F451510

General Info

Members Datasets Scaffolds Average Seq Length
476 202 476 222

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100054446|Ga0097621_1000544462
Length 256
Sequence MVEKPYKNVFKFMMNHTDSFVKFISLNFLTILISSMLQTSTLKFLKDLKRNNNKPWFDAHRKEYETAKGDFAAFIHNVIDKQSKSDPTIKSIVAKDCMFRINRDVRFSKDKSPYKTNMGAYINRGGKKSVFAGYYFHCEPGQSFVGGGLWMPMPPELSKVRQEIDYNLDGFKKIVTSKKFKAVYKDLSHEAEYVLSRVPKGYETTNPAAEYLKMKSFVSMASLKDSDLTSKDLVKKTTTAFEALQPLIDFINGSLN

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
150 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
151 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
152 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
188 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
189 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
190 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 1.26
Rhizosphere 96.22
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10021793 3300002077 Bacteria 1259
2 JGI24751J29686_10000913 3300002459 Bacteria 6687
3 rootH2_10022400 3300003320 Bacteria 18013
4 rootH1_10027085 3300003323 Bacteria 1246
5 rootH1_10262097 3300003323 Bacteria 3810
6 Ga0065704_10088239 3300005289 Unclassified 2955
7 Ga0065704_10259550 3300005289 Bacteria 969
8 Ga0065712_10000884 3300005290 Bacteria 8010
9 Ga0065715_10098396 3300005293 Bacteria 3554
10 Ga0065707_10250581 3300005295 Bacteria 1126
11 Ga0070658_10287944 3300005327 Bacteria 1399
12 Ga0070658_10412318 3300005327 Bacteria 1161
13 Ga0070676_10053959 3300005328 Bacteria 2368
14 Ga0070676_10212359 3300005328 Bacteria 1274
15 Ga0070683_100269753 3300005329 Bacteria 1619
16 Ga0070690_100170067 3300005330 Unclassified 1499
17 Ga0070670_100120224 3300005331 Bacteria 2266
18 Ga0070670_100212109 3300005331 Bacteria 1684
19 Ga0070677_10026720 3300005333 Bacteria 2167
20 Ga0070677_10066650 3300005333 Bacteria 1502
21 Ga0068869_100002957 3300005334 Bacteria 10319
22 Ga0068869_100025453 3300005334 Bacteria 4109
23 Ga0068869_100137792 3300005334 Bacteria 1882
24 Ga0070680_100039589 3300005336 Bacteria 3814
25 Ga0070680_100080612 3300005336 Unclassified 2684
26 Ga0070682_100027529 3300005337 Bacteria 3412
27 Ga0070682_100051999 3300005337 Bacteria 2562
28 Ga0070682_100620944 3300005337 Bacteria 856
29 Ga0068868_100135016 3300005338 Bacteria 2022
30 Ga0068868_100294804 3300005338 Bacteria 1376
31 Ga0070660_100131668 3300005339 Bacteria 2002
32 Ga0070660_100196720 3300005339 Bacteria 1634
33 Ga0070689_100042649 3300005340 Unclassified 3484
34 Ga0070689_100085946 3300005340 Unclassified 2473
35 Ga0070687_100183924 3300005343 Unclassified 1254
36 Ga0070661_100012545 3300005344 Bacteria 5930
37 Ga0070661_100369352 3300005344 Bacteria 1129
38 Ga0070668_100083396 3300005347 Bacteria 2509
39 Ga0070669_100016070 3300005353 Bacteria 5339
40 Ga0070669_100050457 3300005353 Unclassified 3039
41 Ga0070669_100119272 3300005353 Bacteria 2010
42 Ga0070669_100181249 3300005353 Bacteria 1648
43 Ga0070669_100913142 3300005353 Bacteria 750
44 Ga0070675_100079672 3300005354 Bacteria 2729
45 Ga0070675_100107633 3300005354 Bacteria 2354
46 Ga0070675_100114969 3300005354 Bacteria 2280
47 Ga0070675_100462759 3300005354 Bacteria 1139
48 Ga0070671_100118214 3300005355 Bacteria 2229
49 Ga0070671_100295866 3300005355 Bacteria 1378
50 Ga0070674_100122531 3300005356 Bacteria 1927
51 Ga0070674_100301608 3300005356 Bacteria 1277
52 Ga0070674_100349733 3300005356 Bacteria 1193
53 Ga0070674_100384225 3300005356 Unclassified 1143
54 Ga0070674_100647020 3300005356 Bacteria 898
55 Ga0070673_100071030 3300005364 Bacteria 2796
56 Ga0070673_100101368 3300005364 Bacteria 2372
57 Ga0070673_100231442 3300005364 Bacteria 1603
58 Ga0070673_100570356 3300005364 Bacteria 1030
59 Ga0070688_100008629 3300005365 Bacteria 5547
60 Ga0070688_100021027 3300005365 Bacteria 3805
61 Ga0070688_100024073 3300005365 Bacteria 3587
62 Ga0070659_100011442 3300005366 Bacteria 6563
63 Ga0070659_100047005 3300005366 Bacteria 3384
64 Ga0070667_100086985 3300005367 Bacteria 2682
65 Ga0070667_100198719 3300005367 Bacteria 1779
66 Ga0070667_100253186 3300005367 Unclassified 1575
67 Ga0070667_100340944 3300005367 Bacteria 1355
68 Ga0070667_100516924 3300005367 Bacteria 1095
69 Ga0070667_100582298 3300005367 Bacteria 1030
70 Ga0070708_100466587 3300005445 Bacteria 1191
71 Ga0070662_100075813 3300005457 Bacteria 2491
72 Ga0070681_10178456 3300005458 Bacteria 2045
73 Ga0070681_10289231 3300005458 Bacteria 1549
74 Ga0068867_100005971 3300005459 Bacteria 8636
75 Ga0068867_100029629 3300005459 Bacteria 3944
76 Ga0068867_100056241 3300005459 Bacteria 2910
77 Ga0068867_100133154 3300005459 Unclassified 1934
78 Ga0068867_100426581 3300005459 Bacteria 1124
79 Ga0070685_10025184 3300005466 Bacteria 3276
80 Ga0070698_100000261 3300005471 Bacteria 53090
81 Ga0070698_100001837 3300005471 Bacteria 23656
82 Ga0070698_100124945 3300005471 Bacteria 2530
83 Ga0070699_100532647 3300005518 Bacteria 1068
84 Ga0070679_100155068 3300005530 Bacteria 2265
85 Ga0068853_100019279 3300005539 Bacteria 5654
86 Ga0068853_100164560 3300005539 Bacteria 2004
87 Ga0068853_100513530 3300005539 Bacteria 1132
88 Ga0068853_100621868 3300005539 Bacteria 1026
89 Ga0070672_100044903 3300005543 Bacteria 3415
90 Ga0070672_100062607 3300005543 Bacteria 2936
91 Ga0070672_100267622 3300005543 Bacteria 1442
92 Ga0070672_100307799 3300005543 Unclassified 1344
93 Ga0070672_100839616 3300005543 Bacteria 809
94 Ga0070686_100182150 3300005544 Bacteria 1493
95 Ga0070686_100389654 3300005544 Unclassified 1057
96 Ga0070686_100569688 3300005544 Bacteria 888
97 Ga0070704_100738994 3300005549 Unclassified 875
98 Ga0068855_100081378 3300005563 Bacteria 3754
99 Ga0068855_100278449 3300005563 Bacteria 1858
100 Ga0068857_100017703 3300005577 Bacteria 6248
101 Ga0068857_100131887 3300005577 Bacteria 2254
102 Ga0068857_100141652 3300005577 Bacteria 2173
103 Ga0070702_100062391 3300005615 Bacteria 2173
104 Ga0070702_100596394 3300005615 Unclassified 827
105 Ga0068859_100021136 3300005617 Bacteria 6531
106 Ga0068859_100022740 3300005617 Bacteria 6286
107 Ga0068859_100034740 3300005617 Bacteria 5059
108 Ga0068859_100065600 3300005617 Bacteria 3664
109 Ga0068859_100069690 3300005617 Bacteria 3552
110 Ga0068859_100070594 3300005617 Bacteria 3528
111 Ga0068859_100166805 3300005617 Bacteria 2282
112 Ga0068859_100608624 3300005617 Bacteria 1185
113 Ga0068859_100747263 3300005617 Bacteria 1067
114 Ga0068864_100050002 3300005618 Bacteria 3597
115 Ga0068864_100058196 3300005618 Bacteria 3340
116 Ga0068864_100104543 3300005618 Bacteria 2516
117 Ga0068864_100471507 3300005618 Bacteria 1203
118 Ga0068866_10005820 3300005718 Bacteria 5114
119 Ga0068866_10090180 3300005718 Bacteria 1668
120 Ga0068861_100005004 3300005719 Bacteria 8933
121 Ga0068861_100363351 3300005719 Bacteria 1274
122 Ga0068851_10293377 3300005834 Bacteria 933
123 Ga0068870_10016297 3300005840 Bacteria 3548
124 Ga0068870_10045044 3300005840 Bacteria 2307
125 Ga0068870_10345535 3300005840 Bacteria 953
126 Ga0068863_100117548 3300005841 Bacteria 2534
127 Ga0068863_100119489 3300005841 Bacteria 2512
128 Ga0068863_100484121 3300005841 Bacteria 1217
129 Ga0068863_100553977 3300005841 Unclassified 1135
130 Ga0068863_100562645 3300005841 Unclassified 1126
131 Ga0068858_100148576 3300005842 Bacteria 2202
132 Ga0068860_100012840 3300005843 Bacteria 8234
133 Ga0068860_100039297 3300005843 Bacteria 4526
134 Ga0068860_100057139 3300005843 Bacteria 3709
135 Ga0068860_100060173 3300005843 Bacteria 3610
136 Ga0068860_100142584 3300005843 Bacteria 2304
137 Ga0068860_100567210 3300005843 Bacteria 1138
138 Ga0068860_100753250 3300005843 Viruses 986
139 Ga0068862_100013758 3300005844 Bacteria 6705
140 Ga0068862_100148981 3300005844 Bacteria 2082
141 Ga0068862_100267779 3300005844 Bacteria 1562
142 Ga0068862_101229989 3300005844 Bacteria 748
143 Ga0075366_10022754 3300006195 Bacteria 3648
144 Ga0097621_100006082 3300006237 Bacteria 8541
145 Ga0097621_100054446 3300006237 Bacteria 3263
146 Ga0068871_100035984 3300006358 Bacteria 3938
147 Ga0068871_100043979 3300006358 Bacteria 3589
148 Ga0068871_100096453 3300006358 Bacteria 2470
149 Ga0068871_100286822 3300006358 Bacteria 1441
150 Ga0068871_100559673 3300006358 Unclassified 1036
151 Ga0075428_100040312 3300006844 Bacteria 5138
152 Ga0075428_100289044 3300006844 Bacteria 1763
153 Ga0075430_100004078 3300006846 Bacteria 12326
154 Ga0075430_100040034 3300006846 Bacteria 3967
155 Ga0075431_100038487 3300006847 Bacteria 4924
156 Ga0075431_100455847 3300006847 Unclassified 1274
157 Ga0075434_100437685 3300006871 Bacteria 1329
158 Ga0075429_100003978 3300006880 Bacteria 12648
159 Ga0068865_100031978 3300006881 Bacteria 3512
160 Ga0068865_100192937 3300006881 Bacteria 1577
161 Ga0097620_100021136 3300006931 Bacteria 6531
162 Ga0097620_100022740 3300006931 Bacteria 6286
163 Ga0097620_100034740 3300006931 Bacteria 5059
164 Ga0097620_100065601 3300006931 Bacteria 3664
165 Ga0097620_100069689 3300006931 Bacteria 3552
166 Ga0097620_100070595 3300006931 Bacteria 3528
167 Ga0097620_100166807 3300006931 Bacteria 2282
168 Ga0097620_100608590 3300006931 Bacteria 1185
169 Ga0097620_100747370 3300006931 Bacteria 1067
170 Ga0105240_10086895 3300009093 Bacteria 3830
171 Ga0111539_10043647 3300009094 Bacteria 5374
172 Ga0111539_10068970 3300009094 Bacteria 4175
173 Ga0111539_10477733 3300009094 Bacteria 1451
174 Ga0111539_10505865 3300009094 Bacteria 1407
175 Ga0111539_10773376 3300009094 Bacteria 1118
176 Ga0105247_10010045 3300009101 Bacteria 5732
177 Ga0105242_10052333 3300009176 Bacteria 3332
178 Ga0105242_10068405 3300009176 Bacteria 2938
179 Ga0105242_10083884 3300009176 Unclassified 2669
180 Ga0105242_10139684 3300009176 Bacteria 2101
181 Ga0105242_10224628 3300009176 Bacteria 1680
182 Ga0105242_10515791 3300009176 Unclassified 1139
183 Ga0105242_10519985 3300009176 Bacteria 1135
184 Ga0105242_10732668 3300009176 Bacteria 971
185 Ga0105242_11094894 3300009176 Bacteria 810
186 Ga0105237_10028528 3300009545 Bacteria 5683
187 Ga0105238_10664477 3300009551 Bacteria 1053
188 Ga0105249_10001666 3300009553 Bacteria 19481
189 Ga0105249_10002272 3300009553 Bacteria 16674
190 Ga0105249_10011342 3300009553 Bacteria 7826
191 Ga0105249_10034962 3300009553 Bacteria 4555
192 Ga0105249_10055195 3300009553 Unclassified 3633
193 Ga0105249_10085345 3300009553 Bacteria 2942
194 Ga0105249_10119949 3300009553 Bacteria 2498
195 Ga0105239_10000925 3300010375 Bacteria 41596
196 Ga0105239_10173973 3300010375 Unclassified 2408
197 Ga0105246_10122384 3300011119 Bacteria 1930
198 Ga0105246_10183632 3300011119 Bacteria 1613
199 Ga0157373_10050446 3300013100 Bacteria 2963
200 Ga0157371_10004778 3300013102 Bacteria 11678
201 Ga0157371_10008816 3300013102 Bacteria 7988
202 Ga0157371_10024047 3300013102 Bacteria 4450
203 Ga0157371_10035183 3300013102 Bacteria 3589
204 Ga0157371_10102061 3300013102 Unclassified 2035
205 Ga0157371_10127195 3300013102 Unclassified 1812
206 Ga0157371_10351640 3300013102 Bacteria 1073
207 Ga0157370_10065454 3300013104 Bacteria 3439
208 Ga0157370_10340323 3300013104 Bacteria 1383
209 Ga0157370_10871678 3300013104 Unclassified 818
210 Ga0157369_10015498 3300013105 Bacteria 8589
211 Ga0157369_10248162 3300013105 Bacteria 1858
212 Ga0157369_10597326 3300013105 Bacteria 1139
213 Ga0157374_10005808 3300013296 Bacteria 10424
214 Ga0157374_10134044 3300013296 Bacteria 2399
215 Ga0157374_10166663 3300013296 Bacteria 2147
216 Ga0157378_10014689 3300013297 Bacteria 6860
217 Ga0157378_10025243 3300013297 Bacteria 5234
218 Ga0157378_10123364 3300013297 Unclassified 2390
219 Ga0157378_10714462 3300013297 Bacteria 1022
220 Ga0163162_10067751 3300013306 Bacteria 3620
221 Ga0163162_10069229 3300013306 Bacteria 3581
222 Ga0163162_10110307 3300013306 Unclassified 2849
223 Ga0163162_10144004 3300013306 Unclassified 2498
224 Ga0163162_10381977 3300013306 Bacteria 1542
225 Ga0163162_10587592 3300013306 Bacteria 1240
226 Ga0163162_10659985 3300013306 Bacteria 1169
227 Ga0163162_10676285 3300013306 Unclassified 1155
228 Ga0157372_10004419 3300013307 Bacteria 14994
229 Ga0157372_10029858 3300013307 Bacteria 5957
230 Ga0157372_10034626 3300013307 Bacteria 5554
231 Ga0157372_10112922 3300013307 Unclassified 3113
232 Ga0157372_10137968 3300013307 Bacteria 2809
233 Ga0157372_10568654 3300013307 Unclassified 1321
234 Ga0157372_10749341 3300013307 Unclassified 1136
235 Ga0157372_10848867 3300013307 Bacteria 1060
236 Ga0157372_11479268 3300013307 Bacteria 783
237 Ga0157375_10097678 3300013308 Unclassified 3012
238 Ga0157375_10259455 3300013308 Unclassified 1899
239 Ga0157375_10465052 3300013308 Bacteria 1430
240 Ga0157375_10651147 3300013308 Bacteria 1210
241 Ga0157375_11374360 3300013308 Unclassified 831
242 Ga0163163_10001496 3300014325 Bacteria 19803
243 Ga0163163_10004119 3300014325 Bacteria 12386
244 Ga0163163_10635653 3300014325 Bacteria 1131
245 Ga0157380_10001771 3300014326 Bacteria 14268
246 Ga0157380_10010330 3300014326 Bacteria 6713
247 Ga0157380_10046227 3300014326 Unclassified 3418
248 Ga0157380_10111724 3300014326 Bacteria 2297
249 Ga0157380_10127212 3300014326 Bacteria 2168
250 Ga0157380_10157210 3300014326 Bacteria 1972
251 Ga0157380_10182512 3300014326 Bacteria 1845
252 Ga0157380_10603420 3300014326 Bacteria 1086
253 Ga0157380_10774212 3300014326 Bacteria 974
254 Ga0157380_11047453 3300014326 Bacteria 852
255 Ga0157377_10010873 3300014745 Unclassified 4521
256 Ga0157377_10057471 3300014745 Bacteria 2212
257 Ga0157377_10085826 3300014745 Bacteria 1849
258 Ga0157379_10062889 3300014968 Bacteria 3319
259 Ga0157376_10079613 3300014969 Bacteria 2809
260 Ga0157376_10391335 3300014969 Bacteria 1342
261 Ga0157376_11066100 3300014969 Unclassified 833
262 Ga0163161_10171109 3300017792 Unclassified 1661
263 Ga0213876_10046742 3300021384 Bacteria 2288
264 Ga0207697_10032830 3300025315 Bacteria 2125
265 Ga0207682_10006837 3300025893 Bacteria 4577
266 Ga0207682_10055966 3300025893 Bacteria 1641
267 Ga0207642_10258099 3300025899 Bacteria 992
268 Ga0207710_10065173 3300025900 Bacteria 1660
269 Ga0207688_10009074 3300025901 Bacteria 5413
270 Ga0207680_10022687 3300025903 Bacteria 3418
271 Ga0207680_10079687 3300025903 Bacteria 2054
272 Ga0207647_10000064 3300025904 Bacteria 82970
273 Ga0207645_10000352 3300025907 Bacteria 38310
274 Ga0207645_10009765 3300025907 Bacteria 6623
275 Ga0207645_10364241 3300025907 Bacteria 969
276 Ga0207643_10009154 3300025908 Bacteria 5319
277 Ga0207705_10690766 3300025909 Bacteria 793
278 Ga0207707_10088343 3300025912 Unclassified 2707
279 Ga0207707_10181623 3300025912 Bacteria 1837
280 Ga0207671_10016185 3300025914 Bacteria 5806
281 Ga0207660_10096729 3300025917 Bacteria 2199
282 Ga0207662_10025261 3300025918 Bacteria 3421
283 Ga0207657_10033042 3300025919 Bacteria 4667
284 Ga0207657_10238817 3300025919 Bacteria 1451
285 Ga0207681_10050070 3300025923 Bacteria 2826
286 Ga0207681_10159766 3300025923 Bacteria 1697
287 Ga0207681_10166842 3300025923 Unclassified 1665
288 Ga0207681_10168997 3300025923 Bacteria 1656
289 Ga0207694_10449477 3300025924 Unclassified 1076
290 Ga0207650_10198611 3300025925 Bacteria 1605
291 Ga0207650_10263579 3300025925 Bacteria 1398
292 Ga0207650_10558413 3300025925 Bacteria 960
293 Ga0207659_10077932 3300025926 Bacteria 2441
294 Ga0207659_10142030 3300025926 Bacteria 1865
295 Ga0207659_10181285 3300025926 Bacteria 1668
296 Ga0207659_10863688 3300025926 Unclassified 778
297 Ga0207644_10142734 3300025931 Bacteria 1846
298 Ga0207690_10015227 3300025932 Bacteria 4657
299 Ga0207690_10141315 3300025932 Bacteria 1774
300 Ga0207706_10034136 3300025933 Bacteria 4526
301 Ga0207706_10041727 3300025933 Bacteria 4067
302 Ga0207686_10002356 3300025934 Bacteria 10328
303 Ga0207686_10007345 3300025934 Bacteria 5929
304 Ga0207686_10058679 3300025934 Bacteria 2427
305 Ga0207686_10073095 3300025934 Unclassified 2211
306 Ga0207670_10009894 3300025936 Bacteria 5462
307 Ga0207670_10072809 3300025936 Unclassified 2381
308 Ga0207669_10069359 3300025937 Bacteria 2206
309 Ga0207669_10302526 3300025937 Bacteria 1216
310 Ga0207691_10005099 3300025940 Bacteria 12675
311 Ga0207691_10020461 3300025940 Bacteria 6255
312 Ga0207691_10039767 3300025940 Bacteria 4349
313 Ga0207691_10162418 3300025940 Bacteria 1959
314 Ga0207689_10000885 3300025942 Bacteria 28807
315 Ga0207689_10003324 3300025942 Bacteria 14720
316 Ga0207689_10011925 3300025942 Bacteria 7448
317 Ga0207689_10014167 3300025942 Bacteria 6784
318 Ga0207689_10018283 3300025942 Bacteria 5915
319 Ga0207661_10321750 3300025944 Unclassified 1390
320 Ga0207661_10631596 3300025944 Unclassified 984
321 Ga0207667_10017629 3300025949 Bacteria 8033
322 Ga0207667_10206295 3300025949 Bacteria 2015
323 Ga0207651_10162028 3300025960 Bacteria 1754
324 Ga0207712_10001290 3300025961 Bacteria 17188
325 Ga0207712_10002816 3300025961 Bacteria 11137
326 Ga0207712_10005397 3300025961 Bacteria 8071
327 Ga0207712_10078631 3300025961 Bacteria 2394
328 Ga0207712_10223209 3300025961 Bacteria 1508
329 Ga0207712_10526604 3300025961 Unclassified 1014
330 Ga0207668_10026945 3300025972 Unclassified 3739
331 Ga0207640_10822898 3300025981 Bacteria 806
332 Ga0207658_10018627 3300025986 Bacteria 4799
333 Ga0207658_10155752 3300025986 Bacteria 1867
334 Ga0207658_10328347 3300025986 Unclassified 1326
335 Ga0207658_10955225 3300025986 Bacteria 781
336 Ga0207677_10068128 3300026023 Bacteria 2496
337 Ga0207677_10191586 3300026023 Bacteria 1618
338 Ga0207677_10265494 3300026023 Unclassified 1401
339 Ga0207677_10401829 3300026023 Bacteria 1162
340 Ga0207703_10056332 3300026035 Bacteria 3201
341 Ga0207639_10145648 3300026041 Bacteria 1978
342 Ga0207641_10000191 3300026088 Bacteria 84147
343 Ga0207641_10036509 3300026088 Bacteria 4102
344 Ga0207641_10090143 3300026088 Bacteria 2680
345 Ga0207641_10149590 3300026088 Bacteria 2114
346 Ga0207641_10492058 3300026088 Unclassified 1190
347 Ga0207648_10000215 3300026089 Bacteria 62218
348 Ga0207648_10017931 3300026089 Bacteria 6420
349 Ga0207648_10024560 3300026089 Bacteria 5378
350 Ga0207648_10087264 3300026089 Bacteria 2723
351 Ga0207648_10276650 3300026089 Bacteria 1501
352 Ga0207676_10012109 3300026095 Bacteria 6174
353 Ga0207676_10040676 3300026095 Bacteria 3563
354 Ga0207676_10106346 3300026095 Bacteria 2338
355 Ga0207676_10364694 3300026095 Bacteria 1340
356 Ga0207674_10040005 3300026116 Unclassified 4858
357 Ga0207674_10082294 3300026116 Unclassified 3220
358 Ga0207674_10098421 3300026116 Bacteria 2908
359 Ga0207674_10145598 3300026116 Bacteria 2328
360 Ga0207674_10176088 3300026116 Bacteria 2091
361 Ga0207674_10179725 3300026116 Bacteria 2067
362 Ga0207674_10481643 3300026116 Unclassified 1199
363 Ga0207675_100004960 3300026118 Bacteria 12829
364 Ga0207675_100017294 3300026118 Bacteria 6732
365 Ga0207675_100111401 3300026118 Bacteria 2582
366 Ga0207675_100184997 3300026118 Bacteria 1996
367 Ga0207675_100411537 3300026118 Bacteria 1334
368 Ga0207675_100695365 3300026118 Unclassified 1025
369 Ga0207683_10012857 3300026121 Bacteria 7144
370 Ga0207683_10172343 3300026121 Bacteria 1960
371 Ga0207698_10004047 3300026142 Bacteria 8902
372 Ga0207698_10485197 3300026142 Bacteria 1200
373 Ga0207698_10664483 3300026142 Unclassified 1034
374 Ga0207698_10722272 3300026142 Unclassified 993
375 Ga0207698_11119148 3300026142 Unclassified 800
376 Ga0207428_10047741 3300027907 Unclassified 3437
377 Ga0207428_10255497 3300027907 Bacteria 1306
378 Ga0268265_10013946 3300028380 Bacteria 5472
379 Ga0268265_10742004 3300028380 Bacteria 952
380 Ga0268265_10873383 3300028380 Bacteria 881
381 Ga0268265_10873622 3300028380 Unclassified 881
382 Ga0268264_10064149 3300028381 Bacteria 3091
383 Ga0268264_10066291 3300028381 Bacteria 3044
384 Ga0268264_10168390 3300028381 Bacteria 1979
385 Ga0307513_10085521 3300031456 Bacteria 3236
386 Ga0307508_10000485 3300031616 Bacteria 47975
387 Ga0307406_10133538 3300031901 Bacteria 1746
388 Ga0307407_10645629 3300031903 Bacteria 792
389 Ga0307414_10114213 3300032004 Unclassified 2063
390 Ga0307414_10119580 3300032004 Bacteria 2023
391 Ga0307414_10397596 3300032004 Bacteria 1196
392 Ga0307414_10939669 3300032004 Bacteria 794
393 Ga0373937_0107016 3300036401 Bacteria 2600
394 Ga0395898_0583844 3300037466 Unclassified 1060
395 Ga0436365_0070052 3300039437 Bacteria 17912
396 Ga0451793_1596930 3300041452 Bacteria 1007
397 Ga0451793_1932283 3300041452 Bacteria 913
398 Ga0451807_0861839 3300041486 Bacteria 1348
399 Ga0451807_1197294 3300041486 Bacteria 4850
400 Ga0451839_1408564 3300041496 Bacteria 1373
401 Ga0439457_016163 3300042014 Bacteria 1664
402 Ga0439435_0024907 3300042436 Bacteria 1583
403 Ga0439444_0020881 3300042437 Bacteria 1156
404 Ga0466972_0000051 3300044658 Bacteria 114011
405 Ga0466972_0110952 3300044658 Bacteria 1296
406 Ga0453683_0034489 3300044673 Bacteria 3191
407 Ga0453683_0467958 3300044673 Unclassified 816
408 Ga0466961_0061914 3300044693 Bacteria 2378
409 Ga0453684_0024719 3300044712 Bacteria 8759
410 Ga0453684_0641773 3300044712 Unclassified 1159
411 Ga0453684_0868574 3300044712 Bacteria 968
412 Ga0466968_0090315 3300044735 Unclassified 1356
413 Ga0466970_0000446 3300044765 Bacteria 20265
414 Ga0466957_0615957 3300044842 Unclassified 761
415 Ga0451576_0000003 3300045051 Bacteria 1550573
416 Ga0495638_0165549 3300046460 Bacteria 1272
417 Ga0495653_0214337 3300046463 Bacteria 1299
418 Ga0495650_0017829 3300046471 Unclassified 3548
419 Ga0495650_0056309 3300046471 Bacteria 1596
420 Ga0495643_0016687 3300046522 Bacteria 4311
421 Ga0495672_0025247 3300047320 Bacteria 3808
422 Ga0495686_0009042 3300047472 Bacteria 7229
423 Ga0495686_0051219 3300047472 Bacteria 2591
424 Ga0496110_0153746 3300048913 Bacteria 2084
425 Ga0496114_0733506 3300048917 Unclassified 865
426 Ga0501031_0027403 3300049568 Bacteria 3715
427 Ga0501031_0364483 3300049568 Unclassified 935
428 Ga0501032_0001383 3300049569 Bacteria 19257
429 Ga0501032_0271464 3300049569 Bacteria 1099
430 Ga0501033_0072440 3300049570 Bacteria 2530
431 Ga0501034_0013707 3300049571 Bacteria 8336
432 Ga0501034_0613304 3300049571 Bacteria 992
433 Ga0501036_0004076 3300049572 Bacteria 11752
434 Ga0501036_0064765 3300049572 Bacteria 3093
435 Ga0501037_0089565 3300049573 Unclassified 2226
436 Ga0501038_0004139 3300049574 Bacteria 13498
437 Ga0501038_0004606 3300049574 Bacteria 12825
438 Ga0501039_0022527 3300049575 Unclassified 4835
439 Ga0501039_0473713 3300049575 Unclassified 983
440 Ga0501042_0280733 3300049578 Unclassified 1203
441 Ga0501043_0013799 3300049579 Bacteria 6323
442 Ga0501043_0050429 3300049579 Bacteria 3271
443 Ga0501046_0001757 3300049580 Bacteria 20707
444 Ga0501047_0009585 3300049581 Bacteria 9153
445 Ga0501067_0121879 3300049583 Bacteria 1451
446 Ga0501070_0026062 3300049586 Bacteria 4905
447 Ga0501070_0395575 3300049586 Bacteria 1118
448 Ga0501072_0094563 3300049588 Bacteria 2375
449 Ga0501073_0005376 3300049589 Bacteria 9594
450 Ga0501073_0164394 3300049589 Unclassified 1537
451 Ga0501074_0014526 3300049590 Bacteria 5729
452 Ga0501077_0135022 3300049593 Unclassified 1565
453 Ga0501198_020054 3300049649 Bacteria 1057
454 Ga0501242_005604 3300049674 Unclassified 1417
455 Ga0501253_036898 3300049683 Unclassified 965
456 Ga0501257_016769 3300049686 Unclassified 1701
457 Ga0501080_0490384 3300049742 Bacteria 1099
458 Ga0501080_0651921 3300049742 Unclassified 931
459 Ga0501083_0007408 3300049744 Bacteria 7784
460 Ga0501035_0020652 3300049822 Bacteria 6051
461 Ga0501035_0125488 3300049822 Bacteria 2241
462 Ga0501035_0158694 3300049822 Unclassified 1959
463 Ga0501035_0501382 3300049822 Bacteria 999
464 Ga0501044_0006319 3300049823 Bacteria 13103
465 Ga0501044_0158560 3300049823 Unclassified 2241
466 nmdc:mga0k408_225668_c1 3300050493 Bacteria 1118
467 nmdc:mga09592_12271_c1 3300050508 Bacteria 6975
468 nmdc:mga09592_181168_c1 3300050508 Bacteria 1823
469 nmdc:mga0qj67_79287_c1 3300050509 Unclassified 2630
470 nmdc:mga06r32_235993_c1 3300050510 Bacteria 1816
471 nmdc:mga06r32_285887_c1 3300050510 Bacteria 1636
472 nmdc:mga08y16_34985_c1 3300050511 Bacteria 5278
473 nmdc:mga08y16_390267_c1 3300050511 Bacteria 1426
474 Ga0500568_0000909 3300053139 Bacteria 20440
475 Ga0500611_000001 3300053727 Bacteria 385744
476 Ga0501084_0042651 3300054114 Bacteria 3795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0061914 Ga0466961_0061914_1787_2344 185
2 3300041452 Ga0451793_1596930 Ga0451793_1596930_170_787 204
3 3300041452 Ga0451793_1932283 Ga0451793_1932283_162_860 207
4 3300013297 Ga0157378_10014689 Ga0157378_100146893 209
5 3300049572 Ga0501036_0064765 Ga0501036_0064765_107_775 209
6 3300049573 Ga0501037_0089565 Ga0501037_0089565_1038_1706 209
7 3300049574 Ga0501038_0004606 Ga0501038_0004606_1263_1931 209
8 3300049575 Ga0501039_0022527 Ga0501039_0022527_3180_3848 209
9 3300049579 Ga0501043_0013799 Ga0501043_0013799_4281_4949 209
10 3300049589 Ga0501073_0164394 Ga0501073_0164394_400_1068 209
11 3300049742 Ga0501080_0490384 Ga0501080_0490384_14_682 209
12 3300049823 Ga0501044_0158560 Ga0501044_0158560_1534_2202 209
13 3300013102 Ga0157371_10351640 Ga0157371_103516402 210
14 3300021384 Ga0213876_10046742 Ga0213876_100467422 214
15 3300039437 Ga0436365_0070052 Ga0436365_0070052_4449_5117 214
16 3300009176 Ga0105242_10068405 Ga0105242_100684052 215
17 3300009553 Ga0105249_10119949 Ga0105249_101199493 215
18 3300011119 Ga0105246_10122384 Ga0105246_101223842 215
19 3300013296 Ga0157374_10134044 Ga0157374_101340443 215
20 3300014969 Ga0157376_10391335 Ga0157376_103913352 215
21 3300026142 Ga0207698_11119148 Ga0207698_111191481 216
22 3300044712 Ga0453684_0641773 Ga0453684_0641773_379_1029 216
23 3300005328 Ga0070676_10212359 Ga0070676_102123592 218
24 3300005333 Ga0070677_10026720 Ga0070677_100267201 218
25 3300005356 Ga0070674_100349733 Ga0070674_1003497332 218
26 3300005364 Ga0070673_100570356 Ga0070673_1005703561 218
27 3300005459 Ga0068867_100029629 Ga0068867_1000296293 218
28 3300005543 Ga0070672_100062607 Ga0070672_1000626072 218
29 3300005719 Ga0068861_100363351 Ga0068861_1003633512 218
30 3300013306 Ga0163162_10587592 Ga0163162_105875922 218
31 3300014326 Ga0157380_10046227 Ga0157380_100462271 218
32 3300025315 Ga0207697_10032830 Ga0207697_100328302 218
33 3300025893 Ga0207682_10006837 Ga0207682_100068374 218
34 3300025907 Ga0207645_10364241 Ga0207645_103642411 218
35 3300025937 Ga0207669_10302526 Ga0207669_103025262 218
36 3300025940 Ga0207691_10005099 Ga0207691_100050997 218
37 3300026089 Ga0207648_10087264 Ga0207648_100872642 218
38 3300026118 Ga0207675_100184997 Ga0207675_1001849972 218
39 3300026121 Ga0207683_10172343 Ga0207683_101723431 218
40 3300005353 Ga0070669_100913142 Ga0070669_1009131421 219
41 3300045051 Ga0451576_0000003 Ga0451576_0000003_1183445_1184107 219
42 3300003320 rootH2_10022400 rootH2_1002240011 220
43 3300003323 rootH1_10027085 rootH1_100270852 220
44 3300005337 Ga0070682_100027529 Ga0070682_1000275295 220
45 3300005563 Ga0068855_100081378 Ga0068855_1000813784 220
46 3300006237 Ga0097621_100006082 Ga0097621_1000060828 220
47 3300006358 Ga0068871_100096453 Ga0068871_1000964532 220
48 3300006881 Ga0068865_100192937 Ga0068865_1001929372 220
49 3300009093 Ga0105240_10086895 Ga0105240_100868952 220
50 3300009176 Ga0105242_10224628 Ga0105242_102246282 220
51 3300009545 Ga0105237_10028528 Ga0105237_100285283 220
52 3300009551 Ga0105238_10664477 Ga0105238_106644771 220
53 3300010375 Ga0105239_10000925 Ga0105239_1000092522 220
54 3300013297 Ga0157378_10025243 Ga0157378_100252434 220
55 3300013306 Ga0163162_10069229 Ga0163162_100692293 220
56 3300013307 Ga0157372_10004419 Ga0157372_1000441914 220
57 3300013308 Ga0157375_11374360 Ga0157375_113743601 220
58 3300014326 Ga0157380_10774212 Ga0157380_107742121 220
59 3300014969 Ga0157376_11066100 Ga0157376_110661002 220
60 3300025914 Ga0207671_10016185 Ga0207671_100161853 220
61 3300025924 Ga0207694_10449477 Ga0207694_104494772 220
62 3300025949 Ga0207667_10017629 Ga0207667_100176292 220
63 3300026089 Ga0207648_10276650 Ga0207648_102766502 220
64 3300026116 Ga0207674_10179725 Ga0207674_101797252 220
65 3300031616 Ga0307508_10000485 Ga0307508_1000048529 220
66 3300044842 Ga0466957_0615957 Ga0466957_0615957_87_749 220
67 3300046471 Ga0495650_0056309 Ga0495650_0056309_372_1034 220
68 3300048913 Ga0496110_0153746 Ga0496110_0153746_410_1072 220
69 3300048917 Ga0496114_0733506 Ga0496114_0733506_23_685 220
70 3300002077 JGI24744J21845_10021793 JGI24744J21845_100217932 221
71 3300002459 JGI24751J29686_10000913 JGI24751J29686_100009133 221
72 3300003323 rootH1_10262097 rootH1_102620973 221
73 3300005289 Ga0065704_10088239 Ga0065704_100882393 221
74 3300005289 Ga0065704_10259550 Ga0065704_102595502 221
75 3300005290 Ga0065712_10000884 Ga0065712_100008844 221
76 3300005293 Ga0065715_10098396 Ga0065715_100983963 221
77 3300005295 Ga0065707_10250581 Ga0065707_102505811 221
78 3300005327 Ga0070658_10287944 Ga0070658_102879442 221
79 3300005327 Ga0070658_10412318 Ga0070658_104123181 221
80 3300005328 Ga0070676_10053959 Ga0070676_100539592 221
81 3300005329 Ga0070683_100269753 Ga0070683_1002697531 221
82 3300005330 Ga0070690_100170067 Ga0070690_1001700672 221
83 3300005331 Ga0070670_100120224 Ga0070670_1001202242 221
84 3300005331 Ga0070670_100212109 Ga0070670_1002121092 221
85 3300005333 Ga0070677_10066650 Ga0070677_100666502 221
86 3300005334 Ga0068869_100002957 Ga0068869_1000029574 221
87 3300005334 Ga0068869_100025453 Ga0068869_1000254532 221
88 3300005334 Ga0068869_100137792 Ga0068869_1001377922 221
89 3300005336 Ga0070680_100039589 Ga0070680_1000395893 221
90 3300005336 Ga0070680_100080612 Ga0070680_1000806123 221
91 3300005337 Ga0070682_100051999 Ga0070682_1000519992 221
92 3300005337 Ga0070682_100620944 Ga0070682_1006209441 221
93 3300005338 Ga0068868_100135016 Ga0068868_1001350162 221
94 3300005338 Ga0068868_100294804 Ga0068868_1002948042 221
95 3300005339 Ga0070660_100131668 Ga0070660_1001316682 221
96 3300005339 Ga0070660_100196720 Ga0070660_1001967201 221
97 3300005340 Ga0070689_100042649 Ga0070689_1000426492 221
98 3300005340 Ga0070689_100085946 Ga0070689_1000859463 221
99 3300005343 Ga0070687_100183924 Ga0070687_1001839242 221
100 3300005344 Ga0070661_100012545 Ga0070661_1000125453 221
101 3300005344 Ga0070661_100369352 Ga0070661_1003693521 221
102 3300005347 Ga0070668_100083396 Ga0070668_1000833962 221
103 3300005353 Ga0070669_100016070 Ga0070669_1000160702 221
104 3300005353 Ga0070669_100050457 Ga0070669_1000504572 221
105 3300005353 Ga0070669_100119272 Ga0070669_1001192722 221
106 3300005353 Ga0070669_100181249 Ga0070669_1001812493 221
107 3300005354 Ga0070675_100079672 Ga0070675_1000796722 221
108 3300005354 Ga0070675_100107633 Ga0070675_1001076332 221
109 3300005354 Ga0070675_100114969 Ga0070675_1001149692 221
110 3300005354 Ga0070675_100462759 Ga0070675_1004627591 221
111 3300005355 Ga0070671_100118214 Ga0070671_1001182142 221
112 3300005355 Ga0070671_100295866 Ga0070671_1002958662 221
113 3300005356 Ga0070674_100122531 Ga0070674_1001225312 221
114 3300005356 Ga0070674_100301608 Ga0070674_1003016082 221
115 3300005356 Ga0070674_100384225 Ga0070674_1003842252 221
116 3300005356 Ga0070674_100647020 Ga0070674_1006470201 221
117 3300005364 Ga0070673_100071030 Ga0070673_1000710302 221
118 3300005364 Ga0070673_100101368 Ga0070673_1001013682 221
119 3300005364 Ga0070673_100231442 Ga0070673_1002314422 221
120 3300005365 Ga0070688_100008629 Ga0070688_1000086292 221
121 3300005365 Ga0070688_100021027 Ga0070688_1000210273 221
122 3300005365 Ga0070688_100024073 Ga0070688_1000240732 221
123 3300005366 Ga0070659_100011442 Ga0070659_1000114424 221
124 3300005366 Ga0070659_100047005 Ga0070659_1000470054 221
125 3300005367 Ga0070667_100086985 Ga0070667_1000869852 221
126 3300005367 Ga0070667_100198719 Ga0070667_1001987192 221
127 3300005367 Ga0070667_100253186 Ga0070667_1002531862 221
128 3300005367 Ga0070667_100340944 Ga0070667_1003409443 221
129 3300005367 Ga0070667_100516924 Ga0070667_1005169242 221
130 3300005367 Ga0070667_100582298 Ga0070667_1005822981 221
131 3300005445 Ga0070708_100466587 Ga0070708_1004665872 221
132 3300005457 Ga0070662_100075813 Ga0070662_1000758132 221
133 3300005458 Ga0070681_10178456 Ga0070681_101784561 221
134 3300005458 Ga0070681_10289231 Ga0070681_102892312 221
135 3300005459 Ga0068867_100005971 Ga0068867_1000059712 221
136 3300005459 Ga0068867_100056241 Ga0068867_1000562412 221
137 3300005459 Ga0068867_100133154 Ga0068867_1001331542 221
138 3300005459 Ga0068867_100426581 Ga0068867_1004265811 221
139 3300005466 Ga0070685_10025184 Ga0070685_100251843 221
140 3300005471 Ga0070698_100000261 Ga0070698_10000026113 221
141 3300005471 Ga0070698_100001837 Ga0070698_10000183719 221
142 3300005471 Ga0070698_100124945 Ga0070698_1001249451 221
143 3300005518 Ga0070699_100532647 Ga0070699_1005326471 221
144 3300005530 Ga0070679_100155068 Ga0070679_1001550682 221
145 3300005539 Ga0068853_100019279 Ga0068853_1000192792 221
146 3300005539 Ga0068853_100164560 Ga0068853_1001645603 221
147 3300005539 Ga0068853_100513530 Ga0068853_1005135302 221
148 3300005539 Ga0068853_100621868 Ga0068853_1006218682 221
149 3300005543 Ga0070672_100044903 Ga0070672_1000449032 221
150 3300005543 Ga0070672_100267622 Ga0070672_1002676222 221
151 3300005543 Ga0070672_100307799 Ga0070672_1003077992 221
152 3300005543 Ga0070672_100839616 Ga0070672_1008396161 221
153 3300005544 Ga0070686_100182150 Ga0070686_1001821502 221
154 3300005544 Ga0070686_100389654 Ga0070686_1003896541 221
155 3300005544 Ga0070686_100569688 Ga0070686_1005696881 221
156 3300005549 Ga0070704_100738994 Ga0070704_1007389941 221
157 3300005563 Ga0068855_100278449 Ga0068855_1002784493 221
158 3300005577 Ga0068857_100017703 Ga0068857_1000177032 221
159 3300005577 Ga0068857_100131887 Ga0068857_1001318873 221
160 3300005577 Ga0068857_100141652 Ga0068857_1001416522 221
161 3300005615 Ga0070702_100062391 Ga0070702_1000623911 221
162 3300005615 Ga0070702_100596394 Ga0070702_1005963941 221
163 3300005617 Ga0068859_100021136 Ga0068859_1000211365 221
164 3300005617 Ga0068859_100022740 Ga0068859_1000227403 221
165 3300005617 Ga0068859_100034740 Ga0068859_1000347402 221
166 3300005617 Ga0068859_100065600 Ga0068859_1000656003 221
167 3300005617 Ga0068859_100069690 Ga0068859_1000696902 221
168 3300005617 Ga0068859_100070594 Ga0068859_1000705943 221
169 3300005617 Ga0068859_100166805 Ga0068859_1001668052 221
170 3300005617 Ga0068859_100608624 Ga0068859_1006086241 221
171 3300005617 Ga0068859_100747263 Ga0068859_1007472632 221
172 3300005618 Ga0068864_100050002 Ga0068864_1000500025 221
173 3300005618 Ga0068864_100058196 Ga0068864_1000581964 221
174 3300005618 Ga0068864_100104543 Ga0068864_1001045433 221
175 3300005618 Ga0068864_100471507 Ga0068864_1004715073 221
176 3300005718 Ga0068866_10005820 Ga0068866_100058205 221
177 3300005718 Ga0068866_10090180 Ga0068866_100901802 221
178 3300005719 Ga0068861_100005004 Ga0068861_1000050042 221
179 3300005834 Ga0068851_10293377 Ga0068851_102933771 221
180 3300005840 Ga0068870_10016297 Ga0068870_100162972 221
181 3300005840 Ga0068870_10045044 Ga0068870_100450442 221
182 3300005840 Ga0068870_10345535 Ga0068870_103455351 221
183 3300005841 Ga0068863_100117548 Ga0068863_1001175483 221
184 3300005841 Ga0068863_100119489 Ga0068863_1001194892 221
185 3300005841 Ga0068863_100484121 Ga0068863_1004841211 221
186 3300005841 Ga0068863_100553977 Ga0068863_1005539771 221
187 3300005841 Ga0068863_100562645 Ga0068863_1005626451 221
188 3300005842 Ga0068858_100148576 Ga0068858_1001485761 221
189 3300005843 Ga0068860_100012840 Ga0068860_1000128406 221
190 3300005843 Ga0068860_100039297 Ga0068860_1000392973 221
191 3300005843 Ga0068860_100057139 Ga0068860_1000571392 221
192 3300005843 Ga0068860_100060173 Ga0068860_1000601733 221
193 3300005843 Ga0068860_100142584 Ga0068860_1001425843 221
194 3300005843 Ga0068860_100567210 Ga0068860_1005672102 221
195 3300005843 Ga0068860_100753250 Ga0068860_1007532502 221
196 3300005844 Ga0068862_100013758 Ga0068862_1000137586 221
197 3300005844 Ga0068862_100148981 Ga0068862_1001489812 221
198 3300005844 Ga0068862_100267779 Ga0068862_1002677792 221
199 3300005844 Ga0068862_101229989 Ga0068862_1012299891 221
200 3300006195 Ga0075366_10022754 Ga0075366_100227543 221
201 3300006237 Ga0097621_100054446 Ga0097621_1000544462 221
202 3300006358 Ga0068871_100035984 Ga0068871_1000359843 221
203 3300006358 Ga0068871_100043979 Ga0068871_1000439793 221
204 3300006358 Ga0068871_100286822 Ga0068871_1002868221 221
205 3300006358 Ga0068871_100559673 Ga0068871_1005596732 221
206 3300006844 Ga0075428_100040312 Ga0075428_1000403122 221
207 3300006844 Ga0075428_100289044 Ga0075428_1002890442 221
208 3300006846 Ga0075430_100004078 Ga0075430_1000040789 221
209 3300006846 Ga0075430_100040034 Ga0075430_1000400344 221
210 3300006847 Ga0075431_100038487 Ga0075431_1000384875 221
211 3300006847 Ga0075431_100455847 Ga0075431_1004558472 221
212 3300006871 Ga0075434_100437685 Ga0075434_1004376852 221
213 3300006880 Ga0075429_100003978 Ga0075429_1000039789 221
214 3300006881 Ga0068865_100031978 Ga0068865_1000319782 221
215 3300006931 Ga0097620_100021136 Ga0097620_1000211365 221
216 3300006931 Ga0097620_100022740 Ga0097620_1000227403 221
217 3300006931 Ga0097620_100034740 Ga0097620_1000347405 221
218 3300006931 Ga0097620_100065601 Ga0097620_1000656013 221
219 3300006931 Ga0097620_100069689 Ga0097620_1000696892 221
220 3300006931 Ga0097620_100070595 Ga0097620_1000705953 221
221 3300006931 Ga0097620_100166807 Ga0097620_1001668072 221
222 3300006931 Ga0097620_100608590 Ga0097620_1006085901 221
223 3300006931 Ga0097620_100747370 Ga0097620_1007473702 221
224 3300009094 Ga0111539_10043647 Ga0111539_100436472 221
225 3300009094 Ga0111539_10068970 Ga0111539_100689702 221
226 3300009094 Ga0111539_10477733 Ga0111539_104777332 221
227 3300009094 Ga0111539_10505865 Ga0111539_105058652 221
228 3300009094 Ga0111539_10773376 Ga0111539_107733761 221
229 3300009101 Ga0105247_10010045 Ga0105247_100100453 221
230 3300009176 Ga0105242_10052333 Ga0105242_100523331 221
231 3300009176 Ga0105242_10083884 Ga0105242_100838842 221
232 3300009176 Ga0105242_10139684 Ga0105242_101396843 221
233 3300009176 Ga0105242_10515791 Ga0105242_105157911 221
234 3300009176 Ga0105242_10519985 Ga0105242_105199852 221
235 3300009176 Ga0105242_10732668 Ga0105242_107326682 221
236 3300009176 Ga0105242_11094894 Ga0105242_110948941 221
237 3300009553 Ga0105249_10001666 Ga0105249_100016666 221
238 3300009553 Ga0105249_10002272 Ga0105249_100022726 221
239 3300009553 Ga0105249_10011342 Ga0105249_100113423 221
240 3300009553 Ga0105249_10034962 Ga0105249_100349624 221
241 3300009553 Ga0105249_10055195 Ga0105249_100551952 221
242 3300009553 Ga0105249_10085345 Ga0105249_100853452 221
243 3300010375 Ga0105239_10173973 Ga0105239_101739731 221
244 3300011119 Ga0105246_10183632 Ga0105246_101836322 221
245 3300013100 Ga0157373_10050446 Ga0157373_100504463 221
246 3300013102 Ga0157371_10004778 Ga0157371_100047786 221
247 3300013102 Ga0157371_10008816 Ga0157371_100088168 221
248 3300013102 Ga0157371_10024047 Ga0157371_100240475 221
249 3300013102 Ga0157371_10035183 Ga0157371_100351832 221
250 3300013102 Ga0157371_10102061 Ga0157371_101020613 221
251 3300013102 Ga0157371_10127195 Ga0157371_101271952 221
252 3300013104 Ga0157370_10065454 Ga0157370_100654542 221
253 3300013104 Ga0157370_10340323 Ga0157370_103403231 221
254 3300013104 Ga0157370_10871678 Ga0157370_108716781 221
255 3300013105 Ga0157369_10015498 Ga0157369_100154987 221
256 3300013105 Ga0157369_10248162 Ga0157369_102481622 221
257 3300013105 Ga0157369_10597326 Ga0157369_105973262 221
258 3300013296 Ga0157374_10005808 Ga0157374_100058085 221
259 3300013296 Ga0157374_10166663 Ga0157374_101666632 221
260 3300013297 Ga0157378_10123364 Ga0157378_101233643 221
261 3300013297 Ga0157378_10714462 Ga0157378_107144622 221
262 3300013306 Ga0163162_10067751 Ga0163162_100677513 221
263 3300013306 Ga0163162_10110307 Ga0163162_101103071 221
264 3300013306 Ga0163162_10144004 Ga0163162_101440042 221
265 3300013306 Ga0163162_10381977 Ga0163162_103819772 221
266 3300013306 Ga0163162_10659985 Ga0163162_106599851 221
267 3300013306 Ga0163162_10676285 Ga0163162_106762851 221
268 3300013307 Ga0157372_10029858 Ga0157372_100298585 221
269 3300013307 Ga0157372_10034626 Ga0157372_100346261 221
270 3300013307 Ga0157372_10112922 Ga0157372_101129222 221
271 3300013307 Ga0157372_10137968 Ga0157372_101379684 221
272 3300013307 Ga0157372_10568654 Ga0157372_105686542 221
273 3300013307 Ga0157372_10749341 Ga0157372_107493412 221
274 3300013307 Ga0157372_10848867 Ga0157372_108488672 221
275 3300013307 Ga0157372_11479268 Ga0157372_114792681 221
276 3300013308 Ga0157375_10097678 Ga0157375_100976783 221
277 3300013308 Ga0157375_10259455 Ga0157375_102594552 221
278 3300013308 Ga0157375_10465052 Ga0157375_104650522 221
279 3300013308 Ga0157375_10651147 Ga0157375_106511472 221
280 3300014325 Ga0163163_10001496 Ga0163163_1000149614 221
281 3300014325 Ga0163163_10004119 Ga0163163_100041197 221
282 3300014325 Ga0163163_10635653 Ga0163163_106356532 221
283 3300014326 Ga0157380_10001771 Ga0157380_100017713 221
284 3300014326 Ga0157380_10010330 Ga0157380_100103305 221
285 3300014326 Ga0157380_10111724 Ga0157380_101117242 221
286 3300014326 Ga0157380_10127212 Ga0157380_101272122 221
287 3300014326 Ga0157380_10157210 Ga0157380_101572102 221
288 3300014326 Ga0157380_10182512 Ga0157380_101825122 221
289 3300014326 Ga0157380_10603420 Ga0157380_106034202 221
290 3300014326 Ga0157380_11047453 Ga0157380_110474531 221
291 3300014745 Ga0157377_10010873 Ga0157377_100108733 221
292 3300014745 Ga0157377_10057471 Ga0157377_100574712 221
293 3300014745 Ga0157377_10085826 Ga0157377_100858262 221
294 3300014968 Ga0157379_10062889 Ga0157379_100628893 221
295 3300014969 Ga0157376_10079613 Ga0157376_100796133 221
296 3300017792 Ga0163161_10171109 Ga0163161_101711092 221
297 3300025893 Ga0207682_10055966 Ga0207682_100559661 221
298 3300025899 Ga0207642_10258099 Ga0207642_102580992 221
299 3300025900 Ga0207710_10065173 Ga0207710_100651732 221
300 3300025901 Ga0207688_10009074 Ga0207688_100090745 221
301 3300025903 Ga0207680_10022687 Ga0207680_100226872 221
302 3300025903 Ga0207680_10079687 Ga0207680_100796872 221
303 3300025904 Ga0207647_10000064 Ga0207647_1000006423 221
304 3300025907 Ga0207645_10000352 Ga0207645_1000035217 221
305 3300025907 Ga0207645_10009765 Ga0207645_100097652 221
306 3300025908 Ga0207643_10009154 Ga0207643_100091543 221
307 3300025909 Ga0207705_10690766 Ga0207705_106907661 221
308 3300025912 Ga0207707_10088343 Ga0207707_100883431 221
309 3300025912 Ga0207707_10181623 Ga0207707_101816232 221
310 3300025917 Ga0207660_10096729 Ga0207660_100967293 221
311 3300025918 Ga0207662_10025261 Ga0207662_100252612 221
312 3300025919 Ga0207657_10033042 Ga0207657_100330423 221
313 3300025919 Ga0207657_10238817 Ga0207657_102388172 221
314 3300025923 Ga0207681_10050070 Ga0207681_100500702 221
315 3300025923 Ga0207681_10159766 Ga0207681_101597662 221
316 3300025923 Ga0207681_10166842 Ga0207681_101668422 221
317 3300025923 Ga0207681_10168997 Ga0207681_101689972 221
318 3300025925 Ga0207650_10198611 Ga0207650_101986112 221
319 3300025925 Ga0207650_10263579 Ga0207650_102635792 221
320 3300025925 Ga0207650_10558413 Ga0207650_105584132 221
321 3300025926 Ga0207659_10077932 Ga0207659_100779323 221
322 3300025926 Ga0207659_10142030 Ga0207659_101420302 221
323 3300025926 Ga0207659_10181285 Ga0207659_101812851 221
324 3300025926 Ga0207659_10863688 Ga0207659_108636881 221
325 3300025931 Ga0207644_10142734 Ga0207644_101427343 221
326 3300025932 Ga0207690_10015227 Ga0207690_100152274 221
327 3300025932 Ga0207690_10141315 Ga0207690_101413153 221
328 3300025933 Ga0207706_10034136 Ga0207706_100341362 221
329 3300025933 Ga0207706_10041727 Ga0207706_100417272 221
330 3300025934 Ga0207686_10002356 Ga0207686_100023562 221
331 3300025934 Ga0207686_10007345 Ga0207686_100073455 221
332 3300025934 Ga0207686_10058679 Ga0207686_100586792 221
333 3300025934 Ga0207686_10073095 Ga0207686_100730952 221
334 3300025936 Ga0207670_10009894 Ga0207670_100098942 221
335 3300025936 Ga0207670_10072809 Ga0207670_100728093 221
336 3300025937 Ga0207669_10069359 Ga0207669_100693592 221
337 3300025940 Ga0207691_10020461 Ga0207691_100204612 221
338 3300025940 Ga0207691_10039767 Ga0207691_100397673 221
339 3300025940 Ga0207691_10162418 Ga0207691_101624182 221
340 3300025942 Ga0207689_10000885 Ga0207689_1000088518 221
341 3300025942 Ga0207689_10003324 Ga0207689_1000332412 221
342 3300025942 Ga0207689_10011925 Ga0207689_100119252 221
343 3300025942 Ga0207689_10014167 Ga0207689_100141674 221
344 3300025942 Ga0207689_10018283 Ga0207689_100182836 221
345 3300025944 Ga0207661_10321750 Ga0207661_103217502 221
346 3300025944 Ga0207661_10631596 Ga0207661_106315961 221
347 3300025949 Ga0207667_10206295 Ga0207667_102062953 221
348 3300025960 Ga0207651_10162028 Ga0207651_101620282 221
349 3300025961 Ga0207712_10001290 Ga0207712_100012908 221
350 3300025961 Ga0207712_10002816 Ga0207712_100028163 221
351 3300025961 Ga0207712_10005397 Ga0207712_100053973 221
352 3300025961 Ga0207712_10078631 Ga0207712_100786312 221
353 3300025961 Ga0207712_10223209 Ga0207712_102232092 221
354 3300025961 Ga0207712_10526604 Ga0207712_105266042 221
355 3300025972 Ga0207668_10026945 Ga0207668_100269452 221
356 3300025981 Ga0207640_10822898 Ga0207640_108228981 221
357 3300025986 Ga0207658_10018627 Ga0207658_100186276 221
358 3300025986 Ga0207658_10155752 Ga0207658_101557522 221
359 3300025986 Ga0207658_10328347 Ga0207658_103283473 221
360 3300025986 Ga0207658_10955225 Ga0207658_109552251 221
361 3300026023 Ga0207677_10068128 Ga0207677_100681282 221
362 3300026023 Ga0207677_10191586 Ga0207677_101915862 221
363 3300026023 Ga0207677_10265494 Ga0207677_102654942 221
364 3300026023 Ga0207677_10401829 Ga0207677_104018292 221
365 3300026035 Ga0207703_10056332 Ga0207703_100563322 221
366 3300026041 Ga0207639_10145648 Ga0207639_101456482 221
367 3300026088 Ga0207641_10000191 Ga0207641_100001912 221
368 3300026088 Ga0207641_10036509 Ga0207641_100365091 221
369 3300026088 Ga0207641_10090143 Ga0207641_100901433 221
370 3300026088 Ga0207641_10149590 Ga0207641_101495903 221
371 3300026088 Ga0207641_10492058 Ga0207641_104920581 221
372 3300026089 Ga0207648_10000215 Ga0207648_1000021549 221
373 3300026089 Ga0207648_10017931 Ga0207648_100179311 221
374 3300026089 Ga0207648_10024560 Ga0207648_100245603 221
375 3300026095 Ga0207676_10012109 Ga0207676_100121094 221
376 3300026095 Ga0207676_10040676 Ga0207676_100406762 221
377 3300026095 Ga0207676_10106346 Ga0207676_101063462 221
378 3300026095 Ga0207676_10364694 Ga0207676_103646942 221
379 3300026116 Ga0207674_10040005 Ga0207674_100400052 221
380 3300026116 Ga0207674_10082294 Ga0207674_100822942 221
381 3300026116 Ga0207674_10098421 Ga0207674_100984213 221
382 3300026116 Ga0207674_10145598 Ga0207674_101455983 221
383 3300026116 Ga0207674_10176088 Ga0207674_101760882 221
384 3300026116 Ga0207674_10481643 Ga0207674_104816431 221
385 3300026118 Ga0207675_100004960 Ga0207675_1000049605 221
386 3300026118 Ga0207675_100017294 Ga0207675_1000172944 221
387 3300026118 Ga0207675_100111401 Ga0207675_1001114011 221
388 3300026118 Ga0207675_100411537 Ga0207675_1004115372 221
389 3300026118 Ga0207675_100695365 Ga0207675_1006953652 221
390 3300026121 Ga0207683_10012857 Ga0207683_100128575 221
391 3300026142 Ga0207698_10004047 Ga0207698_100040474 221
392 3300026142 Ga0207698_10485197 Ga0207698_104851972 221
393 3300026142 Ga0207698_10664483 Ga0207698_106644832 221
394 3300026142 Ga0207698_10722272 Ga0207698_107222722 221
395 3300027907 Ga0207428_10047741 Ga0207428_100477412 221
396 3300027907 Ga0207428_10255497 Ga0207428_102554971 221
397 3300028380 Ga0268265_10013946 Ga0268265_100139462 221
398 3300028380 Ga0268265_10742004 Ga0268265_107420042 221
399 3300028380 Ga0268265_10873383 Ga0268265_108733832 221
400 3300028380 Ga0268265_10873622 Ga0268265_108736221 221
401 3300028381 Ga0268264_10064149 Ga0268264_100641493 221
402 3300028381 Ga0268264_10066291 Ga0268264_100662912 221
403 3300028381 Ga0268264_10168390 Ga0268264_101683901 221
404 3300031456 Ga0307513_10085521 Ga0307513_100855211 221
405 3300031901 Ga0307406_10133538 Ga0307406_101335382 221
406 3300031903 Ga0307407_10645629 Ga0307407_106456291 221
407 3300032004 Ga0307414_10114213 Ga0307414_101142132 221
408 3300032004 Ga0307414_10119580 Ga0307414_101195802 221
409 3300032004 Ga0307414_10397596 Ga0307414_103975961 221
410 3300032004 Ga0307414_10939669 Ga0307414_109396691 221
411 3300036401 Ga0373937_0107016 Ga0373937_0107016_1699_2364 221
412 3300037466 Ga0395898_0583844 Ga0395898_0583844_219_887 221
413 3300041486 Ga0451807_0861839 Ga0451807_0861839_173_838 221
414 3300041486 Ga0451807_1197294 Ga0451807_1197294_1264_2037 221
415 3300041496 Ga0451839_1408564 Ga0451839_1408564_193_858 221
416 3300042014 Ga0439457_016163 Ga0439457_016163_192_866 221
417 3300042436 Ga0439435_0024907 Ga0439435_0024907_110_778 221
418 3300042437 Ga0439444_0020881 Ga0439444_0020881_291_959 221
419 3300044658 Ga0466972_0000051 Ga0466972_0000051_15535_16206 221
420 3300044658 Ga0466972_0110952 Ga0466972_0110952_113_778 221
421 3300044673 Ga0453683_0034489 Ga0453683_0034489_785_1453 221
422 3300044673 Ga0453683_0467958 Ga0453683_0467958_132_797 221
423 3300044712 Ga0453684_0024719 Ga0453684_0024719_4422_5090 221
424 3300044712 Ga0453684_0868574 Ga0453684_0868574_161_829 221
425 3300044735 Ga0466968_0090315 Ga0466968_0090315_145_816 221
426 3300044765 Ga0466970_0000446 Ga0466970_0000446_11085_11756 221
427 3300046460 Ga0495638_0165549 Ga0495638_0165549_381_1046 221
428 3300046463 Ga0495653_0214337 Ga0495653_0214337_89_754 221
429 3300046471 Ga0495650_0017829 Ga0495650_0017829_1800_2465 221
430 3300046522 Ga0495643_0016687 Ga0495643_0016687_1332_2000 221
431 3300047320 Ga0495672_0025247 Ga0495672_0025247_223_888 221
432 3300047472 Ga0495686_0009042 Ga0495686_0009042_2088_2753 221
433 3300047472 Ga0495686_0051219 Ga0495686_0051219_1552_2217 221
434 3300049568 Ga0501031_0027403 Ga0501031_0027403_540_1208 221
435 3300049568 Ga0501031_0364483 Ga0501031_0364483_82_750 221
436 3300049569 Ga0501032_0001383 Ga0501032_0001383_17214_17882 221
437 3300049569 Ga0501032_0271464 Ga0501032_0271464_188_856 221
438 3300049570 Ga0501033_0072440 Ga0501033_0072440_650_1318 221
439 3300049571 Ga0501034_0013707 Ga0501034_0013707_1104_1772 221
440 3300049571 Ga0501034_0613304 Ga0501034_0613304_70_738 221
441 3300049572 Ga0501036_0004076 Ga0501036_0004076_2572_3240 221
442 3300049574 Ga0501038_0004139 Ga0501038_0004139_7544_8212 221
443 3300049575 Ga0501039_0473713 Ga0501039_0473713_116_784 221
444 3300049578 Ga0501042_0280733 Ga0501042_0280733_139_807 221
445 3300049579 Ga0501043_0050429 Ga0501043_0050429_1327_1995 221
446 3300049580 Ga0501046_0001757 Ga0501046_0001757_4857_5525 221
447 3300049581 Ga0501047_0009585 Ga0501047_0009585_6015_6683 221
448 3300049583 Ga0501067_0121879 Ga0501067_0121879_578_1246 221
449 3300049586 Ga0501070_0026062 Ga0501070_0026062_1976_2644 221
450 3300049586 Ga0501070_0395575 Ga0501070_0395575_243_911 221
451 3300049588 Ga0501072_0094563 Ga0501072_0094563_601_1269 221
452 3300049589 Ga0501073_0005376 Ga0501073_0005376_2108_2776 221
453 3300049590 Ga0501074_0014526 Ga0501074_0014526_372_1040 221
454 3300049593 Ga0501077_0135022 Ga0501077_0135022_276_944 221
455 3300049649 Ga0501198_020054 Ga0501198_020054_326_997 221
456 3300049674 Ga0501242_005604 Ga0501242_005604_46_714 221
457 3300049683 Ga0501253_036898 Ga0501253_036898_181_852 221
458 3300049686 Ga0501257_016769 Ga0501257_016769_749_1417 221
459 3300049742 Ga0501080_0651921 Ga0501080_0651921_245_913 221
460 3300049744 Ga0501083_0007408 Ga0501083_0007408_4491_5159 221
461 3300049822 Ga0501035_0020652 Ga0501035_0020652_465_1133 221
462 3300049822 Ga0501035_0125488 Ga0501035_0125488_573_1241 221
463 3300049822 Ga0501035_0158694 Ga0501035_0158694_302_970 221
464 3300049822 Ga0501035_0501382 Ga0501035_0501382_245_913 221
465 3300049823 Ga0501044_0006319 Ga0501044_0006319_4569_5237 221
466 3300050493 nmdc:mga0k408_225668_c1 nmdc:mga0k408_225668_c1_62_730 221
467 3300050508 nmdc:mga09592_12271_c1 nmdc:mga09592_12271_c1_3469_4137 221
468 3300050508 nmdc:mga09592_181168_c1 nmdc:mga09592_181168_c1_821_1486 221
469 3300050509 nmdc:mga0qj67_79287_c1 nmdc:mga0qj67_79287_c1_148_813 221
470 3300050510 nmdc:mga06r32_235993_c1 nmdc:mga06r32_235993_c1_176_844 221
471 3300050510 nmdc:mga06r32_285887_c1 nmdc:mga06r32_285887_c1_944_1609 221
472 3300050511 nmdc:mga08y16_34985_c1 nmdc:mga08y16_34985_c1_2498_3166 221
473 3300050511 nmdc:mga08y16_390267_c1 nmdc:mga08y16_390267_c1_130_795 221
474 3300053139 Ga0500568_0000909 Ga0500568_0000909_15619_16290 221
475 3300053727 Ga0500611_000001 Ga0500611_000001_239379_240044 221
476 3300054114 Ga0501084_0042651 Ga0501084_0042651_1249_1917 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09365

DUF2461

Conserved hypothetical protein (DUF2461)

40

250

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wnb-assembly1.cif.gz_A structure of the rieske non-heme iron oxygenase sxtt with dideoxysaxitoxin bound 0.6655 82 114
6wn3-assembly1.cif.gz_C structure of the rieske non-heme iron oxygenase sxtt 0.6137 79 114
3bvt-assembly1.cif.gz_A golgi mannosidase ii d204a catalytic nucleophile mutant complex with methyl (alpha-d-mannopyranosyl)-(1->3)-s-alpha-d-mannopyranoside 0.5564 77 115
3mqz-assembly1.cif.gz_A crystal structure of conserved protein duf1054 from pink subaerial biofilm microbial leptospirillum sp. group ii uba. 0.5429 73 216
2a8e-assembly1.cif.gz_A three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204. 0.5172 22 220
ID Description Score Start End Superfamily
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5383 47 220 3.30.930.20
3mqzA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5309 72 216 3.30.930.20
af_Q2G2G7_1_204_3.30.930.20 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5155 10 214 3.30.930.20
af_P0AAY6_8_135_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.5061 47 219 3.30.1460.10
af_P0AAY6_8_135_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.4998 47 219 3.30.1460.10
ID Description Score Start End GO Terms
AF-A0A4R2WDI8-F1-model_v4 deleted 0.9825 2 220
AF-A0A838TLV8-F1-model_v4 DUF2461 domain-containing protein 0.9801 1 221
AF-A0A136LC66-F1-model_v4 deleted 0.9794 2 217
AF-A0A2N1TIC0-F1-model_v4 TIGR02453 family protein 0.9772 1 219
AF-A0A7Z9IS49-F1-model_v4 DUF2461 domain-containing protein 0.9763 1 220

Feature Viewer

pLDDT pTM Quality
95.43 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map