F451239

General Info

Members Datasets Scaffolds Average Seq Length
474 286 948 130

Family's Representative Sequence

Representative Sequence 3300046515|Ga0495620_0140702|Ga0495620_0140702_472_924
Length 150
Sequence VHAAAPDGSRTDERSALMASVIHYTIATEAEKSPDFRRVLWTGEHTQLVIMTIPPGGEIGEEVHEDTDQILTFVSGTGKAIVSGSEKNVAQGDLVVVPAGLKHNFLNTGQNPLILYTVYGPPEHADGAVHKTKEEADRLEEQGKDEPPTS

Samples

Sample ID Description Type Environment
1 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
78 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
124 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
125 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
145 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
146 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
156 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
159 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
160 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
161 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
162 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
163 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
166 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
167 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
168 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
169 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
173 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
174 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
204 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
223 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
224 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
240 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
241 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
242 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
243 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
248 2501939600 Micromonospora sp. L5 Isolate Unclassified
249 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
250 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
251 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
252 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
253 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
254 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
255 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
256 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
257 2855683550 Micromonospora sp. RP3T Isolate Unclassified
258 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
259 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
260 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
261 2858868258 Micromonospora sp. MH33 Isolate Unclassified
262 2858882152 Micromonospora noduli MED15 Isolate Nodule
263 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
264 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
265 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
266 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
267 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
268 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
269 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
270 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
271 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
272 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
273 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
274 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
275 2902582711 Micromonospora sp. AP08 Isolate Unclassified
276 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
277 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
278 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
279 649633069 Micromonospora sp. L5 Isolate Unclassified
280 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
281 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
282 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
283 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
284 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
285 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
286 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.76
Metatranscriptomes 4.01
Isolates 8.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 1.27
Rhizoplane 3.38
Rhizosphere 83.12
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495620_0140702 3300046515 Bacteria 944
2 JGI25406J46586_10032546 3300003203 Bacteria 1937
3 rootH1_10127582 3300003316 Bacteria 1034
4 Ga0070658_11355030 3300005327 Bacteria 618
5 Ga0070658_11918810 3300005327 Bacteria 512
6 Ga0070683_100113470 3300005329 Bacteria 2558
7 Ga0070683_100280688 3300005329 Bacteria 1584
8 Ga0070683_100301397 3300005329 Bacteria 1525
9 Ga0070670_100269211 3300005331 Bacteria 1486
10 Ga0070670_100709297 3300005331 Bacteria 905
11 Ga0068869_100008890 3300005334 Bacteria 6498
12 Ga0070682_100685934 3300005337 Bacteria 820
13 Ga0068868_100082087 3300005338 Bacteria 2585
14 Ga0070660_100120725 3300005339 Bacteria 2091
15 Ga0070660_100479436 3300005339 Bacteria 1033
16 Ga0070689_101240534 3300005340 Bacteria 670
17 Ga0070687_100381792 3300005343 Bacteria 918
18 Ga0070687_101019809 3300005343 Bacteria 601
19 Ga0070661_100074879 3300005344 Bacteria 2494
20 Ga0070668_100000918 3300005347 Bacteria 20528
21 Ga0070669_100565489 3300005353 Bacteria 949
22 Ga0070675_100001359 3300005354 Bacteria 17905
23 Ga0070671_100381137 3300005355 Bacteria 1205
24 Ga0070671_100785259 3300005355 Bacteria 829
25 Ga0070674_100349956 3300005356 Bacteria 1193
26 Ga0070659_100128594 3300005366 Bacteria 2056
27 Ga0070659_102027892 3300005366 Bacteria 517
28 Ga0070667_100129487 3300005367 Bacteria 2201
29 Ga0070714_100019144 3300005435 Bacteria 5573
30 Ga0070713_100346930 3300005436 Bacteria 1377
31 Ga0070713_100496965 3300005436 Bacteria 1150
32 Ga0070700_100094663 3300005441 Bacteria 1956
33 Ga0070663_100092830 3300005455 Bacteria 2239
34 Ga0070662_100050743 3300005457 Bacteria 2993
35 Ga0070681_10824876 3300005458 Bacteria 845
36 Ga0070681_11699114 3300005458 Bacteria 557
37 Ga0068867_101930132 3300005459 Bacteria 557
38 Ga0070685_10175996 3300005466 Bacteria 1374
39 Ga0070685_11226902 3300005466 Bacteria 571
40 Ga0070706_101193021 3300005467 Bacteria 699
41 Ga0070679_100757920 3300005530 Bacteria 914
42 Ga0070684_100311308 3300005535 Bacteria 1446
43 Ga0068853_100069136 3300005539 Bacteria 3071
44 Ga0070672_100426047 3300005543 Bacteria 1140
45 Ga0070672_100487674 3300005543 Bacteria 1065
46 Ga0070693_100100653 3300005547 Bacteria 1760
47 Ga0070693_101487961 3300005547 Bacteria 529
48 Ga0070665_100338737 3300005548 Bacteria 1509
49 Ga0070664_100008333 3300005564 Bacteria 8384
50 Ga0070664_100373784 3300005564 Bacteria 1300
51 Ga0068857_100063049 3300005577 Bacteria 3295
52 Ga0068852_100042936 3300005616 Bacteria 3831
53 Ga0068852_101578115 3300005616 Bacteria 679
54 Ga0068864_100149442 3300005618 Bacteria 2115
55 Ga0068864_100846906 3300005618 Unclassified 901
56 Ga0068851_10342623 3300005834 Bacteria 868
57 Ga0068870_10891241 3300005840 Bacteria 628
58 Ga0068863_100551620 3300005841 Bacteria 1138
59 Ga0068863_101883497 3300005841 Bacteria 608
60 Ga0068858_100076244 3300005842 Bacteria 3114
61 Ga0068860_100021642 3300005843 Bacteria 6225
62 Ga0068860_100330069 3300005843 Bacteria 1498
63 Ga0068860_100390553 3300005843 Unclassified 1375
64 Ga0068862_100071478 3300005844 Bacteria 2996
65 Ga0068862_100289215 3300005844 Bacteria 1504
66 Ga0068862_102428448 3300005844 Bacteria 536
67 Ga0081540_1009244 3300005983 Bacteria 6797
68 Ga0081539_10001178 3300005985 Bacteria 47290
69 Ga0081539_10239819 3300005985 Bacteria 812
70 Ga0070717_10818726 3300006028 Bacteria 847
71 Ga0075432_10334310 3300006058 Bacteria 638
72 Ga0075432_10546162 3300006058 Bacteria 523
73 Ga0068871_101491217 3300006358 Bacteria 639
74 Ga0075428_100636775 3300006844 Bacteria 1137
75 Ga0075434_102076831 3300006871 Bacteria 573
76 Ga0075429_100269349 3300006880 Bacteria 1492
77 Ga0068865_100456029 3300006881 Bacteria 1058
78 Ga0111539_10061526 3300009094 Bacteria 4448
79 Ga0111539_11379727 3300009094 Bacteria 818
80 Ga0111539_12199905 3300009094 Bacteria 640
81 Ga0105245_10054905 3300009098 Bacteria 3577
82 Ga0105245_10383387 3300009098 Bacteria 1400
83 Ga0105245_11147186 3300009098 Bacteria 824
84 Ga0105247_11413174 3300009101 Bacteria 564
85 Ga0114129_10849918 3300009147 Bacteria 1160
86 Ga0105242_13177716 3300009176 Bacteria 510
87 Ga0105248_11393225 3300009177 Bacteria 793
88 Ga0105238_10143400 3300009551 Bacteria 2365
89 Ga0105238_10230530 3300009551 Bacteria 1829
90 Ga0105238_11272515 3300009551 Bacteria 761
91 Ga0105238_12489981 3300009551 Bacteria 553
92 Ga0105249_11701728 3300009553 Unclassified 703
93 Ga0105249_11822850 3300009553 Bacteria 681
94 Ga0105249_12391707 3300009553 Bacteria 601
95 Ga0105028_129715 3300009993 Bacteria 608
96 Ga0105239_10716948 3300010375 Bacteria 1144
97 Ga0105239_11588478 3300010375 Bacteria 756
98 Ga0105239_12399216 3300010375 Bacteria 614
99 Ga0105246_10567840 3300011119 Bacteria 975
100 Ga0105246_11054323 3300011119 Bacteria 739
101 Ga0105246_11942736 3300011119 Bacteria 566
102 Ga0154012_164414 3300013059 Bacteria 751
103 Ga0157369_10605882 3300013105 Bacteria 1130
104 Ga0157369_11772893 3300013105 Bacteria 627
105 Ga0163162_11406699 3300013306 Bacteria 794
106 Ga0157372_10731295 3300013307 Bacteria 1151
107 Ga0157372_12024538 3300013307 Bacteria 662
108 Ga0157375_10851107 3300013308 Bacteria 1058
109 Ga0157380_10074635 3300014326 Bacteria 2753
110 Ga0157380_10877463 3300014326 Bacteria 921
111 Ga0182008_10208391 3300014497 Bacteria 997
112 Ga0182008_10597574 3300014497 Bacteria 619
113 Ga0182008_10821377 3300014497 Bacteria 541
114 Ga0157377_10002458 3300014745 Bacteria 8197
115 Ga0157377_10434304 3300014745 Bacteria 903
116 Ga0157376_10922314 3300014969 Bacteria 892
117 Ga0197907_10630497 3300020069 Bacteria 527
118 Ga0197907_10891044 3300020069 Bacteria 1981
119 Ga0206356_11194614 3300020070 Bacteria 953
120 Ga0206356_11805502 3300020070 Bacteria 1622
121 Ga0206355_1455406 3300020076 Bacteria 625
122 Ga0206355_1471582 3300020076 Bacteria 795
123 Ga0206351_10568952 3300020077 Bacteria 740
124 Ga0206352_10209109 3300020078 Bacteria 1199
125 Ga0206350_10810804 3300020080 Bacteria 2643
126 Ga0206350_11249551 3300020080 Bacteria 544
127 Ga0206354_11111046 3300020081 Bacteria 1396
128 Ga0206353_10049132 3300020082 Bacteria 5636
129 Ga0206353_10996235 3300020082 Bacteria 598
130 Ga0206353_11519944 3300020082 Bacteria 1024
131 Ga0206353_11861475 3300020082 Bacteria 574
132 Ga0154015_1515389 3300020610 Bacteria 567
133 Ga0154015_1536075 3300020610 Bacteria 533
134 Ga0207656_10641790 3300025321 Bacteria 543
135 Ga0207688_10014334 3300025901 Bacteria 4314
136 Ga0207680_10105932 3300025903 Bacteria 1815
137 Ga0207705_10042138 3300025909 Bacteria 3277
138 Ga0207684_10746997 3300025910 Bacteria 829
139 Ga0207707_11283754 3300025912 Bacteria 589
140 Ga0207693_10522257 3300025915 Bacteria 926
141 Ga0207657_10148289 3300025919 Bacteria 1912
142 Ga0207657_11268589 3300025919 Bacteria 558
143 Ga0207649_10957512 3300025920 Bacteria 672
144 Ga0207652_10667144 3300025921 Bacteria 929
145 Ga0207681_10357743 3300025923 Bacteria 1170
146 Ga0207681_10703240 3300025923 Bacteria 840
147 Ga0207659_10010619 3300025926 Bacteria 5792
148 Ga0207687_10065248 3300025927 Bacteria 2585
149 Ga0207700_10256969 3300025928 Bacteria 1494
150 Ga0207700_10301141 3300025928 Bacteria 1385
151 Ga0207644_10655291 3300025931 Bacteria 874
152 Ga0207644_10927753 3300025931 Bacteria 730
153 Ga0207644_11356159 3300025931 Bacteria 598
154 Ga0207690_10615106 3300025932 Bacteria 888
155 Ga0207706_10117334 3300025933 Bacteria 2341
156 Ga0207706_10149625 3300025933 Bacteria 2053
157 Ga0207669_10289244 3300025937 Bacteria 1240
158 Ga0207665_11001461 3300025939 Bacteria 665
159 Ga0207691_10239860 3300025940 Bacteria 1568
160 Ga0207691_11178560 3300025940 Bacteria 636
161 Ga0207689_10014936 3300025942 Bacteria 6589
162 Ga0207661_10043467 3300025944 Bacteria 3545
163 Ga0207661_10133129 3300025944 Bacteria 2132
164 Ga0207661_10356559 3300025944 Bacteria 1320
165 Ga0207661_10891546 3300025944 Bacteria 819
166 Ga0207679_10009919 3300025945 Bacteria 6114
167 Ga0207668_10000757 3300025972 Bacteria 19740
168 Ga0207640_10087883 3300025981 Bacteria 2144
169 Ga0207640_10365524 3300025981 Bacteria 1164
170 Ga0207658_10396529 3300025986 Bacteria 1212
171 Ga0207658_11644795 3300025986 Bacteria 587
172 Ga0207677_10002514 3300026023 Bacteria 9610
173 Ga0207677_10265466 3300026023 Bacteria 1401
174 Ga0207677_11175478 3300026023 Bacteria 702
175 Ga0207677_11607803 3300026023 Unclassified 602
176 Ga0207703_10408143 3300026035 Bacteria 1262
177 Ga0207678_10013394 3300026067 Bacteria 7198
178 Ga0207678_10078361 3300026067 Bacteria 2830
179 Ga0207708_10133133 3300026075 Bacteria 1945
180 Ga0207676_10055506 3300026095 Bacteria 3110
181 Ga0207676_10443121 3300026095 Unclassified 1223
182 Ga0207676_10669740 3300026095 Bacteria 1003
183 Ga0207676_11522135 3300026095 Bacteria 666
184 Ga0207674_10059415 3300026116 Bacteria 3869
185 Ga0207674_10075061 3300026116 Bacteria 3391
186 Ga0207674_11182617 3300026116 Bacteria 734
187 Ga0207683_10391782 3300026121 Bacteria 1277
188 Ga0207698_10040742 3300026142 Bacteria 3455
189 Ga0207428_10346831 3300027907 Bacteria 1093
190 Ga0268265_10036792 3300028380 Bacteria 3588
191 Ga0268265_10134399 3300028380 Bacteria 2061
192 Ga0268265_10706929 3300028380 Bacteria 974
193 Ga0268264_10204658 3300028381 Bacteria 1808
194 Ga0307517_10063965 3300028786 Bacteria 3429
195 Ga0307515_10008535 3300028794 Bacteria 19952
196 Ga0307515_10084722 3300028794 Bacteria 4066
197 Ga0268256_1082534 3300030500 Bacteria 599
198 Ga0307512_10001676 3300030522 Bacteria 30385
199 Ga0307512_10014602 3300030522 Bacteria 7311
200 Ga0307512_10125616 3300030522 Bacteria 1630
201 Ga0316182_1011673 3300030745 Bacteria 700
202 Ga0307513_10008452 3300031456 Bacteria 13170
203 Ga0307513_10021746 3300031456 Bacteria 7567
204 Ga0307513_10182323 3300031456 Bacteria 1961
205 Ga0307509_10014414 3300031507 Bacteria 9292
206 Ga0307408_100083276 3300031548 Bacteria 2396
207 Ga0307408_100707911 3300031548 Bacteria 906
208 Ga0307408_101016592 3300031548 Bacteria 765
209 Ga0307508_10002975 3300031616 Bacteria 17487
210 Ga0307508_10650899 3300031616 Bacteria 659
211 Ga0307516_10000514 3300031730 Bacteria 51755
212 Ga0307405_10057227 3300031731 Bacteria 2449
213 Ga0307405_10379695 3300031731 Bacteria 1100
214 Ga0307405_10414270 3300031731 Bacteria 1058
215 Ga0307405_10685461 3300031731 Bacteria 847
216 Ga0307405_11400952 3300031731 Bacteria 611
217 Ga0307413_10017035 3300031824 Bacteria 3775
218 Ga0307413_10102725 3300031824 Bacteria 1893
219 Ga0307413_11249677 3300031824 Bacteria 648
220 Ga0307413_11375216 3300031824 Bacteria 620
221 Ga0307410_10043495 3300031852 Bacteria 2977
222 Ga0307410_10092691 3300031852 Bacteria 2148
223 Ga0307410_10196949 3300031852 Bacteria 1536
224 Ga0307410_10481826 3300031852 Bacteria 1018
225 Ga0307410_10683987 3300031852 Bacteria 863
226 Ga0307410_11715334 3300031852 Bacteria 557
227 Ga0307406_10178926 3300031901 Bacteria 1542
228 Ga0307406_10191242 3300031901 Bacteria 1498
229 Ga0307406_10253914 3300031901 Bacteria 1326
230 Ga0307406_10304686 3300031901 Bacteria 1226
231 Ga0307406_10314609 3300031901 Bacteria 1208
232 Ga0307407_10043954 3300031903 Bacteria 2515
233 Ga0307407_10171457 3300031903 Bacteria 1430
234 Ga0307407_10184410 3300031903 Bacteria 1385
235 Ga0307407_10338557 3300031903 Bacteria 1061
236 Ga0307407_10408635 3300031903 Bacteria 976
237 Ga0307407_10793267 3300031903 Bacteria 720
238 Ga0307407_10800002 3300031903 Bacteria 717
239 Ga0307407_11214775 3300031903 Bacteria 589
240 Ga0307407_11236618 3300031903 Bacteria 584
241 Ga0307412_10090946 3300031911 Bacteria 2135
242 Ga0307412_10170906 3300031911 Bacteria 1625
243 Ga0307412_10290798 3300031911 Bacteria 1287
244 Ga0307412_11641888 3300031911 Bacteria 588
245 Ga0307409_100003834 3300031995 Bacteria 8300
246 Ga0307409_100032764 3300031995 Bacteria 3773
247 Ga0307409_100052922 3300031995 Bacteria 3116
248 Ga0307409_100084451 3300031995 Bacteria 2578
249 Ga0307409_100412760 3300031995 Bacteria 1293
250 Ga0307409_100745743 3300031995 Bacteria 982
251 Ga0307409_100920628 3300031995 Bacteria 889
252 Ga0307409_100962291 3300031995 Bacteria 870
253 Ga0307409_101328906 3300031995 Bacteria 744
254 Ga0307409_101466139 3300031995 Bacteria 709
255 Ga0307409_102162541 3300031995 Bacteria 586
256 Ga0307416_100031872 3300032002 Bacteria 3974
257 Ga0307416_100056511 3300032002 Bacteria 3168
258 Ga0307416_100064099 3300032002 Bacteria 3013
259 Ga0307416_100069892 3300032002 Bacteria 2908
260 Ga0307416_100120669 3300032002 Bacteria 2335
261 Ga0307416_100261486 3300032002 Bacteria 1692
262 Ga0307416_100308636 3300032002 Bacteria 1577
263 Ga0307416_100426985 3300032002 Bacteria 1371
264 Ga0307416_100813115 3300032002 Bacteria 1031
265 Ga0307416_101736152 3300032002 Bacteria 728
266 Ga0307414_10276805 3300032004 Bacteria 1408
267 Ga0307414_10292278 3300032004 Bacteria 1374
268 Ga0307414_10462611 3300032004 Bacteria 1115
269 Ga0307414_11423565 3300032004 Bacteria 644
270 Ga0307411_10021367 3300032005 Bacteria 3786
271 Ga0307411_10096022 3300032005 Bacteria 2083
272 Ga0307411_10742694 3300032005 Bacteria 859
273 Ga0307411_11672790 3300032005 Bacteria 589
274 Ga0307415_100055068 3300032126 Bacteria 2719
275 Ga0307415_100085942 3300032126 Bacteria 2262
276 Ga0307415_100115076 3300032126 Bacteria 2004
277 Ga0307415_100142208 3300032126 Bacteria 1834
278 Ga0307415_100253085 3300032126 Bacteria 1432
279 Ga0307415_100334846 3300032126 Bacteria 1268
280 Ga0307415_100335919 3300032126 Bacteria 1266
281 Ga0307415_100345639 3300032126 Bacteria 1250
282 Ga0307415_100792123 3300032126 Bacteria 864
283 Ga0307415_100900809 3300032126 Bacteria 815
284 Ga0307415_101070540 3300032126 Bacteria 753
285 Ga0307415_101149131 3300032126 Bacteria 729
286 Ga0307415_101328361 3300032126 Bacteria 682
287 Ga0307415_101711237 3300032126 Bacteria 607
288 Ga0307507_10035136 3300033179 Bacteria 5156
289 Ga0307510_10221345 3300033180 Bacteria 1404
290 Ga0373950_0008389 3300034818 Bacteria 1625
291 Ga0373938_0008158 3300034957 Bacteria 1863
292 Ga0373940_0012182 3300035088 Bacteria 2056
293 Ga0373951_0000832 3300035091 Bacteria 8390
294 Ga0373932_0019460 3300035112 Bacteria 1770
295 Ga0373942_0000686 3300035207 Bacteria 9461
296 Ga0395900_0052224 3300037418 Bacteria 4208
297 Ga0395900_0056515 3300037418 Bacteria 4039
298 Ga0395900_0264622 3300037418 Bacteria 1716
299 Ga0395898_0106940 3300037466 Bacteria 2683
300 Ga0395898_0370041 3300037466 Bacteria 1367
301 Ga0395905_0235696 3300037471 Bacteria 1711
302 Ga0395901_0104187 3300038443 Bacteria 2977
303 Ga0395901_0226439 3300038443 Bacteria 1953
304 Ga0395901_0794633 3300038443 Bacteria 936
305 Ga0436363_1029416 3300039450 Bacteria 587
306 Ga0451791_1259295 3300041451 Bacteria 1452
307 Ga0451791_1719071 3300041451 Bacteria 607
308 Ga0451797_0880651 3300041453 Bacteria 509
309 Ga0451807_2584555 3300041486 Bacteria 1119
310 Ga0451833_0011502 3300041491 Bacteria 634
311 Ga0451837_0724673 3300041494 Bacteria 617
312 Ga0451837_0724819 3300041494 Bacteria 875
313 Ga0451839_0696778 3300041496 Bacteria 656
314 Ga0451845_0332613 3300041501 Bacteria 829
315 Ga0451855_0775083 3300041511 Bacteria 714
316 Ga0439443_092044 3300042003 Bacteria 573
317 Ga0439448_0012276 3300042005 Bacteria 2561
318 Ga0439451_134325 3300042009 Bacteria 506
319 Ga0439454_062992 3300042011 Bacteria 646
320 Ga0439455_0075257 3300042012 Bacteria 912
321 Ga0439463_005999 3300042016 Bacteria 3018
322 Ga0439463_029006 3300042016 Bacteria 1394
323 Ga0439459_0042808 3300042438 Bacteria 968
324 Ga0439464_0096579 3300042439 Bacteria 895
325 Ga0439464_0126076 3300042439 Bacteria 791
326 Ga0439464_0167282 3300042439 Bacteria 692
327 Ga0439464_0307759 3300042439 Bacteria 518
328 Ga0439460_0020348 3300042461 Bacteria 1804
329 Ga0450893_0070250 3300042532 Bacteria 680
330 Ga0439440_0233827 3300042993 Bacteria 555
331 Ga0466969_0249956 3300044656 Bacteria 804
332 Ga0466972_0575822 3300044658 Bacteria 532
333 Ga0466965_0051845 3300044683 Bacteria 2036
334 Ga0466966_0203724 3300044684 Bacteria 1197
335 Ga0466961_0615854 3300044693 Bacteria 652
336 Ga0466961_0655269 3300044693 Bacteria 630
337 Ga0466963_0034531 3300044694 Bacteria 3290
338 Ga0466963_0283863 3300044694 Bacteria 1164
339 Ga0466963_0297268 3300044694 Bacteria 1135
340 Ga0466964_0149836 3300044706 Bacteria 1080
341 Ga0466964_0188426 3300044706 Bacteria 983
342 Ga0466971_0042789 3300044719 Bacteria 2035
343 Ga0466971_0188418 3300044719 Bacteria 971
344 Ga0466970_0032411 3300044765 Bacteria 2761
345 Ga0466970_0247359 3300044765 Bacteria 999
346 Ga0466957_0024404 3300044842 Bacteria 3578
347 Ga0466957_0088524 3300044842 Bacteria 1937
348 Ga0466957_0098826 3300044842 Bacteria 1837
349 Ga0466957_0427415 3300044842 Bacteria 910
350 Ga0466960_0030399 3300044901 Bacteria 2485
351 Ga0466960_0105416 3300044901 Bacteria 1457
352 Ga0466960_0115406 3300044901 Bacteria 1400
353 Ga0466960_0355884 3300044901 Bacteria 836
354 Ga0466960_0394572 3300044901 Bacteria 796
355 Ga0466960_0516222 3300044901 Bacteria 701
356 Ga0466960_0802292 3300044901 Bacteria 570
357 Ga0466959_0058524 3300045049 Bacteria 2807
358 Ga0466959_0083898 3300045049 Bacteria 2294
359 Ga0466959_0129814 3300045049 Bacteria 1786
360 Ga0466958_0090832 3300045836 Bacteria 1890
361 Ga0466958_0456562 3300045836 Bacteria 827
362 Ga0466967_0008152 3300045976 Bacteria 7648
363 Ga0466967_0033970 3300045976 Bacteria 4323
364 Ga0466967_0161072 3300045976 Bacteria 2106
365 Ga0466967_0364613 3300045976 Bacteria 1400
366 Ga0466967_0906657 3300045976 Bacteria 877
367 Ga0495631_0050230 3300046518 Bacteria 1825
368 Ga0495656_0048579 3300046615 Bacteria 1804
369 Ga0495636_0412487 3300047318 Bacteria 645
370 Ga0495674_0292081 3300047319 Bacteria 1333
371 Ga0495615_0313863 3300048090 Bacteria 511
372 Ga0496101_0916901 3300048904 Bacteria 690
373 Ga0496102_1380048 3300048905 Bacteria 624
374 Ga0496103_0163290 3300048906 Bacteria 1429
375 Ga0496103_0932690 3300048906 Bacteria 543
376 Ga0496105_0021483 3300048908 Bacteria 5222
377 Ga0496105_0211753 3300048908 Bacteria 1580
378 Ga0496105_0538543 3300048908 Bacteria 913
379 Ga0496106_0310400 3300048909 Bacteria 1265
380 Ga0496108_0000079 3300048911 Bacteria 103605
381 Ga0496108_0318488 3300048911 Bacteria 1356
382 Ga0496110_0149301 3300048913 Bacteria 2116
383 Ga0496112_0431161 3300048915 Bacteria 1257
384 Ga0496124_0330359 3300048927 Bacteria 1088
385 Ga0496126_0078468 3300048929 Bacteria 2926
386 Ga0501290_065779 3300049513 Bacteria 593
387 Ga0501315_051742 3300049531 Bacteria 647
388 Ga0501032_0089426 3300049569 Bacteria 2044
389 Ga0501033_0221963 3300049570 Bacteria 1345
390 Ga0501034_0680609 3300049571 Bacteria 928
391 Ga0501036_0004305 3300049572 Bacteria 11499
392 Ga0501037_0010126 3300049573 Bacteria 6919
393 Ga0501038_0021094 3300049574 Bacteria 5852
394 Ga0501039_0084948 3300049575 Bacteria 2465
395 Ga0501041_0005222 3300049577 Bacteria 7585
396 Ga0501042_0034728 3300049578 Bacteria 3577
397 Ga0501043_0229184 3300049579 Bacteria 1435
398 Ga0501048_0072789 3300049582 Bacteria 2426
399 Ga0501048_0941946 3300049582 Bacteria 621
400 Ga0501070_0102439 3300049586 Bacteria 2368
401 Ga0501071_0003771 3300049587 Bacteria 9520
402 Ga0501072_0058226 3300049588 Bacteria 3045
403 Ga0501075_0002209 3300049591 Bacteria 12886
404 Ga0501076_0024155 3300049592 Bacteria 4694
405 Ga0501077_0007400 3300049593 Bacteria 6769
406 Ga0501206_028797 3300049653 Bacteria 819
407 Ga0501240_074806 3300049673 Bacteria 619
408 Ga0501248_029391 3300049678 Bacteria 619
409 Ga0501079_0016045 3300049741 Bacteria 5723
410 Ga0501080_0018698 3300049742 Bacteria 6413
411 Ga0501081_0072956 3300049743 Bacteria 2394
412 Ga0501083_0382735 3300049744 Bacteria 915
413 Ga0501035_0331328 3300049822 Bacteria 1277
414 Ga0501044_0237684 3300049823 Bacteria 1767
415 Ga0501045_1231249 3300049824 Bacteria 546
416 nmdc:mga05p37_2227476_c1 3300050507 Bacteria 508
417 nmdc:mga05p37_47311_c1 3300050507 Bacteria 5291
418 nmdc:mga05p37_711357_c1 3300050507 Bacteria 1114
419 nmdc:mga05p37_778735_c1 3300050507 Bacteria 1050
420 nmdc:mga0qj67_549853_c1 3300050509 Bacteria 926
421 nmdc:mga06r32_495461_c1 3300050510 Bacteria 1199
422 nmdc:mga08y16_14530_c1 3300050511 Bacteria 8282
423 nmdc:mga0n895_1607524_c1 3300050512 Bacteria 614
424 Ga0495595_0433562 3300053084 Bacteria 667
425 Ga0500644_0131166 3300053088 Bacteria 987
426 Ga0500646_0066813 3300053090 Bacteria 1071
427 Ga0500562_048902 3300053108 Bacteria 1130
428 Ga0500569_063498 3300053109 Bacteria 1146
429 Ga0500588_0133847 3300053146 Bacteria 885
430 Ga0500600_0145246 3300053149 Bacteria 1188
431 Ga0501084_0060135 3300054114 Bacteria 3181
432 Ga0501082_0099869 3300060353 Bacteria 2509
433 Ga0466962_0218708 3300061719 Bacteria 933
434 Ga0466962_0261958 3300061719 Bacteria 851
435 Ga0530510_0017493 3300061734 Bacteria 5081
436 2501942509 2501939600 Bacteria 6907073
437 2623499841 2622736605 Bacteria 4992138
438 2753263414 2751185782 Bacteria 11227053
439 2772642310 2772190715 Bacteria 6959372
440 2799183035 2799112218 Bacteria 4315149
441 2816503648 2816332139 Bacteria 9138787
442 2832009479 2832004796 Bacteria 6538017
443 2855671312 2855670206 Bacteria 7120389
444 2855678558 2855676851 Bacteria 7063653
445 2855688551 2855683550 Bacteria 7134265
446 2856860817 2856858025 Bacteria 7255264
447 2857292009 2857288857 Bacteria 7189066
448 2858850796 2858848962 Bacteria 6963058
449 2858869753 2858868258 Bacteria 7683772
450 2858883831 2858882152 Bacteria 7230291
451 2858890016 2858888857 Bacteria 7060307
452 2858900950 2858895516 Bacteria 7378898
453 2858903555 2858902515 Bacteria 7086037
454 2866067729 2866065130 Bacteria 6518152
455 2867306425 2867302475 Bacteria 7087181
456 2867315874 2867312974 Bacteria 7058875
457 2867323659 2867319477 Bacteria 7069771
458 2869053981 2869048445 Bacteria 6875584
459 2869063683 2869061728 Bacteria 7112407
460 2869070904 2869068681 Bacteria 7205615
461 2880493307 2880489317 Bacteria 7096270
462 2880498993 2880495981 Bacteria 7340502
463 2902587257 2902582711 Bacteria 6187705
464 2929221012 2929219909 Bacteria 6984360
465 2929227583 2929226422 Bacteria 7248583
466 2996222471 2996221748 Bacteria 6799777
467 649811550 649633069 Bacteria 6962533
468 8003831931 8003830390 Bacteria 6541657
469 8003858972 8003856774 Bacteria 7675274
470 8003874462 8003870546 Bacteria 7396674
471 8054710770 8054704163 Bacteria 7247792
472 8054727422 8054727385 Bacteria 7558670
473 8054734871 8054734606 Bacteria 6947278
474 8055418632 8055412473 Bacteria 6257500
475 Ga0495620_0140702
476 JGI25406J46586_10032546
477 rootH1_10127582
478 Ga0070658_11355030
479 Ga0070658_11918810
480 Ga0070683_100113470
481 Ga0070683_100280688
482 Ga0070683_100301397
483 Ga0070670_100269211
484 Ga0070670_100709297
485 Ga0068869_100008890
486 Ga0070682_100685934
487 Ga0068868_100082087
488 Ga0070660_100120725
489 Ga0070660_100479436
490 Ga0070689_101240534
491 Ga0070687_100381792
492 Ga0070687_101019809
493 Ga0070661_100074879
494 Ga0070668_100000918
495 Ga0070669_100565489
496 Ga0070675_100001359
497 Ga0070671_100381137
498 Ga0070671_100785259
499 Ga0070674_100349956
500 Ga0070659_100128594
501 Ga0070659_102027892
502 Ga0070667_100129487
503 Ga0070714_100019144
504 Ga0070713_100346930
505 Ga0070713_100496965
506 Ga0070700_100094663
507 Ga0070663_100092830
508 Ga0070662_100050743
509 Ga0070681_10824876
510 Ga0070681_11699114
511 Ga0068867_101930132
512 Ga0070685_10175996
513 Ga0070685_11226902
514 Ga0070706_101193021
515 Ga0070679_100757920
516 Ga0070684_100311308
517 Ga0068853_100069136
518 Ga0070672_100426047
519 Ga0070672_100487674
520 Ga0070693_100100653
521 Ga0070693_101487961
522 Ga0070665_100338737
523 Ga0070664_100008333
524 Ga0070664_100373784
525 Ga0068857_100063049
526 Ga0068852_100042936
527 Ga0068852_101578115
528 Ga0068864_100149442
529 Ga0068864_100846906
530 Ga0068851_10342623
531 Ga0068870_10891241
532 Ga0068863_100551620
533 Ga0068863_101883497
534 Ga0068858_100076244
535 Ga0068860_100021642
536 Ga0068860_100330069
537 Ga0068860_100390553
538 Ga0068862_100071478
539 Ga0068862_100289215
540 Ga0068862_102428448
541 Ga0081540_1009244
542 Ga0081539_10001178
543 Ga0081539_10239819
544 Ga0070717_10818726
545 Ga0075432_10334310
546 Ga0075432_10546162
547 Ga0068871_101491217
548 Ga0075428_100636775
549 Ga0075434_102076831
550 Ga0075429_100269349
551 Ga0068865_100456029
552 Ga0111539_10061526
553 Ga0111539_11379727
554 Ga0111539_12199905
555 Ga0105245_10054905
556 Ga0105245_10383387
557 Ga0105245_11147186
558 Ga0105247_11413174
559 Ga0114129_10849918
560 Ga0105242_13177716
561 Ga0105248_11393225
562 Ga0105238_10143400
563 Ga0105238_10230530
564 Ga0105238_11272515
565 Ga0105238_12489981
566 Ga0105249_11701728
567 Ga0105249_11822850
568 Ga0105249_12391707
569 Ga0105028_129715
570 Ga0105239_10716948
571 Ga0105239_11588478
572 Ga0105239_12399216
573 Ga0105246_10567840
574 Ga0105246_11054323
575 Ga0105246_11942736
576 Ga0154012_164414
577 Ga0157369_10605882
578 Ga0157369_11772893
579 Ga0163162_11406699
580 Ga0157372_10731295
581 Ga0157372_12024538
582 Ga0157375_10851107
583 Ga0157380_10074635
584 Ga0157380_10877463
585 Ga0182008_10208391
586 Ga0182008_10597574
587 Ga0182008_10821377
588 Ga0157377_10002458
589 Ga0157377_10434304
590 Ga0157376_10922314
591 Ga0197907_10630497
592 Ga0197907_10891044
593 Ga0206356_11194614
594 Ga0206356_11805502
595 Ga0206355_1455406
596 Ga0206355_1471582
597 Ga0206351_10568952
598 Ga0206352_10209109
599 Ga0206350_10810804
600 Ga0206350_11249551
601 Ga0206354_11111046
602 Ga0206353_10049132
603 Ga0206353_10996235
604 Ga0206353_11519944
605 Ga0206353_11861475
606 Ga0154015_1515389
607 Ga0154015_1536075
608 Ga0207656_10641790
609 Ga0207688_10014334
610 Ga0207680_10105932
611 Ga0207705_10042138
612 Ga0207684_10746997
613 Ga0207707_11283754
614 Ga0207693_10522257
615 Ga0207657_10148289
616 Ga0207657_11268589
617 Ga0207649_10957512
618 Ga0207652_10667144
619 Ga0207681_10357743
620 Ga0207681_10703240
621 Ga0207659_10010619
622 Ga0207687_10065248
623 Ga0207700_10256969
624 Ga0207700_10301141
625 Ga0207644_10655291
626 Ga0207644_10927753
627 Ga0207644_11356159
628 Ga0207690_10615106
629 Ga0207706_10117334
630 Ga0207706_10149625
631 Ga0207669_10289244
632 Ga0207665_11001461
633 Ga0207691_10239860
634 Ga0207691_11178560
635 Ga0207689_10014936
636 Ga0207661_10043467
637 Ga0207661_10133129
638 Ga0207661_10356559
639 Ga0207661_10891546
640 Ga0207679_10009919
641 Ga0207668_10000757
642 Ga0207640_10087883
643 Ga0207640_10365524
644 Ga0207658_10396529
645 Ga0207658_11644795
646 Ga0207677_10002514
647 Ga0207677_10265466
648 Ga0207677_11175478
649 Ga0207677_11607803
650 Ga0207703_10408143
651 Ga0207678_10013394
652 Ga0207678_10078361
653 Ga0207708_10133133
654 Ga0207676_10055506
655 Ga0207676_10443121
656 Ga0207676_10669740
657 Ga0207676_11522135
658 Ga0207674_10059415
659 Ga0207674_10075061
660 Ga0207674_11182617
661 Ga0207683_10391782
662 Ga0207698_10040742
663 Ga0207428_10346831
664 Ga0268265_10036792
665 Ga0268265_10134399
666 Ga0268265_10706929
667 Ga0268264_10204658
668 Ga0307517_10063965
669 Ga0307515_10008535
670 Ga0307515_10084722
671 Ga0268256_1082534
672 Ga0307512_10001676
673 Ga0307512_10014602
674 Ga0307512_10125616
675 Ga0316182_1011673
676 Ga0307513_10008452
677 Ga0307513_10021746
678 Ga0307513_10182323
679 Ga0307509_10014414
680 Ga0307408_100083276
681 Ga0307408_100707911
682 Ga0307408_101016592
683 Ga0307508_10002975
684 Ga0307508_10650899
685 Ga0307516_10000514
686 Ga0307405_10057227
687 Ga0307405_10379695
688 Ga0307405_10414270
689 Ga0307405_10685461
690 Ga0307405_11400952
691 Ga0307413_10017035
692 Ga0307413_10102725
693 Ga0307413_11249677
694 Ga0307413_11375216
695 Ga0307410_10043495
696 Ga0307410_10092691
697 Ga0307410_10196949
698 Ga0307410_10481826
699 Ga0307410_10683987
700 Ga0307410_11715334
701 Ga0307406_10178926
702 Ga0307406_10191242
703 Ga0307406_10253914
704 Ga0307406_10304686
705 Ga0307406_10314609
706 Ga0307407_10043954
707 Ga0307407_10171457
708 Ga0307407_10184410
709 Ga0307407_10338557
710 Ga0307407_10408635
711 Ga0307407_10793267
712 Ga0307407_10800002
713 Ga0307407_11214775
714 Ga0307407_11236618
715 Ga0307412_10090946
716 Ga0307412_10170906
717 Ga0307412_10290798
718 Ga0307412_11641888
719 Ga0307409_100003834
720 Ga0307409_100032764
721 Ga0307409_100052922
722 Ga0307409_100084451
723 Ga0307409_100412760
724 Ga0307409_100745743
725 Ga0307409_100920628
726 Ga0307409_100962291
727 Ga0307409_101328906
728 Ga0307409_101466139
729 Ga0307409_102162541
730 Ga0307416_100031872
731 Ga0307416_100056511
732 Ga0307416_100064099
733 Ga0307416_100069892
734 Ga0307416_100120669
735 Ga0307416_100261486
736 Ga0307416_100308636
737 Ga0307416_100426985
738 Ga0307416_100813115
739 Ga0307416_101736152
740 Ga0307414_10276805
741 Ga0307414_10292278
742 Ga0307414_10462611
743 Ga0307414_11423565
744 Ga0307411_10021367
745 Ga0307411_10096022
746 Ga0307411_10742694
747 Ga0307411_11672790
748 Ga0307415_100055068
749 Ga0307415_100085942
750 Ga0307415_100115076
751 Ga0307415_100142208
752 Ga0307415_100253085
753 Ga0307415_100334846
754 Ga0307415_100335919
755 Ga0307415_100345639
756 Ga0307415_100792123
757 Ga0307415_100900809
758 Ga0307415_101070540
759 Ga0307415_101149131
760 Ga0307415_101328361
761 Ga0307415_101711237
762 Ga0307507_10035136
763 Ga0307510_10221345
764 Ga0373950_0008389
765 Ga0373938_0008158
766 Ga0373940_0012182
767 Ga0373951_0000832
768 Ga0373932_0019460
769 Ga0373942_0000686
770 Ga0395900_0052224
771 Ga0395900_0056515
772 Ga0395900_0264622
773 Ga0395898_0106940
774 Ga0395898_0370041
775 Ga0395905_0235696
776 Ga0395901_0104187
777 Ga0395901_0226439
778 Ga0395901_0794633
779 Ga0436363_1029416
780 Ga0451791_1259295
781 Ga0451791_1719071
782 Ga0451797_0880651
783 Ga0451807_2584555
784 Ga0451833_0011502
785 Ga0451837_0724673
786 Ga0451837_0724819
787 Ga0451839_0696778
788 Ga0451845_0332613
789 Ga0451855_0775083
790 Ga0439443_092044
791 Ga0439448_0012276
792 Ga0439451_134325
793 Ga0439454_062992
794 Ga0439455_0075257
795 Ga0439463_005999
796 Ga0439463_029006
797 Ga0439459_0042808
798 Ga0439464_0096579
799 Ga0439464_0126076
800 Ga0439464_0167282
801 Ga0439464_0307759
802 Ga0439460_0020348
803 Ga0450893_0070250
804 Ga0439440_0233827
805 Ga0466969_0249956
806 Ga0466972_0575822
807 Ga0466965_0051845
808 Ga0466966_0203724
809 Ga0466961_0615854
810 Ga0466961_0655269
811 Ga0466963_0034531
812 Ga0466963_0283863
813 Ga0466963_0297268
814 Ga0466964_0149836
815 Ga0466964_0188426
816 Ga0466971_0042789
817 Ga0466971_0188418
818 Ga0466970_0032411
819 Ga0466970_0247359
820 Ga0466957_0024404
821 Ga0466957_0088524
822 Ga0466957_0098826
823 Ga0466957_0427415
824 Ga0466960_0030399
825 Ga0466960_0105416
826 Ga0466960_0115406
827 Ga0466960_0355884
828 Ga0466960_0394572
829 Ga0466960_0516222
830 Ga0466960_0802292
831 Ga0466959_0058524
832 Ga0466959_0083898
833 Ga0466959_0129814
834 Ga0466958_0090832
835 Ga0466958_0456562
836 Ga0466967_0008152
837 Ga0466967_0033970
838 Ga0466967_0161072
839 Ga0466967_0364613
840 Ga0466967_0906657
841 Ga0495631_0050230
842 Ga0495656_0048579
843 Ga0495636_0412487
844 Ga0495674_0292081
845 Ga0495615_0313863
846 Ga0496101_0916901
847 Ga0496102_1380048
848 Ga0496103_0163290
849 Ga0496103_0932690
850 Ga0496105_0021483
851 Ga0496105_0211753
852 Ga0496105_0538543
853 Ga0496106_0310400
854 Ga0496108_0000079
855 Ga0496108_0318488
856 Ga0496110_0149301
857 Ga0496112_0431161
858 Ga0496124_0330359
859 Ga0496126_0078468
860 Ga0501290_065779
861 Ga0501315_051742
862 Ga0501032_0089426
863 Ga0501033_0221963
864 Ga0501034_0680609
865 Ga0501036_0004305
866 Ga0501037_0010126
867 Ga0501038_0021094
868 Ga0501039_0084948
869 Ga0501041_0005222
870 Ga0501042_0034728
871 Ga0501043_0229184
872 Ga0501048_0072789
873 Ga0501048_0941946
874 Ga0501070_0102439
875 Ga0501071_0003771
876 Ga0501072_0058226
877 Ga0501075_0002209
878 Ga0501076_0024155
879 Ga0501077_0007400
880 Ga0501206_028797
881 Ga0501240_074806
882 Ga0501248_029391
883 Ga0501079_0016045
884 Ga0501080_0018698
885 Ga0501081_0072956
886 Ga0501083_0382735
887 Ga0501035_0331328
888 Ga0501044_0237684
889 Ga0501045_1231249
890 nmdc:mga05p37_2227476_c1
891 nmdc:mga05p37_47311_c1
892 nmdc:mga05p37_711357_c1
893 nmdc:mga05p37_778735_c1
894 nmdc:mga0qj67_549853_c1
895 nmdc:mga06r32_495461_c1
896 nmdc:mga08y16_14530_c1
897 nmdc:mga0n895_1607524_c1
898 Ga0495595_0433562
899 Ga0500644_0131166
900 Ga0500646_0066813
901 Ga0500562_048902
902 Ga0500569_063498
903 Ga0500588_0133847
904 Ga0500600_0145246
905 Ga0501084_0060135
906 Ga0501082_0099869
907 Ga0466962_0218708
908 Ga0466962_0261958
909 Ga0530510_0017493
910 2501942509
911 2623499841
912 2753263414
913 2772642310
914 2799183035
915 2816503648
916 2832009479
917 2855671312
918 2855678558
919 2855688551
920 2856860817
921 2857292009
922 2858850796
923 2858869753
924 2858883831
925 2858890016
926 2858900950
927 2858903555
928 2866067729
929 2867306425
930 2867315874
931 2867323659
932 2869053981
933 2869063683
934 2869070904
935 2880493307
936 2880498993
937 2902587257
938 2929221012
939 2929227583
940 2996222471
941 649811550
942 8003831931
943 8003858972
944 8003874462
945 8054710770
946 8054727422
947 8054734871
948 8055418632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

49

119

0.98

PF00190

Cupin_1

Cupin

40

136

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9834 2 117
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9645 17 100
3ksc-assembly1.cif.gz_B crystal structure of pea prolegumin, an 11s seed globulin from pisum sativum l. 0.9603 26 98
2evx-assembly1.cif.gz_A crystal structure of pumpkin seed globulin 0.9598 26 99
3ksc-assembly2.cif.gz_D crystal structure of pea prolegumin, an 11s seed globulin from pisum sativum l. 0.9596 26 98
ID Description Score Start End Superfamily
2oa2A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9684 5 115 2.60.120.10
af_A1YQH2_38_212_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.966 26 98 2.60.120.10
af_A0A1D6KN97_1_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9607 26 100 2.60.120.10
3kscB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9603 26 98 2.60.120.10
2evxA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9598 26 99 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A166AEH3-F1-model_v4 RmlC-like cupin 0.9987 15 128
AF-A0A6A6T9X7-F1-model_v4 RmlC-like cupin 0.9987 13 127
AF-A0A163CE11-F1-model_v4 Uncharacterized protein 0.9984 14 127
AF-A0A175VWV8-F1-model_v4 Uncharacterized protein YrkC 0.998 12 127
AF-W6YEN9-F1-model_v4 Cupin type-2 domain-containing protein 0.9977 14 128

Map