F451513

General Info

Members Datasets Scaffolds Average Seq Length
476 353 952 170

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10149691|Ga0099794_101496912
Length 200
Sequence MSTRPFNVLFLCTGNSARSIMAEVLLNSVGHGKFRAYSAGSRPKGEVHPLALELIESNRLPAAGLRSKSWSEFAEPDAPEMDFVFTVCGQAAGEICPVWPGQPMTAHWGIDDPAVVEGDEAHRRGAFFEAFNALQNRLLIFVSLPLAKLDRHLLQRRLDEIGKLSAEDESATNLSDRIRAAGRPLRLNARRRGADPDRAA

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
147 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
148 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
149 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
185 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
186 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
187 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
188 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
189 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
190 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
191 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
192 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
193 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
194 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
195 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
196 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
197 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
200 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
201 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
202 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
203 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
204 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
205 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
206 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
207 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
208 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
209 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
210 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
211 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
212 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
276 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
277 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
278 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
279 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
280 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
285 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
286 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
287 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
288 2718217882 Rhizobium sp. N741 Isolate Nodule
289 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
290 2718218009 Rhizobium sp. N561 Isolate Nodule
291 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
292 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
293 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
294 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
295 2718218363 Rhizobium sp. N113 Isolate Nodule
296 2718218365 Rhizobium sp. N731 Isolate Nodule
297 2718218366 Rhizobium sp. N621 Isolate Nodule
298 2721755514 Rhizobium sp. N6212 Isolate Nodule
299 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
300 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
301 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
302 2721755810 Rhizobium sp. N871 Isolate Nodule
303 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
304 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
305 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
306 2728369365 Rhizobium sp. N1341 Isolate Nodule
307 2728369397 Rhizobium sp. N1314 Isolate Nodule
308 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
309 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
310 2791355256 Rhizobium sp. M10 Isolate Nodule
311 2791355260 Rhizobium sp. L9 Isolate Nodule
312 2791355262 Rhizobium sp. M1 Isolate Nodule
313 2791355264 Rhizobium sp. S9 Isolate Nodule
314 2791355265 Rhizobium sp. H4 Isolate Nodule
315 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
316 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
317 2838048938 Rhizobium pisi 27/80 Isolate Nodule
318 2838061910 Rhizobium phaseoli L15 Isolate Nodule
319 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
320 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
321 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
322 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
323 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
324 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
325 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
326 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
327 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
328 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
329 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
330 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
331 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
332 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
333 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
334 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
335 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
336 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
337 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
338 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
339 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
340 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
341 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
342 2933599457 Rhizobium phaseoli M3 Isolate Nodule
343 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
344 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
345 639633007 Azoarcus olearius BH72 Isolate Unclassified
346 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
347 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
348 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
349 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
350 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
351 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
352 8024501048 Rhizobium sp. H4 Isolate Nodule
353 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.87
Metatranscriptomes 0.42
Isolates 14.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.52
Nodule 12.39
Rhizoplane 3.57
Rhizosphere 76.26
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10149691 3300007265 Bacteria 1184
2 MBSR1b_contig_3608504 2162886012 Bacteria 1354
3 MBSR1b_contig_4766410 2162886012 Bacteria 1226
4 JGI24749J21850_1017037 3300002076 Bacteria 1022
5 JGI24035J26624_1024662 3300002126 Bacteria 643
6 JGI24034J26672_10010494 3300002239 Bacteria 1377
7 Ga0065165_1060513 3300005262 Bacteria 1039
8 Ga0065712_10139797 3300005290 Bacteria 1461
9 Ga0065712_10338387 3300005290 Bacteria 804
10 Ga0065715_10111214 3300005293 Bacteria 2583
11 Ga0065707_10090951 3300005295 Bacteria 4033
12 Ga0070676_10049121 3300005328 Bacteria 2468
13 Ga0070683_100332396 3300005329 Bacteria 1447
14 Ga0070690_100012295 3300005330 Bacteria 5036
15 Ga0070670_100017285 3300005331 Bacteria 6186
16 Ga0070670_100346875 3300005331 Bacteria 1304
17 Ga0070677_10004187 3300005333 Bacteria 4694
18 Ga0070677_10032351 3300005333 Bacteria 2006
19 Ga0068869_100102094 3300005334 Bacteria 2170
20 Ga0070666_10143817 3300005335 Bacteria 1662
21 Ga0070666_10673564 3300005335 Bacteria 757
22 Ga0068868_100247154 3300005338 Bacteria 1500
23 Ga0070660_100172416 3300005339 Bacteria 1748
24 Ga0070661_101053713 3300005344 Bacteria 676
25 Ga0070692_10042164 3300005345 Bacteria 2342
26 Ga0070668_100000058 3300005347 Bacteria 69744
27 Ga0070668_100119126 3300005347 Bacteria 2108
28 Ga0070668_101228033 3300005347 Bacteria 680
29 Ga0070669_100004006 3300005353 Bacteria 10650
30 Ga0070669_100255561 3300005353 Bacteria 1396
31 Ga0070675_100241871 3300005354 Bacteria 1577
32 Ga0070675_100758454 3300005354 Bacteria 886
33 Ga0070671_100038707 3300005355 Bacteria 3957
34 Ga0070674_100021635 3300005356 Bacteria 4134
35 Ga0070688_100239326 3300005365 Bacteria 1287
36 Ga0070667_100147289 3300005367 Bacteria 2066
37 Ga0070667_100953839 3300005367 Bacteria 799
38 Ga0070667_101178949 3300005367 Bacteria 717
39 Ga0070703_10020136 3300005406 Bacteria 1939
40 Ga0070701_10157930 3300005438 Bacteria 1311
41 Ga0070705_100163670 3300005440 Bacteria 1490
42 Ga0070700_100009631 3300005441 Bacteria 5309
43 Ga0070700_100177632 3300005441 Bacteria 1479
44 Ga0070694_100443061 3300005444 Bacteria 1024
45 Ga0070663_100237172 3300005455 Bacteria 1438
46 Ga0070663_100889322 3300005455 Bacteria 769
47 Ga0070678_100056829 3300005456 Bacteria 2864
48 Ga0070678_100088013 3300005456 Bacteria 2373
49 Ga0070662_100124013 3300005457 Bacteria 1983
50 Ga0070662_101221465 3300005457 Bacteria 646
51 Ga0070662_101419985 3300005457 Bacteria 598
52 Ga0070685_10005163 3300005466 Bacteria 6620
53 Ga0070706_100062810 3300005467 Bacteria 3432
54 Ga0070698_100276992 3300005471 Bacteria 1609
55 Ga0070684_100286904 3300005535 Bacteria 1509
56 Ga0068853_100094747 3300005539 Bacteria 2631
57 Ga0070672_100057411 3300005543 Bacteria 3055
58 Ga0070672_100181754 3300005543 Bacteria 1753
59 Ga0070695_100993028 3300005545 Bacteria 682
60 Ga0070693_100037039 3300005547 Bacteria 2717
61 Ga0070665_100184362 3300005548 Bacteria 2088
62 Ga0070665_100548563 3300005548 Bacteria 1168
63 Ga0070704_100008797 3300005549 Bacteria 6074
64 Ga0070704_100227034 3300005549 Bacteria 1521
65 Ga0068857_100025606 3300005577 Bacteria 5195
66 Ga0068857_100114025 3300005577 Bacteria 2430
67 Ga0068854_100118721 3300005578 Bacteria 2004
68 Ga0070702_100011371 3300005615 Bacteria 4425
69 Ga0068852_100044009 3300005616 Bacteria 3789
70 Ga0068859_100064511 3300005617 Bacteria 3695
71 Ga0068859_100815049 3300005617 Bacteria 1020
72 Ga0068864_100090514 3300005618 Bacteria 2697
73 Ga0068864_100222892 3300005618 Bacteria 1740
74 Ga0068866_10014697 3300005718 Bacteria 3462
75 Ga0068861_100437755 3300005719 Bacteria 1168
76 Ga0068851_10046025 3300005834 Bacteria 2206
77 Ga0068870_10067330 3300005840 Bacteria 1942
78 Ga0068863_100000012 3300005841 Bacteria 229774
79 Ga0068863_100548408 3300005841 Bacteria 1141
80 Ga0068858_100002999 3300005842 Bacteria 16925
81 Ga0068858_100540816 3300005842 Bacteria 1127
82 Ga0068860_100279728 3300005843 Bacteria 1630
83 Ga0068862_100054627 3300005844 Bacteria 3419
84 Ga0068862_100057219 3300005844 Bacteria 3343
85 Ga0068862_100239377 3300005844 Bacteria 1649
86 Ga0068862_101419036 3300005844 Bacteria 698
87 Ga0075365_10009573 3300006038 Bacteria 5583
88 Ga0075369_10223548 3300006186 Bacteria 872
89 Ga0097621_100135302 3300006237 Bacteria 2101
90 Ga0097621_100199226 3300006237 Bacteria 1737
91 Ga0068871_100311803 3300006358 Bacteria 1383
92 Ga0068871_100765642 3300006358 Bacteria 888
93 Ga0075428_100086555 3300006844 Bacteria 3418
94 Ga0075430_100012365 3300006846 Bacteria 7260
95 Ga0075430_100013957 3300006846 Bacteria 6846
96 Ga0075430_100028951 3300006846 Bacteria 4702
97 Ga0075430_100507517 3300006846 Bacteria 995
98 Ga0075431_101329723 3300006847 Bacteria 679
99 Ga0075433_10185309 3300006852 Bacteria 1852
100 Ga0075434_100007036 3300006871 Bacteria 10378
101 Ga0075434_101149593 3300006871 Bacteria 789
102 Ga0075429_100053799 3300006880 Bacteria 3502
103 Ga0075429_100084916 3300006880 Unclassified 2759
104 Ga0075429_100185404 3300006880 Bacteria 1823
105 Ga0068865_100658272 3300006881 Bacteria 891
106 Ga0068865_101013734 3300006881 Bacteria 727
107 Ga0097620_100064511 3300006931 Bacteria 3695
108 Ga0097620_100815066 3300006931 Bacteria 1020
109 Ga0097620_100982474 3300006931 Bacteria 927
110 Ga0075435_100455506 3300007076 Bacteria 1103
111 Ga0105251_10158709 3300009011 Bacteria 1020
112 Ga0105250_10038922 3300009092 Bacteria 1907
113 Ga0111539_10073238 3300009094 Bacteria 4039
114 Ga0111539_10164489 3300009094 Bacteria 2595
115 Ga0111539_10174528 3300009094 Bacteria 2511
116 Ga0114129_10011867 3300009147 Bacteria 12392
117 Ga0114129_10012454 3300009147 Bacteria 12109
118 Ga0114129_10049054 3300009147 Bacteria 5933
119 Ga0114129_10383525 3300009147 Bacteria 1855
120 Ga0114129_10486640 3300009147 Bacteria 1614
121 Ga0105243_10140724 3300009148 Bacteria 2058
122 Ga0105241_10004837 3300009174 Bacteria 9930
123 Ga0105242_10053976 3300009176 Bacteria 3283
124 Ga0105242_10635051 3300009176 Bacteria 1036
125 Ga0105248_10359127 3300009177 Bacteria 1640
126 Ga0105248_10580684 3300009177 Bacteria 1264
127 Ga0105248_10652461 3300009177 Bacteria 1187
128 Ga0105237_10478963 3300009545 Bacteria 1251
129 Ga0105238_10284508 3300009551 Bacteria 1635
130 Ga0105249_10017740 3300009553 Bacteria 6322
131 Ga0105249_10031731 3300009553 Bacteria 4779
132 Ga0105249_10205871 3300009553 Bacteria 1928
133 Ga0105239_10356083 3300010375 Bacteria 1652
134 Ga0105246_10081653 3300011119 Bacteria 2305
135 Ga0105246_10193502 3300011119 Bacteria 1576
136 Ga0157373_10556024 3300013100 Bacteria 832
137 Ga0157371_10063438 3300013102 Bacteria 2619
138 Ga0157370_11278797 3300013104 Bacteria 661
139 Ga0157374_10157793 3300013296 Bacteria 2209
140 Ga0163162_10967814 3300013306 Bacteria 961
141 Ga0163162_11464561 3300013306 Bacteria 777
142 Ga0157372_10252633 3300013307 Bacteria 2047
143 Ga0157372_10301167 3300013307 Bacteria 1865
144 Ga0157375_10098424 3300013308 Bacteria 3002
145 Ga0163163_10124903 3300014325 Bacteria 2610
146 Ga0163163_10189189 3300014325 Bacteria 2107
147 Ga0163163_10192002 3300014325 Bacteria 2091
148 Ga0163163_10591348 3300014325 Bacteria 1173
149 Ga0157380_10096763 3300014326 Bacteria 2448
150 Ga0157380_11004667 3300014326 Bacteria 868
151 Ga0157377_10025751 3300014745 Bacteria 3141
152 Ga0157379_10149320 3300014968 Bacteria 2108
153 Ga0157376_10037102 3300014969 Bacteria 3953
154 Ga0157376_10188182 3300014969 Bacteria 1891
155 Ga0157376_10580384 3300014969 Bacteria 1113
156 Ga0163161_10068375 3300017792 Bacteria 2595
157 Ga0207666_1002817 3300025271 Bacteria 2114
158 Ga0209455_1004818 3300025272 Bacteria 4311
159 Ga0207697_10001120 3300025315 Bacteria 14759
160 Ga0207697_10051597 3300025315 Bacteria 1700
161 Ga0207656_10026012 3300025321 Bacteria 2381
162 Ga0207653_10030757 3300025885 Bacteria 1733
163 Ga0207682_10000179 3300025893 Bacteria 28770
164 Ga0207682_10048189 3300025893 Bacteria 1756
165 Ga0207642_10010938 3300025899 Bacteria 3219
166 Ga0207688_10014325 3300025901 Bacteria 4315
167 Ga0207688_10045270 3300025901 Bacteria 2454
168 Ga0207680_10228092 3300025903 Bacteria 1279
169 Ga0207647_10433686 3300025904 Bacteria 738
170 Ga0207647_10581654 3300025904 Bacteria 619
171 Ga0207645_10005789 3300025907 Bacteria 8915
172 Ga0207643_10006326 3300025908 Bacteria 6341
173 Ga0207643_10107216 3300025908 Bacteria 1643
174 Ga0207662_10139282 3300025918 Bacteria 1536
175 Ga0207657_10141811 3300025919 Bacteria 1963
176 Ga0207657_10336276 3300025919 Archaea 1192
177 Ga0207649_10089615 3300025920 Bacteria 2011
178 Ga0207646_10716936 3300025922 Unclassified 894
179 Ga0207681_10007301 3300025923 Bacteria 6772
180 Ga0207681_10365983 3300025923 Bacteria 1157
181 Ga0207681_10564184 3300025923 Bacteria 938
182 Ga0207694_10348012 3300025924 Bacteria 1226
183 Ga0207650_10011114 3300025925 Bacteria 6191
184 Ga0207650_10313638 3300025925 Bacteria 1283
185 Ga0207650_10495798 3300025925 Bacteria 1020
186 Ga0207659_10097686 3300025926 Bacteria 2207
187 Ga0207659_10160125 3300025926 Bacteria 1766
188 Ga0207644_10000070 3300025931 Bacteria 74994
189 Ga0207644_10087983 3300025931 Bacteria 2310
190 Ga0207690_10154988 3300025932 Bacteria 1702
191 Ga0207706_10027470 3300025933 Bacteria 5087
192 Ga0207706_10328041 3300025933 Unclassified 1331
193 Ga0207706_10334485 3300025933 Bacteria 1317
194 Ga0207709_10142378 3300025935 Bacteria 1650
195 Ga0207669_10086879 3300025937 Bacteria 2023
196 Ga0207704_10659658 3300025938 Bacteria 862
197 Ga0207691_10026470 3300025940 Bacteria 5440
198 Ga0207691_10036661 3300025940 Bacteria 4544
199 Ga0207691_10261573 3300025940 Bacteria 1492
200 Ga0207711_10446513 3300025941 Bacteria 1204
201 Ga0207711_10592569 3300025941 Bacteria 1034
202 Ga0207689_10051790 3300025942 Bacteria 3384
203 Ga0207689_10131260 3300025942 Bacteria 2062
204 Ga0207661_10073688 3300025944 Bacteria 2797
205 Ga0207667_10191036 3300025949 Bacteria 2101
206 Ga0207712_10037716 3300025961 Bacteria 3299
207 Ga0207712_10092027 3300025961 Bacteria 2235
208 Ga0207668_10000061 3300025972 Bacteria 89620
209 Ga0207668_10317501 3300025972 Bacteria 1291
210 Ga0207658_10260094 3300025986 Bacteria 1479
211 Ga0207658_10949538 3300025986 Bacteria 784
212 Ga0207677_10762499 3300026023 Bacteria 863
213 Ga0207703_10089350 3300026035 Bacteria 2587
214 Ga0207703_10567420 3300026035 Bacteria 1071
215 Ga0207678_10006934 3300026067 Bacteria 10056
216 Ga0207708_10178315 3300026075 Bacteria 1686
217 Ga0207702_10611092 3300026078 Bacteria 1070
218 Ga0207648_10011918 3300026089 Bacteria 8165
219 Ga0207674_10114385 3300026116 Bacteria 2670
220 Ga0207674_11088069 3300026116 Bacteria 769
221 Ga0207675_100077464 3300026118 Bacteria 3115
222 Ga0207675_100185197 3300026118 Bacteria 1995
223 Ga0207683_10143531 3300026121 Bacteria 2152
224 Ga0207683_10198081 3300026121 Bacteria 1825
225 Ga0207683_10404636 3300026121 Archaea 1256
226 Ga0207428_10008245 3300027907 Bacteria 9423
227 Ga0207428_10010169 3300027907 Bacteria 8414
228 Ga0207428_10096320 3300027907 Bacteria 2291
229 Ga0268266_10028248 3300028379 Bacteria 4768
230 Ga0268266_10136706 3300028379 Bacteria 2196
231 Ga0268266_10817923 3300028379 Bacteria 900
232 Ga0268265_10206482 3300028380 Bacteria 1708
233 Ga0268265_10381055 3300028380 Bacteria 1297
234 Ga0268265_11243014 3300028380 Bacteria 743
235 Ga0268264_10442725 3300028381 Bacteria 1257
236 Ga0265326_10051298 3300028558 Bacteria 1168
237 Ga0265319_1005876 3300028563 Bacteria 5782
238 Ga0265334_10000540 3300028573 Bacteria 19296
239 Ga0265318_10000804 3300028577 Bacteria 20812
240 Ga0265338_10039153 3300028800 Bacteria 4478
241 Ga0265338_10054809 3300028800 Bacteria 3552
242 Ga0265330_10018091 3300031235 Bacteria 3238
243 Ga0265332_10005227 3300031238 Bacteria 6005
244 Ga0265328_10000896 3300031239 Bacteria 13775
245 Ga0265328_10017221 3300031239 Bacteria 2800
246 Ga0265320_10001434 3300031240 Bacteria 17350
247 Ga0265325_10012818 3300031241 Bacteria 4784
248 Ga0265329_10016927 3300031242 Bacteria 2517
249 Ga0265339_10182388 3300031249 Bacteria 1044
250 Ga0265331_10000070 3300031250 Bacteria 152331
251 Ga0265331_10003536 3300031250 Bacteria 10028
252 Ga0265327_10000156 3300031251 Bacteria 146362
253 Ga0265327_10001987 3300031251 Bacteria 23267
254 Ga0265327_10086665 3300031251 Bacteria 1535
255 Ga0265316_10056812 3300031344 Bacteria 3054
256 Ga0307509_10234804 3300031507 Bacteria 1633
257 Ga0265313_10028715 3300031595 Bacteria 2886
258 Ga0265314_10011482 3300031711 Bacteria 7306
259 Ga0265342_10003570 3300031712 Bacteria 12715
260 Ga0316576_10088425 3300031727 Bacteria 2306
261 Ga0316578_10204719 3300031728 Bacteria 1188
262 Ga0307516_10000113 3300031730 Bacteria 93946
263 Ga0307410_10019542 3300031852 Bacteria 4124
264 Ga0307410_10511705 3300031852 Bacteria 989
265 Ga0307406_10648432 3300031901 Bacteria 876
266 Ga0307407_10372813 3300031903 Bacteria 1017
267 Ga0307412_10042151 3300031911 Bacteria 2963
268 Ga0307412_10276347 3300031911 Bacteria 1317
269 Ga0307409_100314293 3300031995 Bacteria 1463
270 Ga0307416_100229174 3300032002 Bacteria 1789
271 Ga0307411_10580931 3300032005 Bacteria 960
272 Ga0307415_100933132 3300032126 Bacteria 802
273 Ga0316593_10053875 3300032168 Bacteria 1364
274 Ga0316587_1021824 3300033529 Bacteria 1094
275 Ga0373944_0235481 3300035089 Bacteria 672
276 Ga0373942_0004485 3300035207 Bacteria 3238
277 Ga0373935_0319799 3300035692 Bacteria 1101
278 Ga0373933_0212329 3300035724 Bacteria 1240
279 Ga0316582_0301974 3300036647 Bacteria 1100
280 Ga0395901_0609310 3300038443 Bacteria 1100
281 Ga0400488_34323 3300038741 Bacteria 1559
282 Ga0400486_13767 3300038742 Bacteria 4291
283 Ga0400487_24020 3300039110 Bacteria 1556
284 Ga0439438_105672 3300041405 Bacteria 681
285 Ga0439453_0044358 3300041408 Bacteria 881
286 Ga0451835_0192922 3300041492 Bacteria 4102
287 Ga0451837_0732906 3300041494 Bacteria 7284
288 Ga0451839_0815740 3300041496 Bacteria 5626
289 Ga0451841_0553159 3300041498 Bacteria 6857
290 Ga0451845_0076104 3300041501 Bacteria 4215
291 Ga0451847_0929205 3300041503 Bacteria 6835
292 Ga0451849_0006899 3300041505 Bacteria 6892
293 Ga0451851_0676020 3300041507 Bacteria 7215
294 Ga0451843_1598276 3300041509 Bacteria 4662
295 Ga0451853_1628757 3300041512 Bacteria 1331
296 Ga0439443_011761 3300042003 Bacteria 1287
297 Ga0439432_068155 3300042006 Bacteria 1088
298 Ga0439449_0024449 3300042007 Bacteria 2258
299 Ga0439452_032866 3300042010 Bacteria 1264
300 Ga0450920_008996 3300042122 Bacteria 1836
301 Ga0450923_000683 3300042125 Bacteria 3981
302 Ga0450894_049429 3300042131 Bacteria 617
303 Ga0450896_000421 3300042133 Bacteria 4299
304 Ga0450898_004835 3300042134 Bacteria 2011
305 Ga0439446_0000092 3300042156 Bacteria 15215
306 Ga0450908_038900 3300042184 Bacteria 824
307 Ga0439434_0003129 3300042435 Bacteria 4865
308 Ga0439434_0190609 3300042435 Bacteria 689
309 Ga0439444_0000262 3300042437 Bacteria 5267
310 Ga0439464_0000949 3300042439 Bacteria 6545
311 Ga0466965_0053344 3300044683 Bacteria 2009
312 Ga0466966_0028598 3300044684 Bacteria 3629
313 Ga0466961_0007644 3300044693 Bacteria 6881
314 Ga0466964_0413644 3300044706 Bacteria 707
315 Ga0466968_0009324 3300044735 Bacteria 3776
316 Ga0466970_0022082 3300044765 Bacteria 3321
317 Ga0466957_0032974 3300044842 Bacteria 3104
318 Ga0466959_0009617 3300045049 Bacteria 6876
319 Ga0466959_0299184 3300045049 Bacteria 1102
320 Ga0451576_0141866 3300045051 Bacteria 2505
321 Ga0466958_0064014 3300045836 Bacteria 2242
322 Ga0495607_0000262 3300046501 Bacteria 56368
323 Ga0495628_1021274 3300046516 Bacteria 568
324 Ga0495637_0014936 3300046520 Bacteria 3654
325 Ga0495642_0177051 3300046528 Bacteria 928
326 Ga0495654_0411410 3300046530 Bacteria 536
327 Ga0495598_0078378 3300046537 Bacteria 1055
328 Ga0495672_0002923 3300047320 Bacteria 15089
329 Ga0496100_0139386 3300048903 Bacteria 1717
330 Ga0496101_0035269 3300048904 Bacteria 3537
331 Ga0496101_0239779 3300048904 Bacteria 1411
332 Ga0496102_0181893 3300048905 Bacteria 1981
333 Ga0496102_0967265 3300048905 Bacteria 772
334 Ga0496104_1051988 3300048907 Bacteria 718
335 Ga0496105_0000936 3300048908 Bacteria 19902
336 Ga0496107_0178610 3300048910 Bacteria 1576
337 Ga0496108_0389485 3300048911 Bacteria 1217
338 Ga0496109_0021715 3300048912 Bacteria 5680
339 Ga0496109_0532051 3300048912 Bacteria 1109
340 Ga0496110_0007064 3300048913 Bacteria 8934
341 Ga0496111_0217621 3300048914 Bacteria 1419
342 Ga0496112_0454533 3300048915 Bacteria 1218
343 Ga0496114_0061865 3300048917 Bacteria 3132
344 Ga0496114_0173592 3300048917 Bacteria 1880
345 Ga0496118_0375504 3300048921 Unclassified 748
346 Ga0496121_0018679 3300048924 Bacteria 6978
347 Ga0501031_0344221 3300049568 Bacteria 965
348 Ga0501033_0429441 3300049570 Bacteria 919
349 Ga0501033_0462567 3300049570 Bacteria 880
350 Ga0501034_0135953 3300049571 Bacteria 2439
351 Ga0501036_0542790 3300049572 Bacteria 966
352 Ga0501036_1186217 3300049572 Bacteria 622
353 Ga0501037_0144258 3300049573 Bacteria 1703
354 Ga0501038_0259545 3300049574 Bacteria 1374
355 Ga0501040_0000994 3300049576 Bacteria 17940
356 Ga0501041_0102835 3300049577 Bacteria 1769
357 Ga0501042_0013064 3300049578 Bacteria 5646
358 Ga0501047_0947613 3300049581 Bacteria 674
359 Ga0501048_0018373 3300049582 Bacteria 5143
360 Ga0501068_0739512 3300049584 Bacteria 644
361 Ga0501070_0334239 3300049586 Bacteria 1231
362 Ga0501071_0133630 3300049587 Bacteria 1845
363 Ga0501071_0636908 3300049587 Bacteria 820
364 Ga0501072_0003005 3300049588 Bacteria 12717
365 Ga0501075_0000258 3300049591 Bacteria 28848
366 Ga0501075_0743517 3300049591 Bacteria 747
367 Ga0501077_0212839 3300049593 Bacteria 1228
368 Ga0501079_0006290 3300049741 Bacteria 8905
369 Ga0501079_0031499 3300049741 Bacteria 4077
370 Ga0501080_0011938 3300049742 Bacteria 7956
371 Ga0501080_0013287 3300049742 Bacteria 7566
372 Ga0501081_0055390 3300049743 Bacteria 2740
373 Ga0501045_0008865 3300049824 Bacteria 7023
374 Ga0501045_0477204 3300049824 Bacteria 927
375 nmdc:mga0yw44_130451_c1 3300050492 Bacteria 1627
376 nmdc:mga0k408_251416_c1 3300050493 Bacteria 1055
377 nmdc:mga07m45_632130_c1 3300050496 Bacteria 617
378 nmdc:mga05p37_1179_c1 3300050507 Bacteria 30174
379 nmdc:mga05p37_118029_c1 3300050507 Bacteria 2752
380 nmdc:mga05p37_2090_c1 3300050507 Bacteria 23298
381 nmdc:mga09592_273560_c1 3300050508 Bacteria 1465
382 nmdc:mga09592_420147_c1 3300050508 Unclassified 1155
383 nmdc:mga0qj67_17379_c1 3300050509 Bacteria 5468
384 nmdc:mga0qj67_3697_c1 3300050509 Bacteria 11045
385 nmdc:mga0qj67_7211_c1 3300050509 Bacteria 8207
386 nmdc:mga0qj67_850702_c1 3300050509 Bacteria 720
387 nmdc:mga06r32_120517_c1 3300050510 Bacteria 2587
388 nmdc:mga06r32_258603_c1 3300050510 Bacteria 1729
389 nmdc:mga08y16_124913_c1 3300050511 Bacteria 2677
390 nmdc:mga08y16_29636_c1 3300050511 Bacteria 5763
391 nmdc:mga08y16_672367_c1 3300050511 Bacteria 1038
392 nmdc:mga0n895_100427_c1 3300050512 Bacteria 2902
393 nmdc:mga0n895_473783_c1 3300050512 Unclassified 1263
394 nmdc:mga0n895_748617_c1 3300050512 Bacteria 970
395 nmdc:mga0a205_196703_c1 3300050515 Bacteria 1907
396 nmdc:mga0a205_293705_c1 3300050515 Bacteria 1499
397 Ga0495655_0067593 3300053083 Bacteria 991
398 Ga0500583_0383377 3300053092 Bacteria 677
399 Ga0500568_0001342 3300053139 Bacteria 16057
400 Ga0500604_0154322 3300053151 Bacteria 781
401 Ga0500627_0239231 3300053158 Bacteria 806
402 Ga0500645_001694 3300053730 Bacteria 10762
403 Ga0501084_0176772 3300054114 Bacteria 1802
404 Ga0501082_0649269 3300060353 Bacteria 923
405 Ga0530510_0000170 3300061734 Bacteria 39521
406 Ga0530510_0754916 3300061734 Bacteria 742
407 2514417138 2513237305 Bacteria 7293571
408 2524614010 2524023250 Bacteria 5457705
409 2585336421 2582581316 Bacteria 7774528
410 2616292274 2615840624 Bacteria 6557588
411 2719181456 2718217882 Bacteria 6556348
412 2719665789 2718217997 Bacteria 6740740
413 2719732120 2718218009 Bacteria 6478651
414 2720492209 2718218199 Bacteria 6740745
415 2720620349 2718218233 Bacteria 6662049
416 2720631773 2718218235 Bacteria 6630699
417 2720775501 2718218269 Bacteria 6906114
418 2721147478 2718218363 Bacteria 6524337
419 2721158997 2718218365 Bacteria 6274507
420 2721164383 2718218366 Bacteria 6425255
421 2722840553 2721755514 Bacteria 6424414
422 2723560732 2721755684 Bacteria 6859907
423 2723567320 2721755685 Bacteria 6704835
424 2723573664 2721755686 Bacteria 7343952
425 2724044876 2721755810 Bacteria 6479005
426 2724090108 2721755819 Bacteria 6906405
427 2724104585 2721755822 Bacteria 6726041
428 2724110386 2721755823 Bacteria 6752556
429 2730164621 2728369365 Bacteria 6555560
430 2730298629 2728369397 Bacteria 6274511
431 2756673956 2756170246 Bacteria 7451806
432 2770194722 2767802442 Bacteria 5747986
433 2793294875 2791355256 Bacteria 6798008
434 2793322979 2791355260 Bacteria 6598818
435 2793335859 2791355262 Bacteria 6774204
436 2793349933 2791355264 Bacteria 6429314
437 2793352872 2791355265 Bacteria 6539969
438 2805925884 2802429605 Bacteria 6875453
439 2805937538 2802429606 Bacteria 6346811
440 2838053550 2838048938 Bacteria 6044578
441 2838065620 2838061910 Bacteria 6794874
442 2838074335 2838068647 Bacteria 6208656
443 2838674420 2838668709 Bacteria 6671819
444 2838706948 2838701080 Bacteria 6669771
445 2842151476 2842146304 Bacteria 5957337
446 2842194325 2842192696 Bacteria 6147454
447 2842205840 2842205361 Bacteria 6340321
448 2842256614 2842250916 Bacteria 6579627
449 2842279297 2842278818 Bacteria 6340002
450 2842314425 2842311132 Bacteria 6616990
451 2842317728 2842317721 Bacteria 6793725
452 2842427550 2842422224 Bacteria 6239196
453 2842450760 2842447887 Bacteria 6754142
454 2842490214 2842489311 Bacteria 6620893
455 2842495991 2842495871 Bacteria 6820686
456 2844002493 2844002411 Bacteria 7168230
457 2871467429 2871466892 Bacteria 6923287
458 2882638400 2882632389 Bacteria 8154593
459 2885322375 2885318864 Bacteria 6729568
460 2894024026 2894023352 Bacteria 5167372
461 2906381920 2906378014 Bacteria 6911440
462 2919544720 2919543075 Bacteria 4728703
463 2924766632 2924762789 Bacteria 6561353
464 2924790483 2924784321 Bacteria 7416538
465 2933604792 2933599457 Bacteria 5858799
466 2937828070 2937822353 Bacteria 7290551
467 2987671024 2987666974 Bacteria 6509233
468 639787506 639633007 Bacteria 4376040
469 640486192 640427133 Bacteria 4567418
470 8005285302 8005282627 Bacteria 6675747
471 8005500521 8005497431 Bacteria 6477605
472 8005627141 8005626139 Bacteria 6534237
473 8005671939 8005668836 Bacteria 6953162
474 8018130106 8018127388 Bacteria 7351159
475 8024501452 8024501048 Bacteria 6427847
476 8056388033 8056382006 Bacteria 6408074
477 Ga0099794_10149691
478 MBSR1b_contig_3608504
479 MBSR1b_contig_4766410
480 JGI24749J21850_1017037
481 JGI24035J26624_1024662
482 JGI24034J26672_10010494
483 Ga0065165_1060513
484 Ga0065712_10139797
485 Ga0065712_10338387
486 Ga0065715_10111214
487 Ga0065707_10090951
488 Ga0070676_10049121
489 Ga0070683_100332396
490 Ga0070690_100012295
491 Ga0070670_100017285
492 Ga0070670_100346875
493 Ga0070677_10004187
494 Ga0070677_10032351
495 Ga0068869_100102094
496 Ga0070666_10143817
497 Ga0070666_10673564
498 Ga0068868_100247154
499 Ga0070660_100172416
500 Ga0070661_101053713
501 Ga0070692_10042164
502 Ga0070668_100000058
503 Ga0070668_100119126
504 Ga0070668_101228033
505 Ga0070669_100004006
506 Ga0070669_100255561
507 Ga0070675_100241871
508 Ga0070675_100758454
509 Ga0070671_100038707
510 Ga0070674_100021635
511 Ga0070688_100239326
512 Ga0070667_100147289
513 Ga0070667_100953839
514 Ga0070667_101178949
515 Ga0070703_10020136
516 Ga0070701_10157930
517 Ga0070705_100163670
518 Ga0070700_100009631
519 Ga0070700_100177632
520 Ga0070694_100443061
521 Ga0070663_100237172
522 Ga0070663_100889322
523 Ga0070678_100056829
524 Ga0070678_100088013
525 Ga0070662_100124013
526 Ga0070662_101221465
527 Ga0070662_101419985
528 Ga0070685_10005163
529 Ga0070706_100062810
530 Ga0070698_100276992
531 Ga0070684_100286904
532 Ga0068853_100094747
533 Ga0070672_100057411
534 Ga0070672_100181754
535 Ga0070695_100993028
536 Ga0070693_100037039
537 Ga0070665_100184362
538 Ga0070665_100548563
539 Ga0070704_100008797
540 Ga0070704_100227034
541 Ga0068857_100025606
542 Ga0068857_100114025
543 Ga0068854_100118721
544 Ga0070702_100011371
545 Ga0068852_100044009
546 Ga0068859_100064511
547 Ga0068859_100815049
548 Ga0068864_100090514
549 Ga0068864_100222892
550 Ga0068866_10014697
551 Ga0068861_100437755
552 Ga0068851_10046025
553 Ga0068870_10067330
554 Ga0068863_100000012
555 Ga0068863_100548408
556 Ga0068858_100002999
557 Ga0068858_100540816
558 Ga0068860_100279728
559 Ga0068862_100054627
560 Ga0068862_100057219
561 Ga0068862_100239377
562 Ga0068862_101419036
563 Ga0075365_10009573
564 Ga0075369_10223548
565 Ga0097621_100135302
566 Ga0097621_100199226
567 Ga0068871_100311803
568 Ga0068871_100765642
569 Ga0075428_100086555
570 Ga0075430_100012365
571 Ga0075430_100013957
572 Ga0075430_100028951
573 Ga0075430_100507517
574 Ga0075431_101329723
575 Ga0075433_10185309
576 Ga0075434_100007036
577 Ga0075434_101149593
578 Ga0075429_100053799
579 Ga0075429_100084916
580 Ga0075429_100185404
581 Ga0068865_100658272
582 Ga0068865_101013734
583 Ga0097620_100064511
584 Ga0097620_100815066
585 Ga0097620_100982474
586 Ga0075435_100455506
587 Ga0105251_10158709
588 Ga0105250_10038922
589 Ga0111539_10073238
590 Ga0111539_10164489
591 Ga0111539_10174528
592 Ga0114129_10011867
593 Ga0114129_10012454
594 Ga0114129_10049054
595 Ga0114129_10383525
596 Ga0114129_10486640
597 Ga0105243_10140724
598 Ga0105241_10004837
599 Ga0105242_10053976
600 Ga0105242_10635051
601 Ga0105248_10359127
602 Ga0105248_10580684
603 Ga0105248_10652461
604 Ga0105237_10478963
605 Ga0105238_10284508
606 Ga0105249_10017740
607 Ga0105249_10031731
608 Ga0105249_10205871
609 Ga0105239_10356083
610 Ga0105246_10081653
611 Ga0105246_10193502
612 Ga0157373_10556024
613 Ga0157371_10063438
614 Ga0157370_11278797
615 Ga0157374_10157793
616 Ga0163162_10967814
617 Ga0163162_11464561
618 Ga0157372_10252633
619 Ga0157372_10301167
620 Ga0157375_10098424
621 Ga0163163_10124903
622 Ga0163163_10189189
623 Ga0163163_10192002
624 Ga0163163_10591348
625 Ga0157380_10096763
626 Ga0157380_11004667
627 Ga0157377_10025751
628 Ga0157379_10149320
629 Ga0157376_10037102
630 Ga0157376_10188182
631 Ga0157376_10580384
632 Ga0163161_10068375
633 Ga0207666_1002817
634 Ga0209455_1004818
635 Ga0207697_10001120
636 Ga0207697_10051597
637 Ga0207656_10026012
638 Ga0207653_10030757
639 Ga0207682_10000179
640 Ga0207682_10048189
641 Ga0207642_10010938
642 Ga0207688_10014325
643 Ga0207688_10045270
644 Ga0207680_10228092
645 Ga0207647_10433686
646 Ga0207647_10581654
647 Ga0207645_10005789
648 Ga0207643_10006326
649 Ga0207643_10107216
650 Ga0207662_10139282
651 Ga0207657_10141811
652 Ga0207657_10336276
653 Ga0207649_10089615
654 Ga0207646_10716936
655 Ga0207681_10007301
656 Ga0207681_10365983
657 Ga0207681_10564184
658 Ga0207694_10348012
659 Ga0207650_10011114
660 Ga0207650_10313638
661 Ga0207650_10495798
662 Ga0207659_10097686
663 Ga0207659_10160125
664 Ga0207644_10000070
665 Ga0207644_10087983
666 Ga0207690_10154988
667 Ga0207706_10027470
668 Ga0207706_10328041
669 Ga0207706_10334485
670 Ga0207709_10142378
671 Ga0207669_10086879
672 Ga0207704_10659658
673 Ga0207691_10026470
674 Ga0207691_10036661
675 Ga0207691_10261573
676 Ga0207711_10446513
677 Ga0207711_10592569
678 Ga0207689_10051790
679 Ga0207689_10131260
680 Ga0207661_10073688
681 Ga0207667_10191036
682 Ga0207712_10037716
683 Ga0207712_10092027
684 Ga0207668_10000061
685 Ga0207668_10317501
686 Ga0207658_10260094
687 Ga0207658_10949538
688 Ga0207677_10762499
689 Ga0207703_10089350
690 Ga0207703_10567420
691 Ga0207678_10006934
692 Ga0207708_10178315
693 Ga0207702_10611092
694 Ga0207648_10011918
695 Ga0207674_10114385
696 Ga0207674_11088069
697 Ga0207675_100077464
698 Ga0207675_100185197
699 Ga0207683_10143531
700 Ga0207683_10198081
701 Ga0207683_10404636
702 Ga0207428_10008245
703 Ga0207428_10010169
704 Ga0207428_10096320
705 Ga0268266_10028248
706 Ga0268266_10136706
707 Ga0268266_10817923
708 Ga0268265_10206482
709 Ga0268265_10381055
710 Ga0268265_11243014
711 Ga0268264_10442725
712 Ga0265326_10051298
713 Ga0265319_1005876
714 Ga0265334_10000540
715 Ga0265318_10000804
716 Ga0265338_10039153
717 Ga0265338_10054809
718 Ga0265330_10018091
719 Ga0265332_10005227
720 Ga0265328_10000896
721 Ga0265328_10017221
722 Ga0265320_10001434
723 Ga0265325_10012818
724 Ga0265329_10016927
725 Ga0265339_10182388
726 Ga0265331_10000070
727 Ga0265331_10003536
728 Ga0265327_10000156
729 Ga0265327_10001987
730 Ga0265327_10086665
731 Ga0265316_10056812
732 Ga0307509_10234804
733 Ga0265313_10028715
734 Ga0265314_10011482
735 Ga0265342_10003570
736 Ga0316576_10088425
737 Ga0316578_10204719
738 Ga0307516_10000113
739 Ga0307410_10019542
740 Ga0307410_10511705
741 Ga0307406_10648432
742 Ga0307407_10372813
743 Ga0307412_10042151
744 Ga0307412_10276347
745 Ga0307409_100314293
746 Ga0307416_100229174
747 Ga0307411_10580931
748 Ga0307415_100933132
749 Ga0316593_10053875
750 Ga0316587_1021824
751 Ga0373944_0235481
752 Ga0373942_0004485
753 Ga0373935_0319799
754 Ga0373933_0212329
755 Ga0316582_0301974
756 Ga0395901_0609310
757 Ga0400488_34323
758 Ga0400486_13767
759 Ga0400487_24020
760 Ga0439438_105672
761 Ga0439453_0044358
762 Ga0451835_0192922
763 Ga0451837_0732906
764 Ga0451839_0815740
765 Ga0451841_0553159
766 Ga0451845_0076104
767 Ga0451847_0929205
768 Ga0451849_0006899
769 Ga0451851_0676020
770 Ga0451843_1598276
771 Ga0451853_1628757
772 Ga0439443_011761
773 Ga0439432_068155
774 Ga0439449_0024449
775 Ga0439452_032866
776 Ga0450920_008996
777 Ga0450923_000683
778 Ga0450894_049429
779 Ga0450896_000421
780 Ga0450898_004835
781 Ga0439446_0000092
782 Ga0450908_038900
783 Ga0439434_0003129
784 Ga0439434_0190609
785 Ga0439444_0000262
786 Ga0439464_0000949
787 Ga0466965_0053344
788 Ga0466966_0028598
789 Ga0466961_0007644
790 Ga0466964_0413644
791 Ga0466968_0009324
792 Ga0466970_0022082
793 Ga0466957_0032974
794 Ga0466959_0009617
795 Ga0466959_0299184
796 Ga0451576_0141866
797 Ga0466958_0064014
798 Ga0495607_0000262
799 Ga0495628_1021274
800 Ga0495637_0014936
801 Ga0495642_0177051
802 Ga0495654_0411410
803 Ga0495598_0078378
804 Ga0495672_0002923
805 Ga0496100_0139386
806 Ga0496101_0035269
807 Ga0496101_0239779
808 Ga0496102_0181893
809 Ga0496102_0967265
810 Ga0496104_1051988
811 Ga0496105_0000936
812 Ga0496107_0178610
813 Ga0496108_0389485
814 Ga0496109_0021715
815 Ga0496109_0532051
816 Ga0496110_0007064
817 Ga0496111_0217621
818 Ga0496112_0454533
819 Ga0496114_0061865
820 Ga0496114_0173592
821 Ga0496118_0375504
822 Ga0496121_0018679
823 Ga0501031_0344221
824 Ga0501033_0429441
825 Ga0501033_0462567
826 Ga0501034_0135953
827 Ga0501036_0542790
828 Ga0501036_1186217
829 Ga0501037_0144258
830 Ga0501038_0259545
831 Ga0501040_0000994
832 Ga0501041_0102835
833 Ga0501042_0013064
834 Ga0501047_0947613
835 Ga0501048_0018373
836 Ga0501068_0739512
837 Ga0501070_0334239
838 Ga0501071_0133630
839 Ga0501071_0636908
840 Ga0501072_0003005
841 Ga0501075_0000258
842 Ga0501075_0743517
843 Ga0501077_0212839
844 Ga0501079_0006290
845 Ga0501079_0031499
846 Ga0501080_0011938
847 Ga0501080_0013287
848 Ga0501081_0055390
849 Ga0501045_0008865
850 Ga0501045_0477204
851 nmdc:mga0yw44_130451_c1
852 nmdc:mga0k408_251416_c1
853 nmdc:mga07m45_632130_c1
854 nmdc:mga05p37_1179_c1
855 nmdc:mga05p37_118029_c1
856 nmdc:mga05p37_2090_c1
857 nmdc:mga09592_273560_c1
858 nmdc:mga09592_420147_c1
859 nmdc:mga0qj67_17379_c1
860 nmdc:mga0qj67_3697_c1
861 nmdc:mga0qj67_7211_c1
862 nmdc:mga0qj67_850702_c1
863 nmdc:mga06r32_120517_c1
864 nmdc:mga06r32_258603_c1
865 nmdc:mga08y16_124913_c1
866 nmdc:mga08y16_29636_c1
867 nmdc:mga08y16_672367_c1
868 nmdc:mga0n895_100427_c1
869 nmdc:mga0n895_473783_c1
870 nmdc:mga0n895_748617_c1
871 nmdc:mga0a205_196703_c1
872 nmdc:mga0a205_293705_c1
873 Ga0495655_0067593
874 Ga0500583_0383377
875 Ga0500568_0001342
876 Ga0500604_0154322
877 Ga0500627_0239231
878 Ga0500645_001694
879 Ga0501084_0176772
880 Ga0501082_0649269
881 Ga0530510_0000170
882 Ga0530510_0754916
883 2514417138
884 2524614010
885 2585336421
886 2616292274
887 2719181456
888 2719665789
889 2719732120
890 2720492209
891 2720620349
892 2720631773
893 2720775501
894 2721147478
895 2721158997
896 2721164383
897 2722840553
898 2723560732
899 2723567320
900 2723573664
901 2724044876
902 2724090108
903 2724104585
904 2724110386
905 2730164621
906 2730298629
907 2756673956
908 2770194722
909 2793294875
910 2793322979
911 2793335859
912 2793349933
913 2793352872
914 2805925884
915 2805937538
916 2838053550
917 2838065620
918 2838074335
919 2838674420
920 2838706948
921 2842151476
922 2842194325
923 2842205840
924 2842256614
925 2842279297
926 2842314425
927 2842317728
928 2842427550
929 2842450760
930 2842490214
931 2842495991
932 2844002493
933 2871467429
934 2882638400
935 2885322375
936 2894024026
937 2906381920
938 2919544720
939 2924766632
940 2924790483
941 2933604792
942 2937828070
943 2987671024
944 639787506
945 640486192
946 8005285302
947 8005500521
948 8005627141
949 8005671939
950 8018130106
951 8024501452
952 8056388033

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

8

138

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9595 6 145
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9454 6 145
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9362 6 144
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9089 6 145
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9084 6 144
ID Description Score Start End Superfamily
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9059 8 143 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8924 7 143 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8632 8 143 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8557 7 143 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.827 9 145 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V9GUH8-F1-model_v4 Protein-tyrosine-phosphatase 0.9902 6 163 GO:0046685
AF-A0A2S2DEE9-F1-model_v4 ArsR family transcriptional regulator 0.9887 5 165 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A2D6BEZ2-F1-model_v4 deleted 0.9879 18 164
AF-A0A529MMM0-F1-model_v4 Arsenate reductase ArsC 0.985 23 142 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A651FWF4-F1-model_v4 MarR family transcriptional regulator 0.9839 5 163 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793

Map