
| 42 | Ga0070700_100009631 | 3300005441 | Bacteria | 5309 |
| 43 | Ga0070700_100177632 | 3300005441 | Bacteria | 1479 |
| 44 | Ga0070694_100443061 | 3300005444 | Bacteria | 1024 |
| 45 | Ga0070663_100237172 | 3300005455 | Bacteria | 1438 |
| 46 | Ga0070663_100889322 | 3300005455 | Bacteria | 769 |
| 47 | Ga0070678_100056829 | 3300005456 | Bacteria | 2864 |
| 48 | Ga0070678_100088013 | 3300005456 | Bacteria | 2373 |
| 49 | Ga0070662_100124013 | 3300005457 | Bacteria | 1983 |
| 50 | Ga0070662_101221465 | 3300005457 | Bacteria | 646 |
| 51 | Ga0070662_101419985 | 3300005457 | Bacteria | 598 |
| 52 | Ga0070685_10005163 | 3300005466 | Bacteria | 6620 |
| 53 | Ga0070706_100062810 | 3300005467 | Bacteria | 3432 |
| 54 | Ga0070698_100276992 | 3300005471 | Bacteria | 1609 |
| 55 | Ga0070684_100286904 | 3300005535 | Bacteria | 1509 |
| 56 | Ga0068853_100094747 | 3300005539 | Bacteria | 2631 |
| 57 | Ga0070672_100057411 | 3300005543 | Bacteria | 3055 |
| 58 | Ga0070672_100181754 | 3300005543 | Bacteria | 1753 |
| 59 | Ga0070695_100993028 | 3300005545 | Bacteria | 682 |
| 60 | Ga0070693_100037039 | 3300005547 | Bacteria | 2717 |
| 61 | Ga0070665_100184362 | 3300005548 | Bacteria | 2088 |
| 62 | Ga0070665_100548563 | 3300005548 | Bacteria | 1168 |
| 63 | Ga0070704_100008797 | 3300005549 | Bacteria | 6074 |
| 64 | Ga0070704_100227034 | 3300005549 | Bacteria | 1521 |
| 65 | Ga0068857_100025606 | 3300005577 | Bacteria | 5195 |
| 66 | Ga0068857_100114025 | 3300005577 | Bacteria | 2430 |
| 67 | Ga0068854_100118721 | 3300005578 | Bacteria | 2004 |
| 68 | Ga0070702_100011371 | 3300005615 | Bacteria | 4425 |
| 69 | Ga0068852_100044009 | 3300005616 | Bacteria | 3789 |
| 70 | Ga0068859_100064511 | 3300005617 | Bacteria | 3695 |
| 71 | Ga0068859_100815049 | 3300005617 | Bacteria | 1020 |
| 72 | Ga0068864_100090514 | 3300005618 | Bacteria | 2697 |
| 73 | Ga0068864_100222892 | 3300005618 | Bacteria | 1740 |
| 74 | Ga0068866_10014697 | 3300005718 | Bacteria | 3462 |
| 75 | Ga0068861_100437755 | 3300005719 | Bacteria | 1168 |
| 76 | Ga0068851_10046025 | 3300005834 | Bacteria | 2206 |
| 77 | Ga0068870_10067330 | 3300005840 | Bacteria | 1942 |
| 78 | Ga0068863_100000012 | 3300005841 | Bacteria | 229774 |
| 79 | Ga0068863_100548408 | 3300005841 | Bacteria | 1141 |
| 80 | Ga0068858_100002999 | 3300005842 | Bacteria | 16925 |
| 81 | Ga0068858_100540816 | 3300005842 | Bacteria | 1127 |
| 82 | Ga0068860_100279728 | 3300005843 | Bacteria | 1630 |
| 83 | Ga0068862_100054627 | 3300005844 | Bacteria | 3419 |
| 84 | Ga0068862_100057219 | 3300005844 | Bacteria | 3343 |
| 85 | Ga0068862_100239377 | 3300005844 | Bacteria | 1649 |
| 86 | Ga0068862_101419036 | 3300005844 | Bacteria | 698 |
| 87 | Ga0075365_10009573 | 3300006038 | Bacteria | 5583 |
| 88 | Ga0075369_10223548 | 3300006186 | Bacteria | 872 |
| 89 | Ga0097621_100135302 | 3300006237 | Bacteria | 2101 |
| 90 | Ga0097621_100199226 | 3300006237 | Bacteria | 1737 |
| 91 | Ga0068871_100311803 | 3300006358 | Bacteria | 1383 |
| 92 | Ga0068871_100765642 | 3300006358 | Bacteria | 888 |
| 93 | Ga0075428_100086555 | 3300006844 | Bacteria | 3418 |
| 94 | Ga0075430_100012365 | 3300006846 | Bacteria | 7260 |
| 95 | Ga0075430_100013957 | 3300006846 | Bacteria | 6846 |
| 96 | Ga0075430_100028951 | 3300006846 | Bacteria | 4702 |
| 97 | Ga0075430_100507517 | 3300006846 | Bacteria | 995 |
| 98 | Ga0075431_101329723 | 3300006847 | Bacteria | 679 |
| 99 | Ga0075433_10185309 | 3300006852 | Bacteria | 1852 |
| 100 | Ga0075434_100007036 | 3300006871 | Bacteria | 10378 |
| 101 | Ga0075434_101149593 | 3300006871 | Bacteria | 789 |
| 102 | Ga0075429_100053799 | 3300006880 | Bacteria | 3502 |
| 103 | Ga0075429_100084916 | 3300006880 | Unclassified | 2759 |
| 104 | Ga0075429_100185404 | 3300006880 | Bacteria | 1823 |
| 105 | Ga0068865_100658272 | 3300006881 | Bacteria | 891 |
| 106 | Ga0068865_101013734 | 3300006881 | Bacteria | 727 |
| 107 | Ga0097620_100064511 | 3300006931 | Bacteria | 3695 |
| 108 | Ga0097620_100815066 | 3300006931 | Bacteria | 1020 |
| 109 | Ga0097620_100982474 | 3300006931 | Bacteria | 927 |
| 110 | Ga0075435_100455506 | 3300007076 | Bacteria | 1103 |
| 111 | Ga0105251_10158709 | 3300009011 | Bacteria | 1020 |
| 112 | Ga0105250_10038922 | 3300009092 | Bacteria | 1907 |
| 113 | Ga0111539_10073238 | 3300009094 | Bacteria | 4039 |
| 114 | Ga0111539_10164489 | 3300009094 | Bacteria | 2595 |
| 115 | Ga0111539_10174528 | 3300009094 | Bacteria | 2511 |
| 116 | Ga0114129_10011867 | 3300009147 | Bacteria | 12392 |
| 117 | Ga0114129_10012454 | 3300009147 | Bacteria | 12109 |
| 118 | Ga0114129_10049054 | 3300009147 | Bacteria | 5933 |
| 119 | Ga0114129_10383525 | 3300009147 | Bacteria | 1855 |
| 120 | Ga0114129_10486640 | 3300009147 | Bacteria | 1614 |
| 121 | Ga0105243_10140724 | 3300009148 | Bacteria | 2058 |
| 122 | Ga0105241_10004837 | 3300009174 | Bacteria | 9930 |
| 123 | Ga0105242_10053976 | 3300009176 | Bacteria | 3283 |
| 124 | Ga0105242_10635051 | 3300009176 | Bacteria | 1036 |
| 125 | Ga0105248_10359127 | 3300009177 | Bacteria | 1640 |
| 126 | Ga0105248_10580684 | 3300009177 | Bacteria | 1264 |
| 127 | Ga0105248_10652461 | 3300009177 | Bacteria | 1187 |
| 128 | Ga0105237_10478963 | 3300009545 | Bacteria | 1251 |
| 129 | Ga0105238_10284508 | 3300009551 | Bacteria | 1635 |
| 130 | Ga0105249_10017740 | 3300009553 | Bacteria | 6322 |
| 131 | Ga0105249_10031731 | 3300009553 | Bacteria | 4779 |
| 132 | Ga0105249_10205871 | 3300009553 | Bacteria | 1928 |
| 133 | Ga0105239_10356083 | 3300010375 | Bacteria | 1652 |
| 134 | Ga0105246_10081653 | 3300011119 | Bacteria | 2305 |
| 135 | Ga0105246_10193502 | 3300011119 | Bacteria | 1576 |
| 136 | Ga0157373_10556024 | 3300013100 | Bacteria | 832 |
| 137 | Ga0157371_10063438 | 3300013102 | Bacteria | 2619 |
| 138 | Ga0157370_11278797 | 3300013104 | Bacteria | 661 |
| 139 | Ga0157374_10157793 | 3300013296 | Bacteria | 2209 |
| 140 | Ga0163162_10967814 | 3300013306 | Bacteria | 961 |
| 141 | Ga0163162_11464561 | 3300013306 | Bacteria | 777 |
| 142 | Ga0157372_10252633 | 3300013307 | Bacteria | 2047 |
| 143 | Ga0157372_10301167 | 3300013307 | Bacteria | 1865 |
| 144 | Ga0157375_10098424 | 3300013308 | Bacteria | 3002 |
| 145 | Ga0163163_10124903 | 3300014325 | Bacteria | 2610 |
| 146 | Ga0163163_10189189 | 3300014325 | Bacteria | 2107 |
| 147 | Ga0163163_10192002 | 3300014325 | Bacteria | 2091 |
| 148 | Ga0163163_10591348 | 3300014325 | Bacteria | 1173 |
| 149 | Ga0157380_10096763 | 3300014326 | Bacteria | 2448 |
| 150 | Ga0157380_11004667 | 3300014326 | Bacteria | 868 |
| 151 | Ga0157377_10025751 | 3300014745 | Bacteria | 3141 |
| 152 | Ga0157379_10149320 | 3300014968 | Bacteria | 2108 |
| 153 | Ga0157376_10037102 | 3300014969 | Bacteria | 3953 |
| 154 | Ga0157376_10188182 | 3300014969 | Bacteria | 1891 |
| 155 | Ga0157376_10580384 | 3300014969 | Bacteria | 1113 |
| 156 | Ga0163161_10068375 | 3300017792 | Bacteria | 2595 |
| 157 | Ga0207666_1002817 | 3300025271 | Bacteria | 2114 |
| 158 | Ga0209455_1004818 | 3300025272 | Bacteria | 4311 |
| 159 | Ga0207697_10001120 | 3300025315 | Bacteria | 14759 |
| 160 | Ga0207697_10051597 | 3300025315 | Bacteria | 1700 |
| 161 | Ga0207656_10026012 | 3300025321 | Bacteria | 2381 |
| 162 | Ga0207653_10030757 | 3300025885 | Bacteria | 1733 |
| 163 | Ga0207682_10000179 | 3300025893 | Bacteria | 28770 |
| 164 | Ga0207682_10048189 | 3300025893 | Bacteria | 1756 |
| 165 | Ga0207642_10010938 | 3300025899 | Bacteria | 3219 |
| 166 | Ga0207688_10014325 | 3300025901 | Bacteria | 4315 |
| 167 | Ga0207688_10045270 | 3300025901 | Bacteria | 2454 |
| 168 | Ga0207680_10228092 | 3300025903 | Bacteria | 1279 |
| 169 | Ga0207647_10433686 | 3300025904 | Bacteria | 738 |
| 170 | Ga0207647_10581654 | 3300025904 | Bacteria | 619 |
| 171 | Ga0207645_10005789 | 3300025907 | Bacteria | 8915 |
| 172 | Ga0207643_10006326 | 3300025908 | Bacteria | 6341 |
| 173 | Ga0207643_10107216 | 3300025908 | Bacteria | 1643 |
| 174 | Ga0207662_10139282 | 3300025918 | Bacteria | 1536 |
| 175 | Ga0207657_10141811 | 3300025919 | Bacteria | 1963 |
| 176 | Ga0207657_10336276 | 3300025919 | Archaea | 1192 |
| 177 | Ga0207649_10089615 | 3300025920 | Bacteria | 2011 |
| 178 | Ga0207646_10716936 | 3300025922 | Unclassified | 894 |
| 179 | Ga0207681_10007301 | 3300025923 | Bacteria | 6772 |
| 180 | Ga0207681_10365983 | 3300025923 | Bacteria | 1157 |
| 181 | Ga0207681_10564184 | 3300025923 | Bacteria | 938 |
| 182 | Ga0207694_10348012 | 3300025924 | Bacteria | 1226 |
| 183 | Ga0207650_10011114 | 3300025925 | Bacteria | 6191 |
| 184 | Ga0207650_10313638 | 3300025925 | Bacteria | 1283 |
| 185 | Ga0207650_10495798 | 3300025925 | Bacteria | 1020 |
| 186 | Ga0207659_10097686 | 3300025926 | Bacteria | 2207 |
| 187 | Ga0207659_10160125 | 3300025926 | Bacteria | 1766 |
| 188 | Ga0207644_10000070 | 3300025931 | Bacteria | 74994 |
| 189 | Ga0207644_10087983 | 3300025931 | Bacteria | 2310 |
| 190 | Ga0207690_10154988 | 3300025932 | Bacteria | 1702 |
| 191 | Ga0207706_10027470 | 3300025933 | Bacteria | 5087 |
| 192 | Ga0207706_10328041 | 3300025933 | Unclassified | 1331 |
| 193 | Ga0207706_10334485 | 3300025933 | Bacteria | 1317 |
| 194 | Ga0207709_10142378 | 3300025935 | Bacteria | 1650 |
| 195 | Ga0207669_10086879 | 3300025937 | Bacteria | 2023 |
| 196 | Ga0207704_10659658 | 3300025938 | Bacteria | 862 |
| 197 | Ga0207691_10026470 | 3300025940 | Bacteria | 5440 |
| 198 | Ga0207691_10036661 | 3300025940 | Bacteria | 4544 |
| 199 | Ga0207691_10261573 | 3300025940 | Bacteria | 1492 |
| 200 | Ga0207711_10446513 | 3300025941 | Bacteria | 1204 |
| 201 | Ga0207711_10592569 | 3300025941 | Bacteria | 1034 |
| 202 | Ga0207689_10051790 | 3300025942 | Bacteria | 3384 |
| 203 | Ga0207689_10131260 | 3300025942 | Bacteria | 2062 |
| 204 | Ga0207661_10073688 | 3300025944 | Bacteria | 2797 |
| 205 | Ga0207667_10191036 | 3300025949 | Bacteria | 2101 |
| 206 | Ga0207712_10037716 | 3300025961 | Bacteria | 3299 |
| 207 | Ga0207712_10092027 | 3300025961 | Bacteria | 2235 |
| 208 | Ga0207668_10000061 | 3300025972 | Bacteria | 89620 |
| 209 | Ga0207668_10317501 | 3300025972 | Bacteria | 1291 |
| 210 | Ga0207658_10260094 | 3300025986 | Bacteria | 1479 |
| 211 | Ga0207658_10949538 | 3300025986 | Bacteria | 784 |
| 212 | Ga0207677_10762499 | 3300026023 | Bacteria | 863 |
| 213 | Ga0207703_10089350 | 3300026035 | Bacteria | 2587 |
| 214 | Ga0207703_10567420 | 3300026035 | Bacteria | 1071 |
| 215 | Ga0207678_10006934 | 3300026067 | Bacteria | 10056 |
| 216 | Ga0207708_10178315 | 3300026075 | Bacteria | 1686 |
| 217 | Ga0207702_10611092 | 3300026078 | Bacteria | 1070 |
| 218 | Ga0207648_10011918 | 3300026089 | Bacteria | 8165 |
| 219 | Ga0207674_10114385 | 3300026116 | Bacteria | 2670 |
| 220 | Ga0207674_11088069 | 3300026116 | Bacteria | 769 |
| 221 | Ga0207675_100077464 | 3300026118 | Bacteria | 3115 |
| 222 | Ga0207675_100185197 | 3300026118 | Bacteria | 1995 |
| 223 | Ga0207683_10143531 | 3300026121 | Bacteria | 2152 |
| 224 | Ga0207683_10198081 | 3300026121 | Bacteria | 1825 |
| 225 | Ga0207683_10404636 | 3300026121 | Archaea | 1256 |
| 226 | Ga0207428_10008245 | 3300027907 | Bacteria | 9423 |
| 227 | Ga0207428_10010169 | 3300027907 | Bacteria | 8414 |
| 228 | Ga0207428_10096320 | 3300027907 | Bacteria | 2291 |
| 229 | Ga0268266_10028248 | 3300028379 | Bacteria | 4768 |
| 230 | Ga0268266_10136706 | 3300028379 | Bacteria | 2196 |
| 231 | Ga0268266_10817923 | 3300028379 | Bacteria | 900 |
| 232 | Ga0268265_10206482 | 3300028380 | Bacteria | 1708 |
| 233 | Ga0268265_10381055 | 3300028380 | Bacteria | 1297 |
| 234 | Ga0268265_11243014 | 3300028380 | Bacteria | 743 |
| 235 | Ga0268264_10442725 | 3300028381 | Bacteria | 1257 |
| 236 | Ga0265326_10051298 | 3300028558 | Bacteria | 1168 |
| 237 | Ga0265319_1005876 | 3300028563 | Bacteria | 5782 |
| 238 | Ga0265334_10000540 | 3300028573 | Bacteria | 19296 |
| 239 | Ga0265318_10000804 | 3300028577 | Bacteria | 20812 |
| 240 | Ga0265338_10039153 | 3300028800 | Bacteria | 4478 |
| 241 | Ga0265338_10054809 | 3300028800 | Bacteria | 3552 |
| 242 | Ga0265330_10018091 | 3300031235 | Bacteria | 3238 |
| 243 | Ga0265332_10005227 | 3300031238 | Bacteria | 6005 |
| 244 | Ga0265328_10000896 | 3300031239 | Bacteria | 13775 |
| 245 | Ga0265328_10017221 | 3300031239 | Bacteria | 2800 |
| 246 | Ga0265320_10001434 | 3300031240 | Bacteria | 17350 |
| 247 | Ga0265325_10012818 | 3300031241 | Bacteria | 4784 |
| 248 | Ga0265329_10016927 | 3300031242 | Bacteria | 2517 |
| 249 | Ga0265339_10182388 | 3300031249 | Bacteria | 1044 |
| 250 | Ga0265331_10000070 | 3300031250 | Bacteria | 152331 |
| 251 | Ga0265331_10003536 | 3300031250 | Bacteria | 10028 |
| 252 | Ga0265327_10000156 | 3300031251 | Bacteria | 146362 |
| 253 | Ga0265327_10001987 | 3300031251 | Bacteria | 23267 |
| 254 | Ga0265327_10086665 | 3300031251 | Bacteria | 1535 |
| 255 | Ga0265316_10056812 | 3300031344 | Bacteria | 3054 |
| 256 | Ga0307509_10234804 | 3300031507 | Bacteria | 1633 |
| 257 | Ga0265313_10028715 | 3300031595 | Bacteria | 2886 |
| 258 | Ga0265314_10011482 | 3300031711 | Bacteria | 7306 |
| 259 | Ga0265342_10003570 | 3300031712 | Bacteria | 12715 |
| 260 | Ga0316576_10088425 | 3300031727 | Bacteria | 2306 |
| 261 | Ga0316578_10204719 | 3300031728 | Bacteria | 1188 |
| 262 | Ga0307516_10000113 | 3300031730 | Bacteria | 93946 |
| 263 | Ga0307410_10019542 | 3300031852 | Bacteria | 4124 |
| 264 | Ga0307410_10511705 | 3300031852 | Bacteria | 989 |
| 265 | Ga0307406_10648432 | 3300031901 | Bacteria | 876 |
| 266 | Ga0307407_10372813 | 3300031903 | Bacteria | 1017 |
| 267 | Ga0307412_10042151 | 3300031911 | Bacteria | 2963 |
| 268 | Ga0307412_10276347 | 3300031911 | Bacteria | 1317 |
| 269 | Ga0307409_100314293 | 3300031995 | Bacteria | 1463 |
| 270 | Ga0307416_100229174 | 3300032002 | Bacteria | 1789 |
| 271 | Ga0307411_10580931 | 3300032005 | Bacteria | 960 |
| 272 | Ga0307415_100933132 | 3300032126 | Bacteria | 802 |
| 273 | Ga0316593_10053875 | 3300032168 | Bacteria | 1364 |
| 274 | Ga0316587_1021824 | 3300033529 | Bacteria | 1094 |
| 275 | Ga0373944_0235481 | 3300035089 | Bacteria | 672 |
| 276 | Ga0373942_0004485 | 3300035207 | Bacteria | 3238 |
| 277 | Ga0373935_0319799 | 3300035692 | Bacteria | 1101 |
| 278 | Ga0373933_0212329 | 3300035724 | Bacteria | 1240 |
| 279 | Ga0316582_0301974 | 3300036647 | Bacteria | 1100 |
| 280 | Ga0395901_0609310 | 3300038443 | Bacteria | 1100 |
| 281 | Ga0400488_34323 | 3300038741 | Bacteria | 1559 |
| 282 | Ga0400486_13767 | 3300038742 | Bacteria | 4291 |
| 283 | Ga0400487_24020 | 3300039110 | Bacteria | 1556 |
| 284 | Ga0439438_105672 | 3300041405 | Bacteria | 681 |
| 285 | Ga0439453_0044358 | 3300041408 | Bacteria | 881 |
| 286 | Ga0451835_0192922 | 3300041492 | Bacteria | 4102 |
| 287 | Ga0451837_0732906 | 3300041494 | Bacteria | 7284 |
| 288 | Ga0451839_0815740 | 3300041496 | Bacteria | 5626 |
| 289 | Ga0451841_0553159 | 3300041498 | Bacteria | 6857 |
| 290 | Ga0451845_0076104 | 3300041501 | Bacteria | 4215 |
| 291 | Ga0451847_0929205 | 3300041503 | Bacteria | 6835 |
| 292 | Ga0451849_0006899 | 3300041505 | Bacteria | 6892 |
| 293 | Ga0451851_0676020 | 3300041507 | Bacteria | 7215 |
| 294 | Ga0451843_1598276 | 3300041509 | Bacteria | 4662 |
| 295 | Ga0451853_1628757 | 3300041512 | Bacteria | 1331 |
| 296 | Ga0439443_011761 | 3300042003 | Bacteria | 1287 |
| 297 | Ga0439432_068155 | 3300042006 | Bacteria | 1088 |
| 298 | Ga0439449_0024449 | 3300042007 | Bacteria | 2258 |
| 299 | Ga0439452_032866 | 3300042010 | Bacteria | 1264 |
| 300 | Ga0450920_008996 | 3300042122 | Bacteria | 1836 |
| 301 | Ga0450923_000683 | 3300042125 | Bacteria | 3981 |
| 302 | Ga0450894_049429 | 3300042131 | Bacteria | 617 |
| 303 | Ga0450896_000421 | 3300042133 | Bacteria | 4299 |
| 304 | Ga0450898_004835 | 3300042134 | Bacteria | 2011 |
| 305 | Ga0439446_0000092 | 3300042156 | Bacteria | 15215 |
| 306 | Ga0450908_038900 | 3300042184 | Bacteria | 824 |
| 307 | Ga0439434_0003129 | 3300042435 | Bacteria | 4865 |
| 308 | Ga0439434_0190609 | 3300042435 | Bacteria | 689 |
| 309 | Ga0439444_0000262 | 3300042437 | Bacteria | 5267 |
| 310 | Ga0439464_0000949 | 3300042439 | Bacteria | 6545 |
| 311 | Ga0466965_0053344 | 3300044683 | Bacteria | 2009 |
| 312 | Ga0466966_0028598 | 3300044684 | Bacteria | 3629 |
| 313 | Ga0466961_0007644 | 3300044693 | Bacteria | 6881 |
| 314 | Ga0466964_0413644 | 3300044706 | Bacteria | 707 |
| 315 | Ga0466968_0009324 | 3300044735 | Bacteria | 3776 |
| 316 | Ga0466970_0022082 | 3300044765 | Bacteria | 3321 |
| 317 | Ga0466957_0032974 | 3300044842 | Bacteria | 3104 |
| 318 | Ga0466959_0009617 | 3300045049 | Bacteria | 6876 |
| 319 | Ga0466959_0299184 | 3300045049 | Bacteria | 1102 |
| 320 | Ga0451576_0141866 | 3300045051 | Bacteria | 2505 |
| 321 | Ga0466958_0064014 | 3300045836 | Bacteria | 2242 |
| 322 | Ga0495607_0000262 | 3300046501 | Bacteria | 56368 |
| 323 | Ga0495628_1021274 | 3300046516 | Bacteria | 568 |
| 324 | Ga0495637_0014936 | 3300046520 | Bacteria | 3654 |
| 325 | Ga0495642_0177051 | 3300046528 | Bacteria | 928 |
| 326 | Ga0495654_0411410 | 3300046530 | Bacteria | 536 |
| 327 | Ga0495598_0078378 | 3300046537 | Bacteria | 1055 |
| 328 | Ga0495672_0002923 | 3300047320 | Bacteria | 15089 |
| 329 | Ga0496100_0139386 | 3300048903 | Bacteria | 1717 |
| 330 | Ga0496101_0035269 | 3300048904 | Bacteria | 3537 |
| 331 | Ga0496101_0239779 | 3300048904 | Bacteria | 1411 |
| 332 | Ga0496102_0181893 | 3300048905 | Bacteria | 1981 |
| 333 | Ga0496102_0967265 | 3300048905 | Bacteria | 772 |
| 334 | Ga0496104_1051988 | 3300048907 | Bacteria | 718 |
| 335 | Ga0496105_0000936 | 3300048908 | Bacteria | 19902 |
| 336 | Ga0496107_0178610 | 3300048910 | Bacteria | 1576 |
| 337 | Ga0496108_0389485 | 3300048911 | Bacteria | 1217 |
| 338 | Ga0496109_0021715 | 3300048912 | Bacteria | 5680 |
| 339 | Ga0496109_0532051 | 3300048912 | Bacteria | 1109 |
| 340 | Ga0496110_0007064 | 3300048913 | Bacteria | 8934 |
| 341 | Ga0496111_0217621 | 3300048914 | Bacteria | 1419 |
| 342 | Ga0496112_0454533 | 3300048915 | Bacteria | 1218 |
| 343 | Ga0496114_0061865 | 3300048917 | Bacteria | 3132 |
| 344 | Ga0496114_0173592 | 3300048917 | Bacteria | 1880 |
| 345 | Ga0496118_0375504 | 3300048921 | Unclassified | 748 |
| 346 | Ga0496121_0018679 | 3300048924 | Bacteria | 6978 |
| 347 | Ga0501031_0344221 | 3300049568 | Bacteria | 965 |
| 348 | Ga0501033_0429441 | 3300049570 | Bacteria | 919 |
| 349 | Ga0501033_0462567 | 3300049570 | Bacteria | 880 |
| 350 | Ga0501034_0135953 | 3300049571 | Bacteria | 2439 |
| 351 | Ga0501036_0542790 | 3300049572 | Bacteria | 966 |
| 352 | Ga0501036_1186217 | 3300049572 | Bacteria | 622 |
| 353 | Ga0501037_0144258 | 3300049573 | Bacteria | 1703 |
| 354 | Ga0501038_0259545 | 3300049574 | Bacteria | 1374 |
| 355 | Ga0501040_0000994 | 3300049576 | Bacteria | 17940 |
| 356 | Ga0501041_0102835 | 3300049577 | Bacteria | 1769 |
| 357 | Ga0501042_0013064 | 3300049578 | Bacteria | 5646 |
| 358 | Ga0501047_0947613 | 3300049581 | Bacteria | 674 |
| 359 | Ga0501048_0018373 | 3300049582 | Bacteria | 5143 |
| 360 | Ga0501068_0739512 | 3300049584 | Bacteria | 644 |
| 361 | Ga0501070_0334239 | 3300049586 | Bacteria | 1231 |
| 362 | Ga0501071_0133630 | 3300049587 | Bacteria | 1845 |
| 363 | Ga0501071_0636908 | 3300049587 | Bacteria | 820 |
| 364 | Ga0501072_0003005 | 3300049588 | Bacteria | 12717 |
| 365 | Ga0501075_0000258 | 3300049591 | Bacteria | 28848 |
| 366 | Ga0501075_0743517 | 3300049591 | Bacteria | 747 |
| 367 | Ga0501077_0212839 | 3300049593 | Bacteria | 1228 |
| 368 | Ga0501079_0006290 | 3300049741 | Bacteria | 8905 |
| 369 | Ga0501079_0031499 | 3300049741 | Bacteria | 4077 |
| 370 | Ga0501080_0011938 | 3300049742 | Bacteria | 7956 |
| 371 | Ga0501080_0013287 | 3300049742 | Bacteria | 7566 |
| 372 | Ga0501081_0055390 | 3300049743 | Bacteria | 2740 |
| 373 | Ga0501045_0008865 | 3300049824 | Bacteria | 7023 |
| 374 | Ga0501045_0477204 | 3300049824 | Bacteria | 927 |
| 375 | nmdc:mga0yw44_130451_c1 | 3300050492 | Bacteria | 1627 |
| 376 | nmdc:mga0k408_251416_c1 | 3300050493 | Bacteria | 1055 |
| 377 | nmdc:mga07m45_632130_c1 | 3300050496 | Bacteria | 617 |
| 378 | nmdc:mga05p37_1179_c1 | 3300050507 | Bacteria | 30174 |
| 379 | nmdc:mga05p37_118029_c1 | 3300050507 | Bacteria | 2752 |
| 380 | nmdc:mga05p37_2090_c1 | 3300050507 | Bacteria | 23298 |
| 381 | nmdc:mga09592_273560_c1 | 3300050508 | Bacteria | 1465 |
| 382 | nmdc:mga09592_420147_c1 | 3300050508 | Unclassified | 1155 |
| 383 | nmdc:mga0qj67_17379_c1 | 3300050509 | Bacteria | 5468 |
| 384 | nmdc:mga0qj67_3697_c1 | 3300050509 | Bacteria | 11045 |
| 385 | nmdc:mga0qj67_7211_c1 | 3300050509 | Bacteria | 8207 |
| 386 | nmdc:mga0qj67_850702_c1 | 3300050509 | Bacteria | 720 |
| 387 | nmdc:mga06r32_120517_c1 | 3300050510 | Bacteria | 2587 |
| 388 | nmdc:mga06r32_258603_c1 | 3300050510 | Bacteria | 1729 |
| 389 | nmdc:mga08y16_124913_c1 | 3300050511 | Bacteria | 2677 |
| 390 | nmdc:mga08y16_29636_c1 | 3300050511 | Bacteria | 5763 |
| 391 | nmdc:mga08y16_672367_c1 | 3300050511 | Bacteria | 1038 |
| 392 | nmdc:mga0n895_100427_c1 | 3300050512 | Bacteria | 2902 |
| 393 | nmdc:mga0n895_473783_c1 | 3300050512 | Unclassified | 1263 |
| 394 | nmdc:mga0n895_748617_c1 | 3300050512 | Bacteria | 970 |
| 395 | nmdc:mga0a205_196703_c1 | 3300050515 | Bacteria | 1907 |
| 396 | nmdc:mga0a205_293705_c1 | 3300050515 | Bacteria | 1499 |
| 397 | Ga0495655_0067593 | 3300053083 | Bacteria | 991 |
| 398 | Ga0500583_0383377 | 3300053092 | Bacteria | 677 |
| 399 | Ga0500568_0001342 | 3300053139 | Bacteria | 16057 |
| 400 | Ga0500604_0154322 | 3300053151 | Bacteria | 781 |
| 401 | Ga0500627_0239231 | 3300053158 | Bacteria | 806 |
| 402 | Ga0500645_001694 | 3300053730 | Bacteria | 10762 |
| 403 | Ga0501084_0176772 | 3300054114 | Bacteria | 1802 |
| 404 | Ga0501082_0649269 | 3300060353 | Bacteria | 923 |
| 405 | Ga0530510_0000170 | 3300061734 | Bacteria | 39521 |
| 406 | Ga0530510_0754916 | 3300061734 | Bacteria | 742 |
| 407 | 2514417138 | 2513237305 | Bacteria | 7293571 |
| 408 | 2524614010 | 2524023250 | Bacteria | 5457705 |
| 409 | 2585336421 | 2582581316 | Bacteria | 7774528 |
| 410 | 2616292274 | 2615840624 | Bacteria | 6557588 |
| 411 | 2719181456 | 2718217882 | Bacteria | 6556348 |
| 412 | 2719665789 | 2718217997 | Bacteria | 6740740 |
| 413 | 2719732120 | 2718218009 | Bacteria | 6478651 |
| 414 | 2720492209 | 2718218199 | Bacteria | 6740745 |
| 415 | 2720620349 | 2718218233 | Bacteria | 6662049 |
| 416 | 2720631773 | 2718218235 | Bacteria | 6630699 |
| 417 | 2720775501 | 2718218269 | Bacteria | 6906114 |
| 418 | 2721147478 | 2718218363 | Bacteria | 6524337 |
| 419 | 2721158997 | 2718218365 | Bacteria | 6274507 |
| 420 | 2721164383 | 2718218366 | Bacteria | 6425255 |
| 421 | 2722840553 | 2721755514 | Bacteria | 6424414 |
| 422 | 2723560732 | 2721755684 | Bacteria | 6859907 |
| 423 | 2723567320 | 2721755685 | Bacteria | 6704835 |
| 424 | 2723573664 | 2721755686 | Bacteria | 7343952 |
| 425 | 2724044876 | 2721755810 | Bacteria | 6479005 |
| 426 | 2724090108 | 2721755819 | Bacteria | 6906405 |
| 427 | 2724104585 | 2721755822 | Bacteria | 6726041 |
| 428 | 2724110386 | 2721755823 | Bacteria | 6752556 |
| 429 | 2730164621 | 2728369365 | Bacteria | 6555560 |
| 430 | 2730298629 | 2728369397 | Bacteria | 6274511 |
| 431 | 2756673956 | 2756170246 | Bacteria | 7451806 |
| 432 | 2770194722 | 2767802442 | Bacteria | 5747986 |
| 433 | 2793294875 | 2791355256 | Bacteria | 6798008 |
| 434 | 2793322979 | 2791355260 | Bacteria | 6598818 |
| 435 | 2793335859 | 2791355262 | Bacteria | 6774204 |
| 436 | 2793349933 | 2791355264 | Bacteria | 6429314 |
| 437 | 2793352872 | 2791355265 | Bacteria | 6539969 |
| 438 | 2805925884 | 2802429605 | Bacteria | 6875453 |
| 439 | 2805937538 | 2802429606 | Bacteria | 6346811 |
| 440 | 2838053550 | 2838048938 | Bacteria | 6044578 |
| 441 | 2838065620 | 2838061910 | Bacteria | 6794874 |
| 442 | 2838074335 | 2838068647 | Bacteria | 6208656 |
| 443 | 2838674420 | 2838668709 | Bacteria | 6671819 |
| 444 | 2838706948 | 2838701080 | Bacteria | 6669771 |
| 445 | 2842151476 | 2842146304 | Bacteria | 5957337 |
| 446 | 2842194325 | 2842192696 | Bacteria | 6147454 |
| 447 | 2842205840 | 2842205361 | Bacteria | 6340321 |
| 448 | 2842256614 | 2842250916 | Bacteria | 6579627 |
| 449 | 2842279297 | 2842278818 | Bacteria | 6340002 |
| 450 | 2842314425 | 2842311132 | Bacteria | 6616990 |
| 451 | 2842317728 | 2842317721 | Bacteria | 6793725 |
| 452 | 2842427550 | 2842422224 | Bacteria | 6239196 |
| 453 | 2842450760 | 2842447887 | Bacteria | 6754142 |
| 454 | 2842490214 | 2842489311 | Bacteria | 6620893 |
| 455 | 2842495991 | 2842495871 | Bacteria | 6820686 |
| 456 | 2844002493 | 2844002411 | Bacteria | 7168230 |
| 457 | 2871467429 | 2871466892 | Bacteria | 6923287 |
| 458 | 2882638400 | 2882632389 | Bacteria | 8154593 |
| 459 | 2885322375 | 2885318864 | Bacteria | 6729568 |
| 460 | 2894024026 | 2894023352 | Bacteria | 5167372 |
| 461 | 2906381920 | 2906378014 | Bacteria | 6911440 |
| 462 | 2919544720 | 2919543075 | Bacteria | 4728703 |
| 463 | 2924766632 | 2924762789 | Bacteria | 6561353 |
| 464 | 2924790483 | 2924784321 | Bacteria | 7416538 |
| 465 | 2933604792 | 2933599457 | Bacteria | 5858799 |
| 466 | 2937828070 | 2937822353 | Bacteria | 7290551 |
| 467 | 2987671024 | 2987666974 | Bacteria | 6509233 |
| 468 | 639787506 | 639633007 | Bacteria | 4376040 |
| 469 | 640486192 | 640427133 | Bacteria | 4567418 |
| 470 | 8005285302 | 8005282627 | Bacteria | 6675747 |
| 471 | 8005500521 | 8005497431 | Bacteria | 6477605 |
| 472 | 8005627141 | 8005626139 | Bacteria | 6534237 |
| 473 | 8005671939 | 8005668836 | Bacteria | 6953162 |
| 474 | 8018130106 | 8018127388 | Bacteria | 7351159 |
| 475 | 8024501452 | 8024501048 | Bacteria | 6427847 |
| 476 | 8056388033 | 8056382006 | Bacteria | 6408074 |
| 477 | Ga0099794_10149691 | |||
| 478 | MBSR1b_contig_3608504 | |||
| 479 | MBSR1b_contig_4766410 | |||
| 480 | JGI24749J21850_1017037 | |||
| 481 | JGI24035J26624_1024662 | |||
| 482 | JGI24034J26672_10010494 | |||
| 483 | Ga0065165_1060513 | |||
| 484 | Ga0065712_10139797 | |||
| 485 | Ga0065712_10338387 | |||
| 486 | Ga0065715_10111214 | |||
| 487 | Ga0065707_10090951 | |||
| 488 | Ga0070676_10049121 | |||
| 489 | Ga0070683_100332396 | |||
| 490 | Ga0070690_100012295 | |||
| 491 | Ga0070670_100017285 | |||
| 492 | Ga0070670_100346875 | |||
| 493 | Ga0070677_10004187 | |||
| 494 | Ga0070677_10032351 | |||
| 495 | Ga0068869_100102094 | |||
| 496 | Ga0070666_10143817 | |||
| 497 | Ga0070666_10673564 | |||
| 498 | Ga0068868_100247154 | |||
| 499 | Ga0070660_100172416 | |||
| 500 | Ga0070661_101053713 | |||
| 501 | Ga0070692_10042164 | |||
| 502 | Ga0070668_100000058 | |||
| 503 | Ga0070668_100119126 | |||
| 504 | Ga0070668_101228033 | |||
| 505 | Ga0070669_100004006 | |||
| 506 | Ga0070669_100255561 | |||
| 507 | Ga0070675_100241871 | |||
| 508 | Ga0070675_100758454 | |||
| 509 | Ga0070671_100038707 | |||
| 510 | Ga0070674_100021635 | |||
| 511 | Ga0070688_100239326 | |||
| 512 | Ga0070667_100147289 | |||
| 513 | Ga0070667_100953839 | |||
| 514 | Ga0070667_101178949 | |||
| 515 | Ga0070703_10020136 | |||
| 516 | Ga0070701_10157930 | |||
| 517 | Ga0070705_100163670 | |||
| 518 | Ga0070700_100009631 | |||
| 519 | Ga0070700_100177632 | |||
| 520 | Ga0070694_100443061 | |||
| 521 | Ga0070663_100237172 | |||
| 522 | Ga0070663_100889322 | |||
| 523 | Ga0070678_100056829 | |||
| 524 | Ga0070678_100088013 | |||
| 525 | Ga0070662_100124013 | |||
| 526 | Ga0070662_101221465 | |||
| 527 | Ga0070662_101419985 | |||
| 528 | Ga0070685_10005163 | |||
| 529 | Ga0070706_100062810 | |||
| 530 | Ga0070698_100276992 | |||
| 531 | Ga0070684_100286904 | |||
| 532 | Ga0068853_100094747 | |||
| 533 | Ga0070672_100057411 | |||
| 534 | Ga0070672_100181754 | |||
| 535 | Ga0070695_100993028 | |||
| 536 | Ga0070693_100037039 | |||
| 537 | Ga0070665_100184362 | |||
| 538 | Ga0070665_100548563 | |||
| 539 | Ga0070704_100008797 | |||
| 540 | Ga0070704_100227034 | |||
| 541 | Ga0068857_100025606 | |||
| 542 | Ga0068857_100114025 | |||
| 543 | Ga0068854_100118721 | |||
| 544 | Ga0070702_100011371 | |||
| 545 | Ga0068852_100044009 | |||
| 546 | Ga0068859_100064511 | |||
| 547 | Ga0068859_100815049 | |||
| 548 | Ga0068864_100090514 | |||
| 549 | Ga0068864_100222892 | |||
| 550 | Ga0068866_10014697 | |||
| 551 | Ga0068861_100437755 | |||
| 552 | Ga0068851_10046025 | |||
| 553 | Ga0068870_10067330 | |||
| 554 | Ga0068863_100000012 | |||
| 555 | Ga0068863_100548408 | |||
| 556 | Ga0068858_100002999 | |||
| 557 | Ga0068858_100540816 | |||
| 558 | Ga0068860_100279728 | |||
| 559 | Ga0068862_100054627 | |||
| 560 | Ga0068862_100057219 | |||
| 561 | Ga0068862_100239377 | |||
| 562 | Ga0068862_101419036 | |||
| 563 | Ga0075365_10009573 | |||
| 564 | Ga0075369_10223548 | |||
| 565 | Ga0097621_100135302 | |||
| 566 | Ga0097621_100199226 | |||
| 567 | Ga0068871_100311803 | |||
| 568 | Ga0068871_100765642 | |||
| 569 | Ga0075428_100086555 | |||
| 570 | Ga0075430_100012365 | |||
| 571 | Ga0075430_100013957 | |||
| 572 | Ga0075430_100028951 | |||
| 573 | Ga0075430_100507517 | |||
| 574 | Ga0075431_101329723 | |||
| 575 | Ga0075433_10185309 | |||
| 576 | Ga0075434_100007036 | |||
| 577 | Ga0075434_101149593 | |||
| 578 | Ga0075429_100053799 | |||
| 579 | Ga0075429_100084916 | |||
| 580 | Ga0075429_100185404 | |||
| 581 | Ga0068865_100658272 | |||
| 582 | Ga0068865_101013734 | |||
| 583 | Ga0097620_100064511 | |||
| 584 | Ga0097620_100815066 | |||
| 585 | Ga0097620_100982474 | |||
| 586 | Ga0075435_100455506 | |||
| 587 | Ga0105251_10158709 | |||
| 588 | Ga0105250_10038922 | |||
| 589 | Ga0111539_10073238 | |||
| 590 | Ga0111539_10164489 | |||
| 591 | Ga0111539_10174528 | |||
| 592 | Ga0114129_10011867 | |||
| 593 | Ga0114129_10012454 | |||
| 594 | Ga0114129_10049054 | |||
| 595 | Ga0114129_10383525 | |||
| 596 | Ga0114129_10486640 | |||
| 597 | Ga0105243_10140724 | |||
| 598 | Ga0105241_10004837 | |||
| 599 | Ga0105242_10053976 | |||
| 600 | Ga0105242_10635051 | |||
| 601 | Ga0105248_10359127 | |||
| 602 | Ga0105248_10580684 | |||
| 603 | Ga0105248_10652461 | |||
| 604 | Ga0105237_10478963 | |||
| 605 | Ga0105238_10284508 | |||
| 606 | Ga0105249_10017740 | |||
| 607 | Ga0105249_10031731 | |||
| 608 | Ga0105249_10205871 | |||
| 609 | Ga0105239_10356083 | |||
| 610 | Ga0105246_10081653 | |||
| 611 | Ga0105246_10193502 | |||
| 612 | Ga0157373_10556024 | |||
| 613 | Ga0157371_10063438 | |||
| 614 | Ga0157370_11278797 | |||
| 615 | Ga0157374_10157793 | |||
| 616 | Ga0163162_10967814 | |||
| 617 | Ga0163162_11464561 | |||
| 618 | Ga0157372_10252633 | |||
| 619 | Ga0157372_10301167 | |||
| 620 | Ga0157375_10098424 | |||
| 621 | Ga0163163_10124903 | |||
| 622 | Ga0163163_10189189 | |||
| 623 | Ga0163163_10192002 | |||
| 624 | Ga0163163_10591348 | |||
| 625 | Ga0157380_10096763 | |||
| 626 | Ga0157380_11004667 | |||
| 627 | Ga0157377_10025751 | |||
| 628 | Ga0157379_10149320 | |||
| 629 | Ga0157376_10037102 | |||
| 630 | Ga0157376_10188182 | |||
| 631 | Ga0157376_10580384 | |||
| 632 | Ga0163161_10068375 | |||
| 633 | Ga0207666_1002817 | |||
| 634 | Ga0209455_1004818 | |||
| 635 | Ga0207697_10001120 | |||
| 636 | Ga0207697_10051597 | |||
| 637 | Ga0207656_10026012 | |||
| 638 | Ga0207653_10030757 | |||
| 639 | Ga0207682_10000179 | |||
| 640 | Ga0207682_10048189 | |||
| 641 | Ga0207642_10010938 | |||
| 642 | Ga0207688_10014325 | |||
| 643 | Ga0207688_10045270 | |||
| 644 | Ga0207680_10228092 | |||
| 645 | Ga0207647_10433686 | |||
| 646 | Ga0207647_10581654 | |||
| 647 | Ga0207645_10005789 | |||
| 648 | Ga0207643_10006326 | |||
| 649 | Ga0207643_10107216 | |||
| 650 | Ga0207662_10139282 | |||
| 651 | Ga0207657_10141811 | |||
| 652 | Ga0207657_10336276 | |||
| 653 | Ga0207649_10089615 | |||
| 654 | Ga0207646_10716936 | |||
| 655 | Ga0207681_10007301 | |||
| 656 | Ga0207681_10365983 | |||
| 657 | Ga0207681_10564184 | |||
| 658 | Ga0207694_10348012 | |||
| 659 | Ga0207650_10011114 | |||
| 660 | Ga0207650_10313638 | |||
| 661 | Ga0207650_10495798 | |||
| 662 | Ga0207659_10097686 | |||
| 663 | Ga0207659_10160125 | |||
| 664 | Ga0207644_10000070 | |||
| 665 | Ga0207644_10087983 | |||
| 666 | Ga0207690_10154988 | |||
| 667 | Ga0207706_10027470 | |||
| 668 | Ga0207706_10328041 | |||
| 669 | Ga0207706_10334485 | |||
| 670 | Ga0207709_10142378 | |||
| 671 | Ga0207669_10086879 | |||
| 672 | Ga0207704_10659658 | |||
| 673 | Ga0207691_10026470 | |||
| 674 | Ga0207691_10036661 | |||
| 675 | Ga0207691_10261573 | |||
| 676 | Ga0207711_10446513 | |||
| 677 | Ga0207711_10592569 | |||
| 678 | Ga0207689_10051790 | |||
| 679 | Ga0207689_10131260 | |||
| 680 | Ga0207661_10073688 | |||
| 681 | Ga0207667_10191036 | |||
| 682 | Ga0207712_10037716 | |||
| 683 | Ga0207712_10092027 | |||
| 684 | Ga0207668_10000061 | |||
| 685 | Ga0207668_10317501 | |||
| 686 | Ga0207658_10260094 | |||
| 687 | Ga0207658_10949538 | |||
| 688 | Ga0207677_10762499 | |||
| 689 | Ga0207703_10089350 | |||
| 690 | Ga0207703_10567420 | |||
| 691 | Ga0207678_10006934 | |||
| 692 | Ga0207708_10178315 | |||
| 693 | Ga0207702_10611092 | |||
| 694 | Ga0207648_10011918 | |||
| 695 | Ga0207674_10114385 | |||
| 696 | Ga0207674_11088069 | |||
| 697 | Ga0207675_100077464 | |||
| 698 | Ga0207675_100185197 | |||
| 699 | Ga0207683_10143531 | |||
| 700 | Ga0207683_10198081 | |||
| 701 | Ga0207683_10404636 | |||
| 702 | Ga0207428_10008245 | |||
| 703 | Ga0207428_10010169 | |||
| 704 | Ga0207428_10096320 | |||
| 705 | Ga0268266_10028248 | |||
| 706 | Ga0268266_10136706 | |||
| 707 | Ga0268266_10817923 | |||
| 708 | Ga0268265_10206482 | |||
| 709 | Ga0268265_10381055 | |||
| 710 | Ga0268265_11243014 | |||
| 711 | Ga0268264_10442725 | |||
| 712 | Ga0265326_10051298 | |||
| 713 | Ga0265319_1005876 | |||
| 714 | Ga0265334_10000540 | |||
| 715 | Ga0265318_10000804 | |||
| 716 | Ga0265338_10039153 | |||
| 717 | Ga0265338_10054809 | |||
| 718 | Ga0265330_10018091 | |||
| 719 | Ga0265332_10005227 | |||
| 720 | Ga0265328_10000896 | |||
| 721 | Ga0265328_10017221 | |||
| 722 | Ga0265320_10001434 | |||
| 723 | Ga0265325_10012818 | |||
| 724 | Ga0265329_10016927 | |||
| 725 | Ga0265339_10182388 | |||
| 726 | Ga0265331_10000070 | |||
| 727 | Ga0265331_10003536 | |||
| 728 | Ga0265327_10000156 | |||
| 729 | Ga0265327_10001987 | |||
| 730 | Ga0265327_10086665 | |||
| 731 | Ga0265316_10056812 | |||
| 732 | Ga0307509_10234804 | |||
| 733 | Ga0265313_10028715 | |||
| 734 | Ga0265314_10011482 | |||
| 735 | Ga0265342_10003570 | |||
| 736 | Ga0316576_10088425 | |||
| 737 | Ga0316578_10204719 | |||
| 738 | Ga0307516_10000113 | |||
| 739 | Ga0307410_10019542 | |||
| 740 | Ga0307410_10511705 | |||
| 741 | Ga0307406_10648432 | |||
| 742 | Ga0307407_10372813 | |||
| 743 | Ga0307412_10042151 | |||
| 744 | Ga0307412_10276347 | |||
| 745 | Ga0307409_100314293 | |||
| 746 | Ga0307416_100229174 | |||
| 747 | Ga0307411_10580931 | |||
| 748 | Ga0307415_100933132 | |||
| 749 | Ga0316593_10053875 | |||
| 750 | Ga0316587_1021824 | |||
| 751 | Ga0373944_0235481 | |||
| 752 | Ga0373942_0004485 | |||
| 753 | Ga0373935_0319799 | |||
| 754 | Ga0373933_0212329 | |||
| 755 | Ga0316582_0301974 | |||
| 756 | Ga0395901_0609310 | |||
| 757 | Ga0400488_34323 | |||
| 758 | Ga0400486_13767 | |||
| 759 | Ga0400487_24020 | |||
| 760 | Ga0439438_105672 | |||
| 761 | Ga0439453_0044358 | |||
| 762 | Ga0451835_0192922 | |||
| 763 | Ga0451837_0732906 | |||
| 764 | Ga0451839_0815740 | |||
| 765 | Ga0451841_0553159 | |||
| 766 | Ga0451845_0076104 | |||
| 767 | Ga0451847_0929205 | |||
| 768 | Ga0451849_0006899 | |||
| 769 | Ga0451851_0676020 | |||
| 770 | Ga0451843_1598276 | |||
| 771 | Ga0451853_1628757 | |||
| 772 | Ga0439443_011761 | |||
| 773 | Ga0439432_068155 | |||
| 774 | Ga0439449_0024449 | |||
| 775 | Ga0439452_032866 | |||
| 776 | Ga0450920_008996 | |||
| 777 | Ga0450923_000683 | |||
| 778 | Ga0450894_049429 | |||
| 779 | Ga0450896_000421 | |||
| 780 | Ga0450898_004835 | |||
| 781 | Ga0439446_0000092 | |||
| 782 | Ga0450908_038900 | |||
| 783 | Ga0439434_0003129 | |||
| 784 | Ga0439434_0190609 | |||
| 785 | Ga0439444_0000262 | |||
| 786 | Ga0439464_0000949 | |||
| 787 | Ga0466965_0053344 | |||
| 788 | Ga0466966_0028598 | |||
| 789 | Ga0466961_0007644 | |||
| 790 | Ga0466964_0413644 | |||
| 791 | Ga0466968_0009324 | |||
| 792 | Ga0466970_0022082 | |||
| 793 | Ga0466957_0032974 | |||
| 794 | Ga0466959_0009617 | |||
| 795 | Ga0466959_0299184 | |||
| 796 | Ga0451576_0141866 | |||
| 797 | Ga0466958_0064014 | |||
| 798 | Ga0495607_0000262 | |||
| 799 | Ga0495628_1021274 | |||
| 800 | Ga0495637_0014936 | |||
| 801 | Ga0495642_0177051 | |||
| 802 | Ga0495654_0411410 | |||
| 803 | Ga0495598_0078378 | |||
| 804 | Ga0495672_0002923 | |||
| 805 | Ga0496100_0139386 | |||
| 806 | Ga0496101_0035269 | |||
| 807 | Ga0496101_0239779 | |||
| 808 | Ga0496102_0181893 | |||
| 809 | Ga0496102_0967265 | |||
| 810 | Ga0496104_1051988 | |||
| 811 | Ga0496105_0000936 | |||
| 812 | Ga0496107_0178610 | |||
| 813 | Ga0496108_0389485 | |||
| 814 | Ga0496109_0021715 | |||
| 815 | Ga0496109_0532051 | |||
| 816 | Ga0496110_0007064 | |||
| 817 | Ga0496111_0217621 | |||
| 818 | Ga0496112_0454533 | |||
| 819 | Ga0496114_0061865 | |||
| 820 | Ga0496114_0173592 | |||
| 821 | Ga0496118_0375504 | |||
| 822 | Ga0496121_0018679 | |||
| 823 | Ga0501031_0344221 | |||
| 824 | Ga0501033_0429441 | |||
| 825 | Ga0501033_0462567 | |||
| 826 | Ga0501034_0135953 | |||
| 827 | Ga0501036_0542790 | |||
| 828 | Ga0501036_1186217 | |||
| 829 | Ga0501037_0144258 | |||
| 830 | Ga0501038_0259545 | |||
| 831 | Ga0501040_0000994 | |||
| 832 | Ga0501041_0102835 | |||
| 833 | Ga0501042_0013064 | |||
| 834 | Ga0501047_0947613 | |||
| 835 | Ga0501048_0018373 | |||
| 836 | Ga0501068_0739512 | |||
| 837 | Ga0501070_0334239 | |||
| 838 | Ga0501071_0133630 | |||
| 839 | Ga0501071_0636908 | |||
| 840 | Ga0501072_0003005 | |||
| 841 | Ga0501075_0000258 | |||
| 842 | Ga0501075_0743517 | |||
| 843 | Ga0501077_0212839 | |||
| 844 | Ga0501079_0006290 | |||
| 845 | Ga0501079_0031499 | |||
| 846 | Ga0501080_0011938 | |||
| 847 | Ga0501080_0013287 | |||
| 848 | Ga0501081_0055390 | |||
| 849 | Ga0501045_0008865 | |||
| 850 | Ga0501045_0477204 | |||
| 851 | nmdc:mga0yw44_130451_c1 | |||
| 852 | nmdc:mga0k408_251416_c1 | |||
| 853 | nmdc:mga07m45_632130_c1 | |||
| 854 | nmdc:mga05p37_1179_c1 | |||
| 855 | nmdc:mga05p37_118029_c1 | |||
| 856 | nmdc:mga05p37_2090_c1 | |||
| 857 | nmdc:mga09592_273560_c1 | |||
| 858 | nmdc:mga09592_420147_c1 | |||
| 859 | nmdc:mga0qj67_17379_c1 | |||
| 860 | nmdc:mga0qj67_3697_c1 | |||
| 861 | nmdc:mga0qj67_7211_c1 | |||
| 862 | nmdc:mga0qj67_850702_c1 | |||
| 863 | nmdc:mga06r32_120517_c1 | |||
| 864 | nmdc:mga06r32_258603_c1 | |||
| 865 | nmdc:mga08y16_124913_c1 | |||
| 866 | nmdc:mga08y16_29636_c1 | |||
| 867 | nmdc:mga08y16_672367_c1 | |||
| 868 | nmdc:mga0n895_100427_c1 | |||
| 869 | nmdc:mga0n895_473783_c1 | |||
| 870 | nmdc:mga0n895_748617_c1 | |||
| 871 | nmdc:mga0a205_196703_c1 | |||
| 872 | nmdc:mga0a205_293705_c1 | |||
| 873 | Ga0495655_0067593 | |||
| 874 | Ga0500583_0383377 | |||
| 875 | Ga0500568_0001342 | |||
| 876 | Ga0500604_0154322 | |||
| 877 | Ga0500627_0239231 | |||
| 878 | Ga0500645_001694 | |||
| 879 | Ga0501084_0176772 | |||
| 880 | Ga0501082_0649269 | |||
| 881 | Ga0530510_0000170 | |||
| 882 | Ga0530510_0754916 | |||
| 883 | 2514417138 | |||
| 884 | 2524614010 | |||
| 885 | 2585336421 | |||
| 886 | 2616292274 | |||
| 887 | 2719181456 | |||
| 888 | 2719665789 | |||
| 889 | 2719732120 | |||
| 890 | 2720492209 | |||
| 891 | 2720620349 | |||
| 892 | 2720631773 | |||
| 893 | 2720775501 | |||
| 894 | 2721147478 | |||
| 895 | 2721158997 | |||
| 896 | 2721164383 | |||
| 897 | 2722840553 | |||
| 898 | 2723560732 | |||
| 899 | 2723567320 | |||
| 900 | 2723573664 | |||
| 901 | 2724044876 | |||
| 902 | 2724090108 | |||
| 903 | 2724104585 | |||
| 904 | 2724110386 | |||
| 905 | 2730164621 | |||
| 906 | 2730298629 | |||
| 907 | 2756673956 | |||
| 908 | 2770194722 | |||
| 909 | 2793294875 | |||
| 910 | 2793322979 | |||
| 911 | 2793335859 | |||
| 912 | 2793349933 | |||
| 913 | 2793352872 | |||
| 914 | 2805925884 | |||
| 915 | 2805937538 | |||
| 916 | 2838053550 | |||
| 917 | 2838065620 | |||
| 918 | 2838074335 | |||
| 919 | 2838674420 | |||
| 920 | 2838706948 | |||
| 921 | 2842151476 | |||
| 922 | 2842194325 | |||
| 923 | 2842205840 | |||
| 924 | 2842256614 | |||
| 925 | 2842279297 | |||
| 926 | 2842314425 | |||
| 927 | 2842317728 | |||
| 928 | 2842427550 | |||
| 929 | 2842450760 | |||
| 930 | 2842490214 | |||
| 931 | 2842495991 | |||
| 932 | 2844002493 | |||
| 933 | 2871467429 | |||
| 934 | 2882638400 | |||
| 935 | 2885322375 | |||
| 936 | 2894024026 | |||
| 937 | 2906381920 | |||
| 938 | 2919544720 | |||
| 939 | 2924766632 | |||
| 940 | 2924790483 | |||
| 941 | 2933604792 | |||
| 942 | 2937828070 | |||
| 943 | 2987671024 | |||
| 944 | 639787506 | |||
| 945 | 640486192 | |||
| 946 | 8005285302 | |||
| 947 | 8005500521 | |||
| 948 | 8005627141 | |||
| 949 | 8005671939 | |||
| 950 | 8018130106 | |||
| 951 | 8024501452 | |||
| 952 | 8056388033 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8p6m-assembly1.cif.gz_B | arsenate reductase (arsc2) from deinococcus indicus | 0.9595 | 6 | 145 |
| 8p6m-assembly1.cif.gz_B | arsenate reductase (arsc2) from deinococcus indicus | 0.9454 | 6 | 145 |
| 8p6m-assembly1.cif.gz_A | arsenate reductase (arsc2) from deinococcus indicus | 0.9362 | 6 | 144 |
| 8p5n-assembly2.cif.gz_B | arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate | 0.9089 | 6 | 145 |
| 8p6m-assembly1.cif.gz_A | arsenate reductase (arsc2) from deinococcus indicus | 0.9084 | 6 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jl3C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9059 | 8 | 143 | 3.40.50.2300 |
| 1jl3B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8924 | 7 | 143 | 3.40.50.2300 |
| 1jl3C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8632 | 8 | 143 | 3.40.50.2300 |
| 1jl3B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8557 | 7 | 143 | 3.40.50.2300 |
| 1y1lA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.827 | 9 | 145 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9GUH8-F1-model_v4 | Protein-tyrosine-phosphatase | 0.9902 | 6 | 163 |
GO:0046685
|
| AF-A0A2S2DEE9-F1-model_v4 | ArsR family transcriptional regulator | 0.9887 | 5 | 165 |
GO:0003700
GO:0004726 GO:0030946 GO:0046685 GO:0140793 |
| AF-A0A2D6BEZ2-F1-model_v4 | deleted | 0.9879 | 18 | 164 |
|
| AF-A0A529MMM0-F1-model_v4 | Arsenate reductase ArsC | 0.985 | 23 | 142 |
GO:0004726
GO:0030946 GO:0046685 GO:0140793 |
| AF-A0A651FWF4-F1-model_v4 | MarR family transcriptional regulator | 0.9839 | 5 | 163 |
GO:0003700
GO:0004726 GO:0030946 GO:0046685 GO:0140793 |