F451273

General Info

Members Datasets Scaffolds Average Seq Length
474 312 942 407

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2671180195|2671832662
Length 433
Sequence HQTDSHQTAPAAHRTGEGPARSFGEPAHSFGKPDHSFGELPRIISVDDHVVEPAHLWQRWLPARLRDAGPRVQRRGIGRMEHIGGGNYRQTFDEDGPQADCWVYEDLVYIHKRHVAAVGFDRDDMTMSPITYDEMRPGCYDPVARVADMELNHVEASLCFPTFPRFCGQTFAEARDTDLALACVRAYNDWMIDEWCADSGGRLIPLCLIPLWDAELAAGEVRRNAARGCRAVCFSEIPPHLGLPSIHSGSWEPFLAACVDTGTVVCMHIGSSSRMPATSGDAPPAVAATLSFNNAMASLADWLFSGVLVRFPELVLAYSEGQIGWLPYALERADDVWREHRAWGGVRDLVPEPPSSYFRRQVYGCFFRDRHGLASLDAIGVDNVTFETDYPHTDSTWPNTRRVAEEMMAGLPAATVRKIVRGNAIRMLGLDLA

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
10 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
66 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
90 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
91 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
92 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
93 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
94 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
95 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
225 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
226 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
227 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
228 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
229 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
234 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
237 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
242 2671180195 Frankia sp. CcI49 Isolate Nodule
243 2508501039 Frankia saprophytica CN3 Isolate Nodule
244 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
245 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
246 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
247 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
248 2643221578 Streptomyces sp. Root63 Isolate Unclassified
249 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
250 2643221647 Streptomyces sp. Root369 Isolate Unclassified
251 2643221670 Streptomyces sp. Root431 Isolate Unclassified
252 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
253 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
254 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
255 2643221714 Streptomyces sp. Root264 Isolate Unclassified
256 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
257 2687453737 Frankia sp. BMG5.36 Isolate Nodule
258 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
259 2773857922 Frankia sp. CcI49 Isolate Nodule
260 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
261 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
262 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
263 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
264 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
265 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
266 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
267 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
268 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
269 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
270 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
271 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
272 2862574272 Streptomyces sp. AcE210 Isolate Nodule
273 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
274 2867428634 Streptomyces sp. RP5T Isolate Unclassified
275 2867475112 Streptomyces sp. TM32 Isolate Unclassified
276 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
277 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
278 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
279 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
280 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
281 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
282 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
283 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
284 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
285 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
286 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
287 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
288 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
289 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
290 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
291 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
292 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
293 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
294 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
295 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
296 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
297 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
298 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
299 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
300 8002775197 Frankia nepalensis CN7 Isolate Nodule
301 8002784119 Frankia sp. AgB1.9 Isolate Nodule
302 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
303 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
304 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
305 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
306 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
307 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
308 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
309 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
310 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
311 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
312 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.02
Metatranscriptomes 0
Isolates 14.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.23
Nodule 2.32
Rhizoplane 3.38
Rhizosphere 75.53
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10015354 3300002067 Bacteria 2390
2 Ga0070671_100004785 3300005355 Bacteria 10761
3 Ga0070671_100041622 3300005355 Bacteria 3819
4 Ga0070673_100181092 3300005364 Bacteria 1804
5 Ga0070710_10009183 3300005437 Bacteria 4833
6 Ga0070706_100051806 3300005467 Bacteria 3789
7 Ga0070707_100055748 3300005468 Bacteria 3789
8 Ga0070697_100180070 3300005536 Bacteria 1791
9 Ga0068855_100043538 3300005563 Bacteria 5318
10 Ga0068855_100153319 3300005563 Bacteria 2619
11 Ga0068858_100047634 3300005842 Bacteria 3973
12 Ga0068858_100118850 3300005842 Bacteria 2471
13 Ga0068860_100006739 3300005843 Bacteria 11522
14 Ga0068860_100251831 3300005843 Bacteria 1720
15 Ga0081455_10044875 3300005937 Bacteria 3851
16 Ga0081455_10121192 3300005937 Bacteria 2060
17 Ga0081538_10040128 3300005981 Bacteria 2990
18 Ga0081539_10007464 3300005985 Bacteria 9962
19 Ga0070717_10308114 3300006028 Bacteria 1409
20 Ga0075365_10001571 3300006038 Bacteria 10481
21 Ga0075365_10003287 3300006038 Bacteria 8291
22 Ga0075368_10001053 3300006042 Bacteria 8641
23 Ga0075363_100120721 3300006048 Bacteria 1464
24 Ga0075364_10000217 3300006051 Bacteria 27132
25 Ga0075364_10001735 3300006051 Bacteria 12003
26 Ga0075364_10027459 3300006051 Bacteria 3636
27 Ga0075362_10003242 3300006177 Bacteria 5647
28 Ga0075367_10005370 3300006178 Bacteria 6355
29 Ga0075428_100079548 3300006844 Bacteria 3578
30 Ga0075430_100156915 3300006846 Bacteria 1894
31 Ga0075431_100048046 3300006847 Bacteria 4401
32 Ga0075431_100081319 3300006847 Bacteria 3345
33 Ga0075433_10033835 3300006852 Bacteria 4384
34 Ga0075434_100001400 3300006871 Bacteria 20264
35 Ga0075429_100031635 3300006880 Bacteria 4598
36 Ga0075436_100013613 3300006914 Bacteria 5571
37 Ga0075435_100014904 3300007076 Bacteria 5830
38 Ga0105245_10304462 3300009098 Bacteria 1565
39 Ga0114129_10219722 3300009147 Bacteria 2564
40 Ga0105243_10077383 3300009148 Bacteria 2706
41 Ga0105248_10079484 3300009177 Bacteria 3686
42 Ga0105238_10159758 3300009551 Bacteria 2229
43 Ga0105239_10140294 3300010375 Bacteria 2693
44 Ga0105246_10004991 3300011119 Bacteria 8078
45 Ga0157370_10319504 3300013104 Bacteria 1432
46 Ga0157378_10197579 3300013297 Bacteria 1900
47 Ga0157378_10353484 3300013297 Bacteria 1436
48 Ga0157372_10394681 3300013307 Bacteria 1612
49 Ga0157375_10316128 3300013308 Bacteria 1726
50 Ga0182008_10001868 3300014497 Bacteria 13707
51 Ga0182007_10000435 3300015262 Bacteria 25447
52 Ga0183367_1005 3300015688 Bacteria 652063
53 Ga0213876_10008549 3300021384 Bacteria 5543
54 Ga0207692_10021791 3300025898 Bacteria 2937
55 Ga0207647_10008897 3300025904 Bacteria 7161
56 Ga0207647_10035140 3300025904 Bacteria 3195
57 Ga0207647_10046354 3300025904 Bacteria 2709
58 Ga0207695_10377147 3300025913 Bacteria 1304
59 Ga0207693_10210075 3300025915 Bacteria 1530
60 Ga0207646_10064419 3300025922 Bacteria 3271
61 Ga0207681_10036527 3300025923 Bacteria 3242
62 Ga0207694_10076304 3300025924 Bacteria 2625
63 Ga0207694_10301180 3300025924 Bacteria 1320
64 Ga0207687_10002385 3300025927 Bacteria 12744
65 Ga0207687_10018185 3300025927 Bacteria 4636
66 Ga0207644_10004478 3300025931 Bacteria 9071
67 Ga0207686_10062126 3300025934 Bacteria 2371
68 Ga0207711_10073797 3300025941 Bacteria 2966
69 Ga0207661_10086386 3300025944 Bacteria 2603
70 Ga0207667_10066470 3300025949 Bacteria 3758
71 Ga0207677_10267125 3300026023 Bacteria 1398
72 Ga0207703_10002358 3300026035 Bacteria 16441
73 Ga0207703_10053954 3300026035 Bacteria 3268
74 Ga0209371_1007076 3300027312 Bacteria 3993
75 Ga0209813_10000980 3300027866 Bacteria 6391
76 Ga0209813_10007741 3300027866 Bacteria 2687
77 Ga0268264_10007043 3300028381 Bacteria 9431
78 Ga0268264_10207852 3300028381 Bacteria 1795
79 Ga0307517_10005931 3300028786 Bacteria 18226
80 Ga0307517_10017150 3300028786 Bacteria 9458
81 Ga0307515_10001178 3300028794 Bacteria 59820
82 Ga0265338_10000733 3300028800 Bacteria 56014
83 Ga0265338_10170219 3300028800 Bacteria 1672
84 Ga0268256_1022843 3300030500 Bacteria 1634
85 Ga0307512_10002337 3300030522 Bacteria 24365
86 Ga0307512_10059066 3300030522 Bacteria 2980
87 Ga0307512_10074570 3300030522 Bacteria 2490
88 Ga0265320_10078534 3300031240 Bacteria 1544
89 Ga0265327_10033663 3300031251 Bacteria 2852
90 Ga0265327_10041580 3300031251 Bacteria 2476
91 Ga0265327_10044763 3300031251 Bacteria 2357
92 Ga0307509_10002991 3300031507 Bacteria 26457
93 Ga0307509_10016504 3300031507 Bacteria 8541
94 Ga0265313_10077298 3300031595 Bacteria 1519
95 Ga0307508_10002314 3300031616 Bacteria 20227
96 Ga0307508_10003510 3300031616 Bacteria 15798
97 Ga0307508_10007528 3300031616 Bacteria 10123
98 Ga0307508_10017452 3300031616 Bacteria 6526
99 Ga0307508_10020266 3300031616 Bacteria 6039
100 Ga0307514_10003322 3300031649 Bacteria 15587
101 Ga0307516_10030376 3300031730 Bacteria 5452
102 Ga0307516_10042158 3300031730 Bacteria 4530
103 Ga0307405_10066063 3300031731 Bacteria 2305
104 Ga0307413_10006513 3300031824 Bacteria 5345
105 Ga0307413_10079918 3300031824 Bacteria 2092
106 Ga0307410_10149321 3300031852 Bacteria 1738
107 Ga0307407_10102575 3300031903 Bacteria 1779
108 Ga0307409_100009117 3300031995 Bacteria 6076
109 Ga0307416_100005984 3300032002 Bacteria 7562
110 Ga0307411_10005855 3300032005 Bacteria 6094
111 Ga0307507_10024945 3300033179 Bacteria 6499
112 Ga0307510_10004474 3300033180 Bacteria 16443
113 Ga0307510_10031005 3300033180 Bacteria 6049
114 Ga0316574_0012594 3300035398 Bacteria 4842
115 Ga0373935_0174039 3300035692 Bacteria 1474
116 Ga0373925_0139878 3300037068 Bacteria 1894
117 Ga0395898_0004783 3300037466 Bacteria 14732
118 Ga0395898_0284239 3300037466 Bacteria 1578
119 Ga0395901_0309186 3300038443 Bacteria 1637
120 Ga0436365_0069478 3300039437 Bacteria 9974
121 Ga0436365_0097495 3300039437 Bacteria 1919
122 Ga0439433_0000203 3300041999 Bacteria 9634
123 Ga0439448_0001449 3300042005 Bacteria 6141
124 Ga0439449_0002232 3300042007 Bacteria 7624
125 Ga0439457_002863 3300042014 Bacteria 4811
126 Ga0450899_004491 3300042135 Bacteria 1494
127 Ga0450903_000752 3300042138 Bacteria 6354
128 Ga0439458_0001489 3300042157 Bacteria 5892
129 Ga0439458_0009007 3300042157 Bacteria 2226
130 Ga0466969_0007672 3300044656 Bacteria 5734
131 Ga0466965_0000750 3300044683 Bacteria 12173
132 Ga0466965_0104208 3300044683 Bacteria 1453
133 Ga0466966_0003793 3300044684 Bacteria 9965
134 Ga0466966_0011460 3300044684 Bacteria 5880
135 Ga0466961_0001319 3300044693 Bacteria 15317
136 Ga0466961_0026110 3300044693 Bacteria 3756
137 Ga0466963_0000165 3300044694 Bacteria 26870
138 Ga0466963_0067397 3300044694 Bacteria 2402
139 Ga0466971_0000131 3300044719 Bacteria 27475
140 Ga0466968_0024740 3300044735 Bacteria 2456
141 Ga0466970_0001244 3300044765 Bacteria 12348
142 Ga0466957_0000602 3300044842 Bacteria 18227
143 Ga0466959_0000272 3300045049 Bacteria 31666
144 Ga0466959_0006947 3300045049 Bacteria 7906
145 Ga0466958_0015875 3300045836 Bacteria 4327
146 Ga0466967_0050198 3300045976 Bacteria 3652
147 Ga0495627_018379 3300046453 Bacteria 2359
148 Ga0495592_0046033 3300046454 Bacteria 3252
149 Ga0495603_0002477 3300046455 Bacteria 10859
150 Ga0495603_0027950 3300046455 Bacteria 3401
151 Ga0495629_0010342 3300046459 Bacteria 6792
152 Ga0495629_0030347 3300046459 Bacteria 3833
153 Ga0495629_0049009 3300046459 Bacteria 2961
154 Ga0495629_0058388 3300046459 Bacteria 2697
155 Ga0495629_0114113 3300046459 Bacteria 1883
156 Ga0495629_0132537 3300046459 Bacteria 1736
157 Ga0495638_0043364 3300046460 Bacteria 2838
158 Ga0495651_0015059 3300046462 Bacteria 5978
159 Ga0495653_0018455 3300046463 Bacteria 5664
160 Ga0495639_0004827 3300046475 Bacteria 5789
161 Ga0495662_0001016 3300046476 Bacteria 13762
162 Ga0495662_0003047 3300046476 Bacteria 8451
163 Ga0495662_0005234 3300046476 Bacteria 6502
164 Ga0495662_0007821 3300046476 Bacteria 5261
165 Ga0495664_0000596 3300046477 Bacteria 18302
166 Ga0495664_0003035 3300046477 Bacteria 9091
167 Ga0495664_0046821 3300046477 Bacteria 2566
168 Ga0495664_0052504 3300046477 Bacteria 2423
169 Ga0495585_0027391 3300046492 Bacteria 3253
170 Ga0495585_0063039 3300046492 Bacteria 2035
171 Ga0495594_0006266 3300046499 Bacteria 6116
172 Ga0495594_0043673 3300046499 Bacteria 2457
173 Ga0495608_0006744 3300046511 Bacteria 8141
174 Ga0495608_0094924 3300046511 Bacteria 1927
175 Ga0495618_0073784 3300046514 Bacteria 2172
176 Ga0495628_0010133 3300046516 Bacteria 8014
177 Ga0495630_0017519 3300046517 Bacteria 5249
178 Ga0495630_0056117 3300046517 Bacteria 2951
179 Ga0495631_0012266 3300046518 Bacteria 4193
180 Ga0495631_0025246 3300046518 Bacteria 2739
181 Ga0495632_0047338 3300046519 Bacteria 2133
182 Ga0495643_0001867 3300046522 Bacteria 17867
183 Ga0495648_0032357 3300046524 Bacteria 3433
184 Ga0495666_0003353 3300046526 Bacteria 8082
185 Ga0495666_0081255 3300046526 Bacteria 1533
186 Ga0495652_0058054 3300046529 Bacteria 3279
187 Ga0495652_0208681 3300046529 Bacteria 1476
188 Ga0495640_0003173 3300046533 Bacteria 13243
189 Ga0495640_0015827 3300046533 Bacteria 5661
190 Ga0495586_0007255 3300046535 Bacteria 5918
191 Ga0495586_0016106 3300046535 Bacteria 3977
192 Ga0495587_0006139 3300046536 Bacteria 7839
193 Ga0495587_0010549 3300046536 Bacteria 5876
194 Ga0495645_0004754 3300046543 Bacteria 9281
195 Ga0495645_0036973 3300046543 Bacteria 3558
196 Ga0495622_0019391 3300046557 Bacteria 3167
197 Ga0495622_0033277 3300046557 Bacteria 2406
198 Ga0495622_0048966 3300046557 Bacteria 1962
199 Ga0495633_0024835 3300046558 Bacteria 2957
200 Ga0495633_0027892 3300046558 Bacteria 2755
201 Ga0495667_0001648 3300046559 Bacteria 14797
202 Ga0495667_0013981 3300046559 Bacteria 5419
203 Ga0495634_0001856 3300046642 Bacteria 18168
204 Ga0495634_0019365 3300046642 Bacteria 4837
205 Ga0495625_0017737 3300046660 Bacteria 5568
206 Ga0495625_0121993 3300046660 Bacteria 1772
207 Ga0495635_0016203 3300046663 Bacteria 5202
208 Ga0495588_0001939 3300046674 Bacteria 8835
209 Ga0495588_0005366 3300046674 Bacteria 5700
210 Ga0495657_0014352 3300046675 Bacteria 5814
211 Ga0495657_0069352 3300046675 Bacteria 2307
212 Ga0495657_0112250 3300046675 Bacteria 1726
213 Ga0495657_0119097 3300046675 Bacteria 1664
214 Ga0495599_0072095 3300046678 Bacteria 2155
215 Ga0495623_0013535 3300046679 Bacteria 5289
216 Ga0495623_0028414 3300046679 Bacteria 3597
217 Ga0495646_0005698 3300046680 Bacteria 7891
218 Ga0495646_0011167 3300046680 Bacteria 5704
219 Ga0495646_0049084 3300046680 Bacteria 2562
220 Ga0495647_0034327 3300046681 Bacteria 1900
221 Ga0495658_0040115 3300046683 Unclassified 2602
222 Ga0495658_0106651 3300046683 Bacteria 1680
223 Ga0495613_0000275 3300046689 Bacteria 47915
224 Ga0495613_0000281 3300046689 Bacteria 47256
225 Ga0495613_0002647 3300046689 Bacteria 13462
226 Ga0495613_0007437 3300046689 Bacteria 8163
227 Ga0495613_0010771 3300046689 Bacteria 6783
228 Ga0495613_0011466 3300046689 Bacteria 6591
229 Ga0495613_0017095 3300046689 Bacteria 5399
230 Ga0495624_0118863 3300046690 Bacteria 1624
231 Ga0495670_0004287 3300046691 Bacteria 6986
232 Ga0495670_0113661 3300046691 Bacteria 1403
233 Ga0495671_0001892 3300046692 Bacteria 13443
234 Ga0495589_0015303 3300046794 Bacteria 3949
235 Ga0495600_0044409 3300046809 Bacteria 2899
236 Ga0495600_0059607 3300046809 Bacteria 2493
237 Ga0495600_0130466 3300046809 Bacteria 1634
238 Ga0495600_0156022 3300046809 Bacteria 1476
239 Ga0495660_0083084 3300046810 Bacteria 1675
240 Ga0495604_0001198 3300047317 Bacteria 21414
241 Ga0495604_0099337 3300047317 Bacteria 2142
242 Ga0495636_0002009 3300047318 Bacteria 7792
243 Ga0495636_0002459 3300047318 Bacteria 7102
244 Ga0495636_0012240 3300047318 Bacteria 3397
245 Ga0495674_0249730 3300047319 Bacteria 1460
246 Ga0495672_0004411 3300047320 Bacteria 11539
247 Ga0495672_0020353 3300047320 Bacteria 4351
248 Ga0495676_0020140 3300047321 Bacteria 5862
249 Ga0495676_0031804 3300047321 Bacteria 4458
250 Ga0495676_0052445 3300047321 Bacteria 3255
251 Ga0495676_0053293 3300047321 Bacteria 3224
252 Ga0495680_0010650 3300047322 Bacteria 8199
253 Ga0495680_0078520 3300047322 Bacteria 2498
254 Ga0495680_0143106 3300047322 Bacteria 1748
255 Ga0495680_0179230 3300047322 Bacteria 1530
256 Ga0495687_001308 3300047443 Bacteria 23349
257 Ga0495687_006315 3300047443 Bacteria 7297
258 Ga0495687_020260 3300047443 Bacteria 3243
259 Ga0495675_0006835 3300047444 Bacteria 7001
260 Ga0495685_003895 3300047447 Bacteria 4793
261 Ga0495685_004564 3300047447 Bacteria 4486
262 Ga0495685_030129 3300047447 Bacteria 1866
263 Ga0495681_0000958 3300047470 Bacteria 22103
264 Ga0495686_0011133 3300047472 Bacteria 6352
265 Ga0495593_0000541 3300047673 Bacteria 21383
266 Ga0495593_0042966 3300047673 Bacteria 2424
267 Ga0495602_0025231 3300048088 Bacteria 5753
268 Ga0495614_0004274 3300048089 Bacteria 6434
269 Ga0495614_0079177 3300048089 Bacteria 1422
270 Ga0496100_0043625 3300048903 Bacteria 2869
271 Ga0496100_0115107 3300048903 Bacteria 1874
272 Ga0496101_0029351 3300048904 Bacteria 3846
273 Ga0496102_0023165 3300048905 Bacteria 5512
274 Ga0496102_0023258 3300048905 Bacteria 5501
275 Ga0496103_0034610 3300048906 Bacteria 3090
276 Ga0496104_0099411 3300048907 Bacteria 2785
277 Ga0496105_0007902 3300048908 Bacteria 8262
278 Ga0496105_0031881 3300048908 Bacteria 4322
279 Ga0496106_0056540 3300048909 Bacteria 2966
280 Ga0496107_0094030 3300048910 Bacteria 2193
281 Ga0496108_0031616 3300048911 Bacteria 4393
282 Ga0496108_0041423 3300048911 Bacteria 3845
283 Ga0496114_0026652 3300048917 Bacteria 4734
284 Ga0496115_0004127 3300048918 Bacteria 10484
285 Ga0496119_0000067 3300048922 Bacteria 162404
286 Ga0496120_0001000 3300048923 Bacteria 38203
287 Ga0496126_0000027 3300048929 Bacteria 396518
288 Ga0496126_0000040 3300048929 Bacteria 345144
289 Ga0496126_0111473 3300048929 Bacteria 2382
290 Ga0501032_0012173 3300049569 Bacteria 6158
291 Ga0501033_0000489 3300049570 Bacteria 37277
292 Ga0501033_0001672 3300049570 Bacteria 19390
293 Ga0501033_0064618 3300049570 Bacteria 2693
294 Ga0501034_0000290 3300049571 Bacteria 89870
295 Ga0501034_0008322 3300049571 Bacteria 10976
296 Ga0501034_0008466 3300049571 Bacteria 10864
297 Ga0501034_0019515 3300049571 Bacteria 6933
298 Ga0501034_0079988 3300049571 Bacteria 3272
299 Ga0501034_0091523 3300049571 Bacteria 3039
300 Ga0501036_0414611 3300049572 Bacteria 1123
301 Ga0501037_0065978 3300049573 Bacteria 2637
302 Ga0501037_0073726 3300049573 Bacteria 2481
303 Ga0501037_0091996 3300049573 Bacteria 2194
304 Ga0501038_0097815 3300049574 Bacteria 2448
305 Ga0501039_0166948 3300049575 Bacteria 1730
306 Ga0501040_0151059 3300049576 Bacteria 1638
307 Ga0501043_0110892 3300049579 Bacteria 2154
308 Ga0501046_0105732 3300049580 Bacteria 2155
309 Ga0501046_0119717 3300049580 Bacteria 2004
310 Ga0501047_0007227 3300049581 Bacteria 10438
311 Ga0501047_0071963 3300049581 Bacteria 3328
312 Ga0501047_0367242 3300049581 Bacteria 1274
313 Ga0501048_0028034 3300049582 Bacteria 4090
314 Ga0501068_0001384 3300049584 Bacteria 12893
315 Ga0501068_0004023 3300049584 Bacteria 7996
316 Ga0501068_0004699 3300049584 Bacteria 7435
317 Ga0501069_0002665 3300049585 Bacteria 9109
318 Ga0501069_0064389 3300049585 Bacteria 2049
319 Ga0501070_0000915 3300049586 Bacteria 26831
320 Ga0501070_0008998 3300049586 Bacteria 8448
321 Ga0501070_0086836 3300049586 Bacteria 2590
322 Ga0501070_0195146 3300049586 Bacteria 1663
323 Ga0501071_0008198 3300049587 Bacteria 6895
324 Ga0501072_0011742 3300049588 Bacteria 6693
325 Ga0501073_0000204 3300049589 Bacteria 39275
326 Ga0501073_0001673 3300049589 Bacteria 16431
327 Ga0501073_0054429 3300049589 Bacteria 2801
328 Ga0501074_0000034 3300049590 Bacteria 64955
329 Ga0501074_0034302 3300049590 Bacteria 3679
330 Ga0501074_0038430 3300049590 Bacteria 3468
331 Ga0501074_0054535 3300049590 Bacteria 2882
332 Ga0501075_0005076 3300049591 Bacteria 8994
333 Ga0501076_0028823 3300049592 Bacteria 4314
334 Ga0501076_0113744 3300049592 Bacteria 2190
335 Ga0501076_0115508 3300049592 Bacteria 2172
336 Ga0501077_0039757 3300049593 Bacteria 2996
337 Ga0501080_0007248 3300049742 Bacteria 10005
338 Ga0501080_0045919 3300049742 Bacteria 4068
339 Ga0501080_0046931 3300049742 Bacteria 4020
340 Ga0501080_0112318 3300049742 Bacteria 2526
341 Ga0501081_0005991 3300049743 Bacteria 7871
342 Ga0501083_0002791 3300049744 Bacteria 12082
343 Ga0501083_0005687 3300049744 Bacteria 8824
344 Ga0501044_0001054 3300049823 Bacteria 33150
345 Ga0501044_0002881 3300049823 Bacteria 19577
346 Ga0501044_0004370 3300049823 Bacteria 15819
347 Ga0501044_0006893 3300049823 Bacteria 12509
348 Ga0501044_0047397 3300049823 Bacteria 4445
349 Ga0501044_0183861 3300049823 Bacteria 2056
350 Ga0501044_0209880 3300049823 Bacteria 1902
351 Ga0501045_0005251 3300049824 Bacteria 8961
352 nmdc:mga03n38_65338_c1 3300050490 Bacteria 1668
353 nmdc:mga00v17_11281_c2 3300050491 Bacteria 3397
354 nmdc:mga0yw44_11531_c1 3300050492 Bacteria 4568
355 nmdc:mga0yw44_541_c1 3300050492 Bacteria 13593
356 nmdc:mga06z11_2763_c1 3300050494 Bacteria 6726
357 nmdc:mga06z11_60006_c1 3300050494 Bacteria 1979
358 nmdc:mga06z11_93806_c1 3300050494 Bacteria 1634
359 nmdc:mga04h51_1039_c1 3300050495 Bacteria 6392
360 nmdc:mga05p37_324246_c1 3300050507 Bacteria 1822
361 nmdc:mga05p37_35323_c1 3300050507 Bacteria 6128
362 nmdc:mga09592_29474_c1 3300050508 Bacteria 4565
363 nmdc:mga0qj67_66488_c1 3300050509 Bacteria 2871
364 nmdc:mga0qj67_89628_c1 3300050509 Bacteria 2470
365 nmdc:mga06r32_144261_c1 3300050510 Bacteria 2358
366 nmdc:mga06r32_20417_c1 3300050510 Bacteria 6100
367 nmdc:mga06r32_37316_c1 3300050510 Bacteria 4597
368 nmdc:mga08y16_244185_c1 3300050511 Bacteria 1856
369 nmdc:mga0rr50_2701_c1 3300050513 Bacteria 10063
370 nmdc:mga0a205_30312_c1 3300050515 Bacteria 5178
371 Ga0495601_0008768 3300053077 Bacteria 5965
372 Ga0495595_0019073 3300053084 Bacteria 2972
373 Ga0495619_0008881 3300053085 Bacteria 6350
374 Ga0495619_0030332 3300053085 Bacteria 3500
375 Ga0495619_0031469 3300053085 Bacteria 3438
376 Ga0495619_0038174 3300053085 Bacteria 3132
377 Ga0500566_0000053 3300053094 Bacteria 55483
378 Ga0500640_001443 3300053095 Bacteria 7212
379 Ga0500654_023967 3300053099 Bacteria 3833
380 Ga0500560_001705 3300053107 Bacteria 3936
381 Ga0500560_009372 3300053107 Bacteria 2404
382 Ga0500614_002104 3300053123 Bacteria 4545
383 Ga0500652_002875 3300053131 Bacteria 5185
384 Ga0500658_0003972 3300053134 Bacteria 5549
385 Ga0500561_0000282 3300053137 Bacteria 8877
386 Ga0500568_0000039 3300053139 Bacteria 134018
387 Ga0500573_0055181 3300053140 Bacteria 2280
388 Ga0500573_0104042 3300053140 Bacteria 1595
389 Ga0500600_0012960 3300053149 Bacteria 5058
390 Ga0500616_0000307 3300053153 Bacteria 70503
391 Ga0500616_0001826 3300053153 Bacteria 19302
392 Ga0500616_0002591 3300053153 Bacteria 14847
393 Ga0500616_0003046 3300053153 Bacteria 13189
394 Ga0500633_0003643 3300053160 Bacteria 3399
395 Ga0500634_0045768 3300053161 Bacteria 2366
396 Ga0501084_0000082 3300054114 Bacteria 69523
397 Ga0501084_0003061 3300054114 Bacteria 13543
398 Ga0501082_0189933 3300060353 Bacteria 1787
399 Ga0466962_0002991 3300061719 Bacteria 8061
400 Ga0530510_0010750 3300061734 Bacteria 6422
401 2671832662 2671180195 Bacteria 9757215
402 2508676190 2508501039 Bacteria 9978592
403 2585308556 2582581313 Bacteria 10042643
404 2585313426 2582581314 Bacteria 11452267
405 2616695134 2616644814 Bacteria 11555299
406 2616902069 2616644941 Bacteria 8510691
407 2643902764 2643221578 Bacteria 9213798
408 2643943482 2643221587 Bacteria 7586415
409 2644262211 2643221647 Bacteria 10741251
410 2644388655 2643221670 Bacteria 6497041
411 2644404727 2643221673 Bacteria 9196637
412 2644429867 2643221677 Bacteria 7584031
413 2644437105 2643221678 Bacteria 9540101
414 2644628841 2643221714 Bacteria 9015452
415 2676198674 2675902999 Bacteria 9438463
416 2689961548 2687453737 Bacteria 11203906
417 2774843252 2773857921 Bacteria 9435764
418 2774850818 2773857922 Bacteria 9757215
419 2785343385 2784746763 Bacteria 9783172
420 2785369439 2784746768 Bacteria 10036182
421 2786670547 2786546132 Bacteria 10419719
422 2793984917 2791355406 Bacteria 11364898
423 2808842001 2808606359 Bacteria 9866990
424 2811848967 2808606982 Bacteria 7791042
425 2812358172 2811994879 Bacteria 9313447
426 2852636737 2852635781 Bacteria 8251373
427 2862181884 2862178590 Bacteria 8583590
428 2862285591 2862281513 Bacteria 9621493
429 2862296175 2862290372 Bacteria 7471434
430 2862391973 2862382967 Bacteria 10317375
431 2862579312 2862574272 Bacteria 10567477
432 2863404673 2863404153 Bacteria 9672205
433 2867432377 2867428634 Bacteria 9590268
434 2867475481 2867475112 Bacteria 6909112
435 2873155786 2873151551 Bacteria 8625867
436 2875395901 2875391855 Bacteria 7600475
437 2877681170 2877676314 Bacteria 9512378
438 2912720042 2912715099 Bacteria 9460473
439 2918504457 2918501144 Bacteria 8668083
440 2935393924 2935390628 Bacteria 7043367
441 2946048733 2946045630 Bacteria 8527308
442 2946067676 2946064051 Bacteria 8957905
443 2946075858 2946072368 Bacteria 8999607
444 2947229322 2947224130 Bacteria 9938529
445 2954676867 2954673503 Bacteria 9685905
446 2954687291 2954682443 Bacteria 9862841
447 2954696981 2954691527 Bacteria 10720516
448 2954705154 2954701450 Bacteria 10834262
449 2954716306 2954711539 Bacteria 10867210
450 2954726249 2954721474 Bacteria 10456478
451 2954735562 2954731030 Bacteria 10243860
452 2954745174 2954740390 Bacteria 10229294
453 2954754417 2954749733 Bacteria 10366972
454 2954764148 2954759201 Bacteria 9358192
455 2990061446 2990059506 Bacteria 9321252
456 2995468587 2995463766 Bacteria 8577691
457 2997601459 2997600082 Bacteria 9896405
458 3006491496 3006486233 Bacteria 8157040
459 8002779107 8002775197 Bacteria 10728764
460 8002789417 8002784119 Bacteria 9788632
461 8008567374 8008558824 Bacteria 10610750
462 8025483334 8025478263 Bacteria 8209203
463 8047896842 8047893842 Bacteria 11723082
464 8048129807 8048127548 Bacteria 11053136
465 8048362109 8048356638 Bacteria 11044339
466 8048373827 8048369669 Bacteria 11666822
467 8048384401 8048379754 Bacteria 11877923
468 8048412815 8048406513 Bacteria 8936924
469 8054164161 8054160619 Bacteria 7783213
470 8056668441 8056667051 Bacteria 6953971
471 8056831758 8056829672 Bacteria 9045328
472 JGI24735J21928_10015354
473 Ga0070671_100004785
474 Ga0070671_100041622
475 Ga0070673_100181092
476 Ga0070710_10009183
477 Ga0070706_100051806
478 Ga0070707_100055748
479 Ga0070697_100180070
480 Ga0068855_100043538
481 Ga0068855_100153319
482 Ga0068858_100047634
483 Ga0068858_100118850
484 Ga0068860_100006739
485 Ga0068860_100251831
486 Ga0081455_10044875
487 Ga0081455_10121192
488 Ga0081538_10040128
489 Ga0081539_10007464
490 Ga0070717_10308114
491 Ga0075365_10001571
492 Ga0075365_10003287
493 Ga0075368_10001053
494 Ga0075363_100120721
495 Ga0075364_10000217
496 Ga0075364_10001735
497 Ga0075364_10027459
498 Ga0075362_10003242
499 Ga0075367_10005370
500 Ga0075428_100079548
501 Ga0075430_100156915
502 Ga0075431_100048046
503 Ga0075431_100081319
504 Ga0075433_10033835
505 Ga0075434_100001400
506 Ga0075429_100031635
507 Ga0075436_100013613
508 Ga0075435_100014904
509 Ga0105245_10304462
510 Ga0114129_10219722
511 Ga0105243_10077383
512 Ga0105248_10079484
513 Ga0105238_10159758
514 Ga0105239_10140294
515 Ga0105246_10004991
516 Ga0157370_10319504
517 Ga0157378_10197579
518 Ga0157378_10353484
519 Ga0157372_10394681
520 Ga0157375_10316128
521 Ga0182008_10001868
522 Ga0182007_10000435
523 Ga0183367_1005
524 Ga0213876_10008549
525 Ga0207692_10021791
526 Ga0207647_10008897
527 Ga0207647_10035140
528 Ga0207647_10046354
529 Ga0207695_10377147
530 Ga0207693_10210075
531 Ga0207646_10064419
532 Ga0207681_10036527
533 Ga0207694_10076304
534 Ga0207694_10301180
535 Ga0207687_10002385
536 Ga0207687_10018185
537 Ga0207644_10004478
538 Ga0207686_10062126
539 Ga0207711_10073797
540 Ga0207661_10086386
541 Ga0207667_10066470
542 Ga0207677_10267125
543 Ga0207703_10002358
544 Ga0207703_10053954
545 Ga0209371_1007076
546 Ga0209813_10000980
547 Ga0209813_10007741
548 Ga0268264_10007043
549 Ga0268264_10207852
550 Ga0307517_10005931
551 Ga0307517_10017150
552 Ga0307515_10001178
553 Ga0265338_10000733
554 Ga0265338_10170219
555 Ga0268256_1022843
556 Ga0307512_10002337
557 Ga0307512_10059066
558 Ga0307512_10074570
559 Ga0265320_10078534
560 Ga0265327_10033663
561 Ga0265327_10041580
562 Ga0265327_10044763
563 Ga0307509_10002991
564 Ga0307509_10016504
565 Ga0265313_10077298
566 Ga0307508_10002314
567 Ga0307508_10003510
568 Ga0307508_10007528
569 Ga0307508_10017452
570 Ga0307508_10020266
571 Ga0307514_10003322
572 Ga0307516_10030376
573 Ga0307516_10042158
574 Ga0307405_10066063
575 Ga0307413_10006513
576 Ga0307413_10079918
577 Ga0307410_10149321
578 Ga0307407_10102575
579 Ga0307409_100009117
580 Ga0307416_100005984
581 Ga0307411_10005855
582 Ga0307507_10024945
583 Ga0307510_10004474
584 Ga0307510_10031005
585 Ga0316574_0012594
586 Ga0373935_0174039
587 Ga0373925_0139878
588 Ga0395898_0004783
589 Ga0395898_0284239
590 Ga0395901_0309186
591 Ga0436365_0069478
592 Ga0436365_0097495
593 Ga0439433_0000203
594 Ga0439448_0001449
595 Ga0439449_0002232
596 Ga0439457_002863
597 Ga0450899_004491
598 Ga0450903_000752
599 Ga0439458_0001489
600 Ga0439458_0009007
601 Ga0466969_0007672
602 Ga0466965_0000750
603 Ga0466965_0104208
604 Ga0466966_0003793
605 Ga0466966_0011460
606 Ga0466961_0001319
607 Ga0466961_0026110
608 Ga0466963_0000165
609 Ga0466963_0067397
610 Ga0466971_0000131
611 Ga0466968_0024740
612 Ga0466970_0001244
613 Ga0466957_0000602
614 Ga0466959_0000272
615 Ga0466959_0006947
616 Ga0466958_0015875
617 Ga0466967_0050198
618 Ga0495627_018379
619 Ga0495592_0046033
620 Ga0495603_0002477
621 Ga0495603_0027950
622 Ga0495629_0010342
623 Ga0495629_0030347
624 Ga0495629_0049009
625 Ga0495629_0058388
626 Ga0495629_0114113
627 Ga0495629_0132537
628 Ga0495638_0043364
629 Ga0495651_0015059
630 Ga0495653_0018455
631 Ga0495639_0004827
632 Ga0495662_0001016
633 Ga0495662_0003047
634 Ga0495662_0005234
635 Ga0495662_0007821
636 Ga0495664_0000596
637 Ga0495664_0003035
638 Ga0495664_0046821
639 Ga0495664_0052504
640 Ga0495585_0027391
641 Ga0495585_0063039
642 Ga0495594_0006266
643 Ga0495594_0043673
644 Ga0495608_0006744
645 Ga0495608_0094924
646 Ga0495618_0073784
647 Ga0495628_0010133
648 Ga0495630_0017519
649 Ga0495630_0056117
650 Ga0495631_0012266
651 Ga0495631_0025246
652 Ga0495632_0047338
653 Ga0495643_0001867
654 Ga0495648_0032357
655 Ga0495666_0003353
656 Ga0495666_0081255
657 Ga0495652_0058054
658 Ga0495652_0208681
659 Ga0495640_0003173
660 Ga0495640_0015827
661 Ga0495586_0007255
662 Ga0495586_0016106
663 Ga0495587_0006139
664 Ga0495587_0010549
665 Ga0495645_0004754
666 Ga0495645_0036973
667 Ga0495622_0019391
668 Ga0495622_0033277
669 Ga0495622_0048966
670 Ga0495633_0024835
671 Ga0495633_0027892
672 Ga0495667_0001648
673 Ga0495667_0013981
674 Ga0495634_0001856
675 Ga0495634_0019365
676 Ga0495625_0017737
677 Ga0495625_0121993
678 Ga0495635_0016203
679 Ga0495588_0001939
680 Ga0495588_0005366
681 Ga0495657_0014352
682 Ga0495657_0069352
683 Ga0495657_0112250
684 Ga0495657_0119097
685 Ga0495599_0072095
686 Ga0495623_0013535
687 Ga0495623_0028414
688 Ga0495646_0005698
689 Ga0495646_0011167
690 Ga0495646_0049084
691 Ga0495647_0034327
692 Ga0495658_0040115
693 Ga0495658_0106651
694 Ga0495613_0000275
695 Ga0495613_0000281
696 Ga0495613_0002647
697 Ga0495613_0007437
698 Ga0495613_0010771
699 Ga0495613_0011466
700 Ga0495613_0017095
701 Ga0495624_0118863
702 Ga0495670_0004287
703 Ga0495670_0113661
704 Ga0495671_0001892
705 Ga0495589_0015303
706 Ga0495600_0044409
707 Ga0495600_0059607
708 Ga0495600_0130466
709 Ga0495600_0156022
710 Ga0495660_0083084
711 Ga0495604_0001198
712 Ga0495604_0099337
713 Ga0495636_0002009
714 Ga0495636_0002459
715 Ga0495636_0012240
716 Ga0495674_0249730
717 Ga0495672_0004411
718 Ga0495672_0020353
719 Ga0495676_0020140
720 Ga0495676_0031804
721 Ga0495676_0052445
722 Ga0495676_0053293
723 Ga0495680_0010650
724 Ga0495680_0078520
725 Ga0495680_0143106
726 Ga0495680_0179230
727 Ga0495687_001308
728 Ga0495687_006315
729 Ga0495687_020260
730 Ga0495675_0006835
731 Ga0495685_003895
732 Ga0495685_004564
733 Ga0495685_030129
734 Ga0495681_0000958
735 Ga0495686_0011133
736 Ga0495593_0000541
737 Ga0495593_0042966
738 Ga0495602_0025231
739 Ga0495614_0004274
740 Ga0495614_0079177
741 Ga0496100_0043625
742 Ga0496100_0115107
743 Ga0496101_0029351
744 Ga0496102_0023165
745 Ga0496102_0023258
746 Ga0496103_0034610
747 Ga0496104_0099411
748 Ga0496105_0007902
749 Ga0496105_0031881
750 Ga0496106_0056540
751 Ga0496107_0094030
752 Ga0496108_0031616
753 Ga0496108_0041423
754 Ga0496114_0026652
755 Ga0496115_0004127
756 Ga0496119_0000067
757 Ga0496120_0001000
758 Ga0496126_0000027
759 Ga0496126_0000040
760 Ga0496126_0111473
761 Ga0501032_0012173
762 Ga0501033_0000489
763 Ga0501033_0001672
764 Ga0501033_0064618
765 Ga0501034_0000290
766 Ga0501034_0008322
767 Ga0501034_0008466
768 Ga0501034_0019515
769 Ga0501034_0079988
770 Ga0501034_0091523
771 Ga0501036_0414611
772 Ga0501037_0065978
773 Ga0501037_0073726
774 Ga0501037_0091996
775 Ga0501038_0097815
776 Ga0501039_0166948
777 Ga0501040_0151059
778 Ga0501043_0110892
779 Ga0501046_0105732
780 Ga0501046_0119717
781 Ga0501047_0007227
782 Ga0501047_0071963
783 Ga0501047_0367242
784 Ga0501048_0028034
785 Ga0501068_0001384
786 Ga0501068_0004023
787 Ga0501068_0004699
788 Ga0501069_0002665
789 Ga0501069_0064389
790 Ga0501070_0000915
791 Ga0501070_0008998
792 Ga0501070_0086836
793 Ga0501070_0195146
794 Ga0501071_0008198
795 Ga0501072_0011742
796 Ga0501073_0000204
797 Ga0501073_0001673
798 Ga0501073_0054429
799 Ga0501074_0000034
800 Ga0501074_0034302
801 Ga0501074_0038430
802 Ga0501074_0054535
803 Ga0501075_0005076
804 Ga0501076_0028823
805 Ga0501076_0113744
806 Ga0501076_0115508
807 Ga0501077_0039757
808 Ga0501080_0007248
809 Ga0501080_0045919
810 Ga0501080_0046931
811 Ga0501080_0112318
812 Ga0501081_0005991
813 Ga0501083_0002791
814 Ga0501083_0005687
815 Ga0501044_0001054
816 Ga0501044_0002881
817 Ga0501044_0004370
818 Ga0501044_0006893
819 Ga0501044_0047397
820 Ga0501044_0183861
821 Ga0501044_0209880
822 Ga0501045_0005251
823 nmdc:mga03n38_65338_c1
824 nmdc:mga00v17_11281_c2
825 nmdc:mga0yw44_11531_c1
826 nmdc:mga0yw44_541_c1
827 nmdc:mga06z11_2763_c1
828 nmdc:mga06z11_60006_c1
829 nmdc:mga06z11_93806_c1
830 nmdc:mga04h51_1039_c1
831 nmdc:mga05p37_324246_c1
832 nmdc:mga05p37_35323_c1
833 nmdc:mga09592_29474_c1
834 nmdc:mga0qj67_66488_c1
835 nmdc:mga0qj67_89628_c1
836 nmdc:mga06r32_144261_c1
837 nmdc:mga06r32_20417_c1
838 nmdc:mga06r32_37316_c1
839 nmdc:mga08y16_244185_c1
840 nmdc:mga0rr50_2701_c1
841 nmdc:mga0a205_30312_c1
842 Ga0495601_0008768
843 Ga0495595_0019073
844 Ga0495619_0008881
845 Ga0495619_0030332
846 Ga0495619_0031469
847 Ga0495619_0038174
848 Ga0500566_0000053
849 Ga0500640_001443
850 Ga0500654_023967
851 Ga0500560_001705
852 Ga0500560_009372
853 Ga0500614_002104
854 Ga0500652_002875
855 Ga0500658_0003972
856 Ga0500561_0000282
857 Ga0500568_0000039
858 Ga0500573_0055181
859 Ga0500573_0104042
860 Ga0500600_0012960
861 Ga0500616_0000307
862 Ga0500616_0001826
863 Ga0500616_0002591
864 Ga0500616_0003046
865 Ga0500633_0003643
866 Ga0500634_0045768
867 Ga0501084_0000082
868 Ga0501084_0003061
869 Ga0501082_0189933
870 Ga0466962_0002991
871 Ga0530510_0010750
872 2671832662
873 2508676190
874 2585308556
875 2585313426
876 2616695134
877 2616902069
878 2643902764
879 2643943482
880 2644262211
881 2644388655
882 2644404727
883 2644429867
884 2644437105
885 2644628841
886 2676198674
887 2689961548
888 2774843252
889 2774850818
890 2785343385
891 2785369439
892 2786670547
893 2793984917
894 2808842001
895 2811848967
896 2812358172
897 2852636737
898 2862181884
899 2862285591
900 2862296175
901 2862391973
902 2862579312
903 2863404673
904 2867432377
905 2867475481
906 2873155786
907 2875395901
908 2877681170
909 2912720042
910 2918504457
911 2935393924
912 2946048733
913 2946067676
914 2946075858
915 2947229322
916 2954676867
917 2954687291
918 2954696981
919 2954705154
920 2954716306
921 2954726249
922 2954735562
923 2954745174
924 2954754417
925 2954764148
926 2990061446
927 2995468587
928 2997601459
929 3006491496
930 8002779107
931 8002789417
932 8008567374
933 8025483334
934 8047896842
935 8048129807
936 8048362109
937 8048373827
938 8048384401
939 8048412815
940 8054164161
941 8056668441
942 8056831758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

42

430

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6omr-assembly1.cif.gz_B crystal structure of ptmu3 complexed with ptn substrate 0.8643 9 401
7pwy-assembly2.cif.gz_C structure of human dimeric acmsd in complex with the inhibitor tes-1025 0.8588 107 403
6omr-assembly1.cif.gz_B crystal structure of ptmu3 complexed with ptn substrate 0.8393 9 401
4qs5-assembly2.cif.gz_C crystal structure of 5-carboxyvanillate decarboxylase ligw2 from novosphingobium aromaticivorans dsm 12444 (target efi-505250) with bound manganese and 3-methoxy-4-hydroxy-5-nitrobenzoic acid, the d314n mutant 0.8123 105 403
7pwy-assembly2.cif.gz_D structure of human dimeric acmsd in complex with the inhibitor tes-1025 0.8072 14 403
ID Description Score Start End Superfamily
af_Q2FV40_2_334_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8265 116 405 3.20.20.140
4icmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8178 111 404 3.20.20.140
4infC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8107 105 403 3.20.20.140
3ij6C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7991 109 401 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7961 15 408 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A1Q5AKH7-F1-model_v4 Amidohydrolase 0.9987 10 409 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A505D774-F1-model_v4 Amidohydrolase 0.9986 10 409 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-I2N072-F1-model_v4 Amidohydrolase 0.9979 10 410 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2R4K0R3-F1-model_v4 Amidohydrolase 0.9977 13 410 GO:0005737
GO:0016787
GO:0016831
GO:0019748
AF-A0A2S1ST73-F1-model_v4 Amidohydrolase 0.9976 10 409 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Map