F451197

General Info

Members Datasets Scaffolds Average Seq Length
474 287 948 101

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10032450|Ga0265760_100324502
Length 122
Sequence VTTRFSKANPEANFMFNPLKISEMLSQANQMQEEVQRKLGETVVEATSGGGAVSATMNGKKQLLKLHIDPAAVIGLSGSQPDVEMLEDLVIAAVNEAGRKADEAIQSSVQGMLGGLKIPGLT

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
165 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
169 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
200 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
201 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
202 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
203 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
258 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
259 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
265 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
266 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
279 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
280 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 1.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 2.32
Rhizosphere 96.62
Stem 0
Stem Tuber 0
Unclassified 17.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10032450 3300031090 Bacteria 1542
2 JGI24750J21931_1056532 3300002070 Unclassified 621
3 JGI24751J29686_10080264 3300002459 Bacteria 676
4 rootH2_10055879 3300003320 Bacteria 2733
5 Ga0065714_10083659 3300005288 Bacteria 2238
6 Ga0065704_10081053 3300005289 Bacteria 3829
7 Ga0065712_10068647 3300005290 Bacteria 9533
8 Ga0065707_10014836 3300005295 Bacteria 2372
9 Ga0070658_10009059 3300005327 Bacteria 8006
10 Ga0070658_10811125 3300005327 Bacteria 813
11 Ga0070676_10028031 3300005328 Bacteria 3198
12 Ga0070676_10057124 3300005328 Bacteria 2308
13 Ga0070676_10744844 3300005328 Bacteria 719
14 Ga0070690_100271268 3300005330 Bacteria 1207
15 Ga0070670_100076644 3300005331 Bacteria 2873
16 Ga0070670_100081852 3300005331 Bacteria 2774
17 Ga0068869_100059683 3300005334 Bacteria 2793
18 Ga0068869_100119516 3300005334 Bacteria 2014
19 Ga0070666_10571244 3300005335 Bacteria 824
20 Ga0070680_100221341 3300005336 Bacteria 1598
21 Ga0070680_100378013 3300005336 Bacteria 1206
22 Ga0070682_102061830 3300005337 Bacteria 503
23 Ga0068868_100284831 3300005338 Bacteria 1399
24 Ga0068868_100992347 3300005338 Unclassified 768
25 Ga0068868_102088833 3300005338 Bacteria 539
26 Ga0070660_100007116 3300005339 Bacteria 7777
27 Ga0070689_100234415 3300005340 Bacteria 1510
28 Ga0070689_101028577 3300005340 Bacteria 734
29 Ga0070661_100502186 3300005344 Bacteria 971
30 Ga0070668_100479481 3300005347 Unclassified 1074
31 Ga0070669_100394029 3300005353 Bacteria 1132
32 Ga0070675_100004388 3300005354 Bacteria 10761
33 Ga0070675_100017430 3300005354 Bacteria 5706
34 Ga0070675_100766780 3300005354 Unclassified 881
35 Ga0070671_101381978 3300005355 Bacteria 622
36 Ga0070674_100606390 3300005356 Unclassified 926
37 Ga0070674_100997211 3300005356 Bacteria 735
38 Ga0070673_100028861 3300005364 Bacteria 4131
39 Ga0070673_100391773 3300005364 Unclassified 1240
40 Ga0070688_100024250 3300005365 Bacteria 3576
41 Ga0070714_101278456 3300005435 Unclassified 716
42 Ga0070713_100285121 3300005436 Bacteria 1516
43 Ga0070713_100463074 3300005436 Bacteria 1192
44 Ga0070713_101421799 3300005436 Unclassified 673
45 Ga0070713_101588602 3300005436 Unclassified 635
46 Ga0070711_101304527 3300005439 Bacteria 630
47 Ga0070705_101044286 3300005440 Bacteria 665
48 Ga0070694_101278074 3300005444 Bacteria 617
49 Ga0070708_100434711 3300005445 Bacteria 1238
50 Ga0070708_100450058 3300005445 Bacteria 1215
51 Ga0070663_100299380 3300005455 Unclassified 1287
52 Ga0070678_100329222 3300005456 Unclassified 1307
53 Ga0070662_100915199 3300005457 Unclassified 749
54 Ga0070681_10090577 3300005458 Bacteria 3009
55 Ga0070681_10596570 3300005458 Bacteria 1019
56 Ga0070681_11099731 3300005458 Bacteria 716
57 Ga0070685_10122751 3300005466 Bacteria 1615
58 Ga0070685_10803069 3300005466 Bacteria 694
59 Ga0070707_100600008 3300005468 Bacteria 1063
60 Ga0070699_100139920 3300005518 Bacteria 2136
61 Ga0070699_100214799 3300005518 Bacteria 1713
62 Ga0070679_100027033 3300005530 Bacteria 5642
63 Ga0070679_100144015 3300005530 Bacteria 2361
64 Ga0070697_101131259 3300005536 Viruses 697
65 Ga0070672_101935125 3300005543 Unclassified 531
66 Ga0070686_100442198 3300005544 Bacteria 998
67 Ga0070686_100758708 3300005544 Bacteria 779
68 Ga0070693_101100882 3300005547 Bacteria 606
69 Ga0070665_100005812 3300005548 Bacteria 12653
70 Ga0070704_100863363 3300005549 Bacteria 812
71 Ga0068855_100056756 3300005563 Bacteria 4592
72 Ga0068855_100878012 3300005563 Bacteria 949
73 Ga0068857_101438928 3300005577 Unclassified 671
74 Ga0068854_100326290 3300005578 Bacteria 1249
75 Ga0068856_100020539 3300005614 Bacteria 6414
76 Ga0068856_100140053 3300005614 Bacteria 2426
77 Ga0070702_100618421 3300005615 Bacteria 815
78 Ga0068852_100396916 3300005616 Bacteria 1356
79 Ga0068859_100377354 3300005617 Bacteria 1513
80 Ga0068859_101574356 3300005617 Unclassified 726
81 Ga0068859_101778794 3300005617 Unclassified 681
82 Ga0068864_100036606 3300005618 Bacteria 4184
83 Ga0068851_10349503 3300005834 Bacteria 860
84 Ga0068870_10018687 3300005840 Bacteria 3351
85 Ga0068863_100149057 3300005841 Bacteria 2238
86 Ga0068863_102367667 3300005841 Bacteria 541
87 Ga0068860_100530447 3300005843 Unclassified 1178
88 Ga0068860_101298196 3300005843 Bacteria 749
89 Ga0068860_101343674 3300005843 Unclassified 736
90 Ga0068862_100100082 3300005844 Bacteria 2535
91 Ga0070717_10018587 3300006028 Bacteria 5431
92 Ga0070717_10330671 3300006028 Bacteria 1359
93 Ga0070715_10527541 3300006163 Bacteria 680
94 Ga0070716_100148930 3300006173 Bacteria 1503
95 Ga0097621_102127547 3300006237 Bacteria 536
96 Ga0068871_100099678 3300006358 Bacteria 2432
97 Ga0075428_100081111 3300006844 Bacteria 3541
98 Ga0075430_100821349 3300006846 Bacteria 766
99 Ga0075431_100285119 3300006847 Bacteria 1672
100 Ga0075431_100316008 3300006847 Bacteria 1576
101 Ga0075433_10028960 3300006852 Bacteria 4713
102 Ga0075433_10044419 3300006852 Bacteria 3860
103 Ga0075433_10428171 3300006852 Unclassified 1167
104 Ga0075433_10931015 3300006852 Bacteria 758
105 Ga0075434_100034359 3300006871 Bacteria 5006
106 Ga0075434_100190740 3300006871 Bacteria 2070
107 Ga0075429_100019855 3300006880 Bacteria 5826
108 Ga0075429_100445554 3300006880 Unclassified 1135
109 Ga0068865_100004448 3300006881 Bacteria 8453
110 Ga0068865_100654952 3300006881 Unclassified 893
111 Ga0097620_100377349 3300006931 Bacteria 1513
112 Ga0097620_101574247 3300006931 Unclassified 726
113 Ga0097620_101778767 3300006931 Unclassified 681
114 Ga0075435_100009878 3300007076 Bacteria 6944
115 Ga0075435_100417327 3300007076 Unclassified 1155
116 Ga0105240_10046054 3300009093 Bacteria 5529
117 Ga0105240_10793540 3300009093 Bacteria 1026
118 Ga0111539_10000435 3300009094 Bacteria 52742
119 Ga0111539_10065824 3300009094 Bacteria 4281
120 Ga0111539_11588500 3300009094 Unclassified 759
121 Ga0105245_11142288 3300009098 Bacteria 826
122 Ga0105245_11670652 3300009098 Bacteria 689
123 Ga0105245_12846931 3300009098 Bacteria 536
124 Ga0105247_10061904 3300009101 Bacteria 2321
125 Ga0114129_10099632 3300009147 Bacteria 4022
126 Ga0114129_10121022 3300009147 Bacteria 3603
127 Ga0114129_10647631 3300009147 Bacteria 1364
128 Ga0114129_10944040 3300009147 Bacteria 1090
129 Ga0105241_12683473 3300009174 Bacteria 501
130 Ga0105242_10108706 3300009176 Bacteria 2360
131 Ga0105242_12740010 3300009176 Unclassified 543
132 Ga0105248_10000004 3300009177 Bacteria 695244
133 Ga0105248_10061401 3300009177 Bacteria 4220
134 Ga0105248_10229197 3300009177 Bacteria 2091
135 Ga0105248_10580864 3300009177 Bacteria 1264
136 Ga0105248_11347072 3300009177 Bacteria 807
137 Ga0105237_10660687 3300009545 Bacteria 1052
138 Ga0105238_10059478 3300009551 Bacteria 3828
139 Ga0105238_10118788 3300009551 Bacteria 2624
140 Ga0105238_10475039 3300009551 Bacteria 1249
141 Ga0105238_11392656 3300009551 Bacteria 728
142 Ga0105249_11379346 3300009553 Unclassified 777
143 Ga0105246_12595635 3300011119 Bacteria 500
144 Ga0157371_10078934 3300013102 Bacteria 2332
145 Ga0157370_10704663 3300013104 Bacteria 921
146 Ga0157369_11306239 3300013105 Unclassified 739
147 Ga0157374_10014399 3300013296 Bacteria 6922
148 Ga0157374_12342398 3300013296 Bacteria 561
149 Ga0157378_10821625 3300013297 Bacteria 956
150 Ga0163162_10714236 3300013306 Bacteria 1123
151 Ga0163162_11048581 3300013306 Unclassified 923
152 Ga0163162_11914713 3300013306 Bacteria 679
153 Ga0157372_10001208 3300013307 Bacteria 27938
154 Ga0157375_10178062 3300013308 Bacteria 2277
155 Ga0157375_11148556 3300013308 Bacteria 910
156 Ga0157375_12013644 3300013308 Bacteria 686
157 Ga0163163_11195210 3300014325 Bacteria 823
158 Ga0157380_10870420 3300014326 Bacteria 924
159 Ga0157380_11229677 3300014326 Bacteria 794
160 Ga0157377_10017582 3300014745 Bacteria 3699
161 Ga0157377_10089261 3300014745 Unclassified 1817
162 Ga0157379_10204007 3300014968 Bacteria 1788
163 Ga0157376_10157597 3300014969 Bacteria 2054
164 Ga0182005_1154024 3300015265 Unclassified 670
165 Ga0206352_10382403 3300020078 Bacteria 519
166 Ga0206350_11564682 3300020080 Bacteria 754
167 Ga0206354_10421795 3300020081 Unclassified 533
168 Ga0206353_10292495 3300020082 Bacteria 587
169 Ga0224712_10291846 3300022467 Bacteria 761
170 Ga0207656_10140111 3300025321 Bacteria 1139
171 Ga0207642_10355276 3300025899 Bacteria 866
172 Ga0207710_10115298 3300025900 Bacteria 1279
173 Ga0207688_10240268 3300025901 Unclassified 1095
174 Ga0207680_10069720 3300025903 Bacteria 2173
175 Ga0207680_10798933 3300025903 Bacteria 676
176 Ga0207699_11198679 3300025906 Unclassified 562
177 Ga0207645_10018431 3300025907 Bacteria 4592
178 Ga0207645_10296115 3300025907 Bacteria 1077
179 Ga0207643_10021743 3300025908 Bacteria 3529
180 Ga0207705_10040752 3300025909 Bacteria 3332
181 Ga0207707_10204763 3300025912 Unclassified 1720
182 Ga0207707_10323556 3300025912 Bacteria 1331
183 Ga0207707_10408417 3300025912 Bacteria 1165
184 Ga0207695_10070660 3300025913 Bacteria 3568
185 Ga0207695_10200058 3300025913 Bacteria 1912
186 Ga0207695_10919618 3300025913 Bacteria 754
187 Ga0207660_10023391 3300025917 Bacteria 4173
188 Ga0207660_10295045 3300025917 Bacteria 1290
189 Ga0207660_10339198 3300025917 Bacteria 1203
190 Ga0207660_10609583 3300025917 Bacteria 889
191 Ga0207662_10240297 3300025918 Bacteria 1186
192 Ga0207657_10007585 3300025919 Bacteria 11117
193 Ga0207652_10005046 3300025921 Bacteria 10701
194 Ga0207652_10881929 3300025921 Bacteria 791
195 Ga0207646_10241226 3300025922 Bacteria 1633
196 Ga0207646_10331214 3300025922 Bacteria 1375
197 Ga0207694_10002111 3300025924 Bacteria 16387
198 Ga0207694_10058734 3300025924 Bacteria 2992
199 Ga0207694_10411029 3300025924 Bacteria 1126
200 Ga0207659_10009652 3300025926 Bacteria 6038
201 Ga0207659_10027001 3300025926 Bacteria 3882
202 Ga0207659_10325032 3300025926 Bacteria 1270
203 Ga0207687_11796411 3300025927 Bacteria 525
204 Ga0207690_11474408 3300025932 Bacteria 569
205 Ga0207706_10042829 3300025933 Bacteria 4012
206 Ga0207686_10071915 3300025934 Bacteria 2227
207 Ga0207670_10159173 3300025936 Unclassified 1684
208 Ga0207669_10699057 3300025937 Unclassified 833
209 Ga0207704_10127873 3300025938 Bacteria 1753
210 Ga0207704_10481149 3300025938 Bacteria 997
211 Ga0207704_10575125 3300025938 Unclassified 919
212 Ga0207665_10318157 3300025939 Bacteria 1167
213 Ga0207691_10109802 3300025940 Bacteria 2454
214 Ga0207711_10000008 3300025941 Bacteria 597686
215 Ga0207711_10000010 3300025941 Bacteria 557970
216 Ga0207711_10128129 3300025941 Bacteria 2272
217 Ga0207689_10052346 3300025942 Bacteria 3364
218 Ga0207689_10074042 3300025942 Bacteria 2798
219 Ga0207661_11473935 3300025944 Bacteria 624
220 Ga0207667_10000199 3300025949 Bacteria 87200
221 Ga0207667_10839828 3300025949 Bacteria 913
222 Ga0207651_10053693 3300025960 Bacteria 2756
223 Ga0207640_10324036 3300025981 Bacteria 1228
224 Ga0207640_11710175 3300025981 Bacteria 568
225 Ga0207658_11851290 3300025986 Bacteria 550
226 Ga0207677_10134924 3300026023 Bacteria 1880
227 Ga0207677_10954025 3300026023 Unclassified 776
228 Ga0207703_11371192 3300026035 Bacteria 680
229 Ga0207678_10289825 3300026067 Bacteria 1406
230 Ga0207678_10992114 3300026067 Unclassified 743
231 Ga0207708_11023277 3300026075 Unclassified 718
232 Ga0207702_10058970 3300026078 Bacteria 3268
233 Ga0207702_10164750 3300026078 Bacteria 2027
234 Ga0207641_12098185 3300026088 Bacteria 566
235 Ga0207648_10202489 3300026089 Bacteria 1761
236 Ga0207676_10072427 3300026095 Bacteria 2770
237 Ga0207676_10968496 3300026095 Bacteria 837
238 Ga0207674_10248109 3300026116 Unclassified 1727
239 Ga0207674_10459839 3300026116 Unclassified 1230
240 Ga0207675_100272280 3300026118 Bacteria 1643
241 Ga0207675_100317793 3300026118 Bacteria 1520
242 Ga0207683_10786562 3300026121 Unclassified 883
243 Ga0207698_10202535 3300026142 Bacteria 1779
244 Ga0209995_1028917 3300027471 Bacteria 926
245 Ga0209982_1053609 3300027552 Unclassified 652
246 Ga0210002_1018343 3300027617 Bacteria 1118
247 Ga0209983_1041871 3300027665 Bacteria 992
248 Ga0209971_1025616 3300027682 Bacteria 1409
249 Ga0209971_1039721 3300027682 Bacteria 1132
250 Ga0209966_1076109 3300027695 Unclassified 740
251 Ga0209998_10065140 3300027717 Bacteria 864
252 Ga0207428_10027423 3300027907 Bacteria 4741
253 Ga0207428_10036225 3300027907 Bacteria 4026
254 Ga0207428_10885947 3300027907 Bacteria 631
255 Ga0268266_10427853 3300028379 Bacteria 1255
256 Ga0268266_10754561 3300028379 Bacteria 939
257 Ga0268265_12705767 3300028380 Bacteria 501
258 Ga0268264_10359065 3300028381 Bacteria 1389
259 Ga0265318_10051713 3300028577 Bacteria 1542
260 Ga0265318_10144811 3300028577 Unclassified 872
261 Ga0265323_10023479 3300028653 Bacteria 2351
262 Ga0265323_10103057 3300028653 Bacteria 942
263 Ga0265336_10002724 3300028666 Bacteria 7150
264 Ga0265336_10009419 3300028666 Bacteria 3381
265 Ga0265338_10001153 3300028800 Bacteria 43711
266 Ga0265338_10185159 3300028800 Bacteria 1583
267 Ga0265338_10319574 3300028800 Unclassified 1124
268 Ga0265338_10424031 3300028800 Bacteria 945
269 Ga0265338_11198974 3300028800 Unclassified 509
270 Ga0265330_10000369 3300031235 Bacteria 31708
271 Ga0265330_10021522 3300031235 Bacteria 2941
272 Ga0265330_10064387 3300031235 Bacteria 1592
273 Ga0265330_10070450 3300031235 Bacteria 1513
274 Ga0265330_10210757 3300031235 Bacteria 820
275 Ga0265330_10274914 3300031235 Unclassified 710
276 Ga0265332_10016963 3300031238 Bacteria 3213
277 Ga0265328_10013428 3300031239 Bacteria 3243
278 Ga0265328_10154555 3300031239 Bacteria 863
279 Ga0265320_10032082 3300031240 Bacteria 2693
280 Ga0265320_10072219 3300031240 Bacteria 1624
281 Ga0265325_10000123 3300031241 Bacteria 53074
282 Ga0265325_10025668 3300031241 Bacteria 3198
283 Ga0265325_10071622 3300031241 Bacteria 1739
284 Ga0265325_10243064 3300031241 Bacteria 817
285 Ga0265325_10381143 3300031241 Unclassified 619
286 Ga0265325_10450967 3300031241 Unclassified 560
287 Ga0265329_10027273 3300031242 Unclassified 1878
288 Ga0265329_10093942 3300031242 Bacteria 952
289 Ga0265329_10183251 3300031242 Bacteria 685
290 Ga0265340_10006216 3300031247 Bacteria 6582
291 Ga0265340_10034964 3300031247 Bacteria 2497
292 Ga0265340_10103823 3300031247 Bacteria 1319
293 Ga0265340_10128882 3300031247 Bacteria 1161
294 Ga0265340_10525487 3300031247 Unclassified 521
295 Ga0265339_10000041 3300031249 Bacteria 119820
296 Ga0265339_10002921 3300031249 Bacteria 12090
297 Ga0265339_10025877 3300031249 Bacteria 3363
298 Ga0265339_10036025 3300031249 Bacteria 2770
299 Ga0265339_10047270 3300031249 Unclassified 2363
300 Ga0265339_10091294 3300031249 Bacteria 1596
301 Ga0265339_10126117 3300031249 Bacteria 1312
302 Ga0265339_10201103 3300031249 Unclassified 983
303 Ga0265331_10142234 3300031250 Bacteria 1091
304 Ga0265331_10143520 3300031250 Unclassified 1085
305 Ga0265331_10188389 3300031250 Bacteria 931
306 Ga0265331_10358849 3300031250 Unclassified 653
307 Ga0265316_10000756 3300031344 Bacteria 35734
308 Ga0265316_10003681 3300031344 Bacteria 15446
309 Ga0265316_10013340 3300031344 Bacteria 7305
310 Ga0265316_10032292 3300031344 Bacteria 4273
311 Ga0265316_10045507 3300031344 Bacteria 3482
312 Ga0265316_10182214 3300031344 Bacteria 1563
313 Ga0265316_10226651 3300031344 Bacteria 1377
314 Ga0265316_10229342 3300031344 Unclassified 1368
315 Ga0265316_10480490 3300031344 Bacteria 889
316 Ga0265316_10833885 3300031344 Bacteria 646
317 Ga0265313_10006754 3300031595 Bacteria 8025
318 Ga0265313_10017356 3300031595 Bacteria 4093
319 Ga0265313_10191279 3300031595 Bacteria 855
320 Ga0265313_10315520 3300031595 Unclassified 625
321 Ga0265314_10000326 3300031711 Bacteria 67045
322 Ga0265314_10002442 3300031711 Bacteria 19040
323 Ga0265314_10085874 3300031711 Bacteria 2062
324 Ga0265314_10147550 3300031711 Bacteria 1447
325 Ga0265314_10184519 3300031711 Bacteria 1247
326 Ga0265342_10001067 3300031712 Bacteria 26609
327 Ga0265342_10001635 3300031712 Bacteria 20659
328 Ga0265342_10002773 3300031712 Bacteria 14840
329 Ga0265342_10129957 3300031712 Bacteria 1412
330 Ga0265342_10160974 3300031712 Unclassified 1240
331 Ga0265342_10259773 3300031712 Unclassified 924
332 Ga0307411_10367538 3300032005 Bacteria 1179
333 Ga0316583_10133320 3300032133 Bacteria 866
334 Ga0373934_0064705 3300035086 Bacteria 1460
335 Ga0373944_0109238 3300035089 Bacteria 942
336 Ga0373923_0147793 3300035111 Bacteria 1066
337 Ga0373954_0120169 3300035118 Bacteria 1275
338 Ga0373957_0042246 3300035120 Bacteria 1720
339 Ga0373943_0029958 3300035170 Bacteria 2574
340 Ga0373946_0385109 3300035171 Bacteria 706
341 Ga0373955_0042682 3300035172 Bacteria 2436
342 Ga0373924_0038282 3300035410 Bacteria 1956
343 Ga0373935_0781418 3300035692 Bacteria 704
344 Ga0373927_0761742 3300035695 Bacteria 640
345 Ga0373933_0055786 3300035724 Bacteria 2371
346 Ga0373933_0450355 3300035724 Bacteria 842
347 Ga0373947_0154576 3300035725 Bacteria 1480
348 Ga0373947_0160851 3300035725 Bacteria 1452
349 Ga0373937_0004849 3300036401 Bacteria 11432
350 Ga0373937_0527698 3300036401 Bacteria 1122
351 Ga0373937_0837164 3300036401 Bacteria 868
352 Ga0373925_0248730 3300037068 Bacteria 1425
353 Ga0395900_0232868 3300037418 Bacteria 1852
354 Ga0436363_0815912 3300039450 Bacteria 625
355 Ga0439436_0262637 3300041404 Bacteria 503
356 Ga0450923_092166 3300042125 Bacteria 692
357 Ga0450900_077326 3300042136 Bacteria 532
358 Ga0439435_0004352 3300042436 Bacteria 3042
359 Ga0439460_0105115 3300042461 Unclassified 911
360 Ga0451576_1680307 3300045051 Bacteria 658
361 Ga0495603_0203712 3300046455 Bacteria 1143
362 Ga0495603_0353601 3300046455 Bacteria 843
363 Ga0495629_0107608 3300046459 Bacteria 1945
364 Ga0495629_0325728 3300046459 Bacteria 1050
365 Ga0495641_0241812 3300046461 Bacteria 811
366 Ga0495580_0221747 3300046472 Bacteria 1299
367 Ga0495582_0262789 3300046473 Bacteria 990
368 Ga0495582_0323334 3300046473 Bacteria 888
369 Ga0495639_0178810 3300046475 Bacteria 1032
370 Ga0495662_0240611 3300046476 Bacteria 892
371 Ga0495664_0337620 3300046477 Bacteria 908
372 Ga0495618_0106558 3300046514 Bacteria 1795
373 Ga0495628_0135045 3300046516 Bacteria 1886
374 Ga0495630_0227735 3300046517 Bacteria 1424
375 Ga0495630_0341578 3300046517 Bacteria 1146
376 Ga0495644_0142752 3300046523 Bacteria 915
377 Ga0495586_0207776 3300046535 Bacteria 1111
378 Ga0495598_0033748 3300046537 Bacteria 1454
379 Ga0495598_0037340 3300046537 Bacteria 1401
380 Ga0495645_0388776 3300046543 Bacteria 891
381 Ga0495656_0033927 3300046615 Bacteria 2086
382 Ga0495635_0095208 3300046663 Bacteria 2036
383 Ga0495659_0363188 3300046664 Unclassified 620
384 Ga0495657_0761471 3300046675 Bacteria 555
385 Ga0495647_0110658 3300046681 Bacteria 1146
386 Ga0495647_0505078 3300046681 Bacteria 563
387 Ga0495658_0042474 3300046683 Bacteria 2539
388 Ga0495658_0147194 3300046683 Bacteria 1444
389 Ga0495669_0164510 3300046684 Bacteria 1054
390 Ga0495613_0513432 3300046689 Bacteria 806
391 Ga0495613_0617759 3300046689 Bacteria 720
392 Ga0495670_0408618 3300046691 Bacteria 734
393 Ga0495670_0619675 3300046691 Unclassified 590
394 Ga0495600_0205323 3300046809 Bacteria 1264
395 Ga0495636_0088111 3300047318 Bacteria 1345
396 Ga0495680_0631655 3300047322 Bacteria 714
397 Ga0495684_0195538 3300047471 Bacteria 1493
398 Ga0495684_0252774 3300047471 Bacteria 1282
399 Ga0495602_0624542 3300048088 Bacteria 738
400 Ga0495614_0444700 3300048089 Bacteria 613
401 Ga0496102_1128083 3300048905 Bacteria 704
402 Ga0496102_1465224 3300048905 Unclassified 601
403 Ga0496104_0169296 3300048907 Bacteria 2095
404 Ga0496104_0260065 3300048907 Bacteria 1649
405 Ga0496105_0149696 3300048908 Bacteria 1919
406 Ga0496105_0277263 3300048908 Bacteria 1353
407 Ga0496105_0831082 3300048908 Bacteria 700
408 Ga0496108_0227865 3300048911 Bacteria 1620
409 Ga0496109_0050155 3300048912 Bacteria 3802
410 Ga0496113_0184383 3300048916 Bacteria 1655
411 Ga0496114_0375889 3300048917 Bacteria 1258
412 Ga0501299_079383 3300049522 Unclassified 726
413 Ga0501032_0237429 3300049569 Unclassified 1185
414 Ga0501037_0540770 3300049573 Unclassified 787
415 Ga0501039_0717487 3300049575 Unclassified 781
416 Ga0501040_0234665 3300049576 Bacteria 1307
417 Ga0501040_0489604 3300049576 Bacteria 886
418 Ga0501041_0011118 3300049577 Bacteria 5315
419 Ga0501042_0096829 3300049578 Bacteria 2120
420 Ga0501043_0264114 3300049579 Bacteria 1323
421 Ga0501048_0034767 3300049582 Bacteria 3633
422 Ga0501071_0123055 3300049587 Bacteria 1924
423 Ga0501072_0009032 3300049588 Bacteria 7576
424 Ga0501074_1150156 3300049590 Unclassified 545
425 Ga0501075_0640295 3300049591 Bacteria 811
426 Ga0501076_0226734 3300049592 Unclassified 1527
427 Ga0501076_1086319 3300049592 Bacteria 659
428 Ga0501077_0239562 3300049593 Bacteria 1153
429 Ga0501077_0333815 3300049593 Bacteria 967
430 Ga0501239_078110 3300049672 Bacteria 526
431 Ga0501249_014147 3300049679 Bacteria 1698
432 Ga0501225_0112240 3300049705 Unclassified 804
433 Ga0501079_0040237 3300049741 Bacteria 3605
434 Ga0501080_0055383 3300049742 Bacteria 3694
435 Ga0501081_0200933 3300049743 Bacteria 1445
436 Ga0501081_0530731 3300049743 Bacteria 878
437 Ga0501083_0122458 3300049744 Bacteria 1706
438 Ga0501272_019106 3300049769 Bacteria 815
439 Ga0501273_029496 3300049770 Unclassified 775
440 Ga0501283_013187 3300049779 Bacteria 1250
441 nmdc:mga05p37_1067569_c1 3300050507 Unclassified 850
442 nmdc:mga05p37_1798_c1 3300050507 Bacteria 25039
443 nmdc:mga05p37_51655_c1 3300050507 Bacteria 5054
444 nmdc:mga05p37_710621_c1 3300050507 Bacteria 1115
445 nmdc:mga09592_537984_c1 3300050508 Unclassified 1004
446 nmdc:mga0qj67_429910_c1 3300050509 Bacteria 1064
447 nmdc:mga06r32_1177392_c1 3300050510 Unclassified 713
448 nmdc:mga06r32_265688_c1 3300050510 Bacteria 1703
449 nmdc:mga06r32_558445_c1 3300050510 Bacteria 1118
450 nmdc:mga08y16_12953_c1 3300050511 Bacteria 8774
451 nmdc:mga08y16_195_c1 3300050511 Bacteria 54659
452 nmdc:mga08y16_4556_c1 3300050511 Bacteria 14449
453 nmdc:mga08y16_469030_c1 3300050511 Unclassified 1282
454 nmdc:mga0n895_500697_c1 3300050512 Bacteria 1224
455 nmdc:mga0rr50_415168_c1 3300050513 Unclassified 1138
456 nmdc:mga0a205_150130_c1 3300050515 Unclassified 2230
457 nmdc:mga0a205_176936_c1 3300050515 Bacteria 2029
458 nmdc:mga0a205_637199_c1 3300050515 Unclassified 917
459 Ga0495612_0266022 3300053078 Bacteria 765
460 Ga0495595_0275527 3300053084 Bacteria 844
461 Ga0495619_0103164 3300053085 Bacteria 1943
462 Ga0495619_0387703 3300053085 Bacteria 965
463 Ga0495619_1166583 3300053085 Bacteria 511
464 Ga0500644_0079040 3300053088 Unclassified 1205
465 Ga0500595_013481 3300053119 Bacteria 3130
466 Ga0500658_0059512 3300053134 Bacteria 1585
467 Ga0501084_0042315 3300054114 Bacteria 3811
468 Ga0590071_000119 3300059421 Bacteria 21957
469 Ga0590074_000082 3300059423 Bacteria 10219
470 Ga0590075_000216 3300059424 Bacteria 16123
471 Ga0590077_000315 3300059426 Bacteria 13671
472 Ga0501082_0149958 3300060353 Bacteria 2025
473 Ga0501082_0663670 3300060353 Bacteria 913
474 Ga0530510_0172761 3300061734 Bacteria 1601
475 Ga0265760_10032450
476 JGI24750J21931_1056532
477 JGI24751J29686_10080264
478 rootH2_10055879
479 Ga0065714_10083659
480 Ga0065704_10081053
481 Ga0065712_10068647
482 Ga0065707_10014836
483 Ga0070658_10009059
484 Ga0070658_10811125
485 Ga0070676_10028031
486 Ga0070676_10057124
487 Ga0070676_10744844
488 Ga0070690_100271268
489 Ga0070670_100076644
490 Ga0070670_100081852
491 Ga0068869_100059683
492 Ga0068869_100119516
493 Ga0070666_10571244
494 Ga0070680_100221341
495 Ga0070680_100378013
496 Ga0070682_102061830
497 Ga0068868_100284831
498 Ga0068868_100992347
499 Ga0068868_102088833
500 Ga0070660_100007116
501 Ga0070689_100234415
502 Ga0070689_101028577
503 Ga0070661_100502186
504 Ga0070668_100479481
505 Ga0070669_100394029
506 Ga0070675_100004388
507 Ga0070675_100017430
508 Ga0070675_100766780
509 Ga0070671_101381978
510 Ga0070674_100606390
511 Ga0070674_100997211
512 Ga0070673_100028861
513 Ga0070673_100391773
514 Ga0070688_100024250
515 Ga0070714_101278456
516 Ga0070713_100285121
517 Ga0070713_100463074
518 Ga0070713_101421799
519 Ga0070713_101588602
520 Ga0070711_101304527
521 Ga0070705_101044286
522 Ga0070694_101278074
523 Ga0070708_100434711
524 Ga0070708_100450058
525 Ga0070663_100299380
526 Ga0070678_100329222
527 Ga0070662_100915199
528 Ga0070681_10090577
529 Ga0070681_10596570
530 Ga0070681_11099731
531 Ga0070685_10122751
532 Ga0070685_10803069
533 Ga0070707_100600008
534 Ga0070699_100139920
535 Ga0070699_100214799
536 Ga0070679_100027033
537 Ga0070679_100144015
538 Ga0070697_101131259
539 Ga0070672_101935125
540 Ga0070686_100442198
541 Ga0070686_100758708
542 Ga0070693_101100882
543 Ga0070665_100005812
544 Ga0070704_100863363
545 Ga0068855_100056756
546 Ga0068855_100878012
547 Ga0068857_101438928
548 Ga0068854_100326290
549 Ga0068856_100020539
550 Ga0068856_100140053
551 Ga0070702_100618421
552 Ga0068852_100396916
553 Ga0068859_100377354
554 Ga0068859_101574356
555 Ga0068859_101778794
556 Ga0068864_100036606
557 Ga0068851_10349503
558 Ga0068870_10018687
559 Ga0068863_100149057
560 Ga0068863_102367667
561 Ga0068860_100530447
562 Ga0068860_101298196
563 Ga0068860_101343674
564 Ga0068862_100100082
565 Ga0070717_10018587
566 Ga0070717_10330671
567 Ga0070715_10527541
568 Ga0070716_100148930
569 Ga0097621_102127547
570 Ga0068871_100099678
571 Ga0075428_100081111
572 Ga0075430_100821349
573 Ga0075431_100285119
574 Ga0075431_100316008
575 Ga0075433_10028960
576 Ga0075433_10044419
577 Ga0075433_10428171
578 Ga0075433_10931015
579 Ga0075434_100034359
580 Ga0075434_100190740
581 Ga0075429_100019855
582 Ga0075429_100445554
583 Ga0068865_100004448
584 Ga0068865_100654952
585 Ga0097620_100377349
586 Ga0097620_101574247
587 Ga0097620_101778767
588 Ga0075435_100009878
589 Ga0075435_100417327
590 Ga0105240_10046054
591 Ga0105240_10793540
592 Ga0111539_10000435
593 Ga0111539_10065824
594 Ga0111539_11588500
595 Ga0105245_11142288
596 Ga0105245_11670652
597 Ga0105245_12846931
598 Ga0105247_10061904
599 Ga0114129_10099632
600 Ga0114129_10121022
601 Ga0114129_10647631
602 Ga0114129_10944040
603 Ga0105241_12683473
604 Ga0105242_10108706
605 Ga0105242_12740010
606 Ga0105248_10000004
607 Ga0105248_10061401
608 Ga0105248_10229197
609 Ga0105248_10580864
610 Ga0105248_11347072
611 Ga0105237_10660687
612 Ga0105238_10059478
613 Ga0105238_10118788
614 Ga0105238_10475039
615 Ga0105238_11392656
616 Ga0105249_11379346
617 Ga0105246_12595635
618 Ga0157371_10078934
619 Ga0157370_10704663
620 Ga0157369_11306239
621 Ga0157374_10014399
622 Ga0157374_12342398
623 Ga0157378_10821625
624 Ga0163162_10714236
625 Ga0163162_11048581
626 Ga0163162_11914713
627 Ga0157372_10001208
628 Ga0157375_10178062
629 Ga0157375_11148556
630 Ga0157375_12013644
631 Ga0163163_11195210
632 Ga0157380_10870420
633 Ga0157380_11229677
634 Ga0157377_10017582
635 Ga0157377_10089261
636 Ga0157379_10204007
637 Ga0157376_10157597
638 Ga0182005_1154024
639 Ga0206352_10382403
640 Ga0206350_11564682
641 Ga0206354_10421795
642 Ga0206353_10292495
643 Ga0224712_10291846
644 Ga0207656_10140111
645 Ga0207642_10355276
646 Ga0207710_10115298
647 Ga0207688_10240268
648 Ga0207680_10069720
649 Ga0207680_10798933
650 Ga0207699_11198679
651 Ga0207645_10018431
652 Ga0207645_10296115
653 Ga0207643_10021743
654 Ga0207705_10040752
655 Ga0207707_10204763
656 Ga0207707_10323556
657 Ga0207707_10408417
658 Ga0207695_10070660
659 Ga0207695_10200058
660 Ga0207695_10919618
661 Ga0207660_10023391
662 Ga0207660_10295045
663 Ga0207660_10339198
664 Ga0207660_10609583
665 Ga0207662_10240297
666 Ga0207657_10007585
667 Ga0207652_10005046
668 Ga0207652_10881929
669 Ga0207646_10241226
670 Ga0207646_10331214
671 Ga0207694_10002111
672 Ga0207694_10058734
673 Ga0207694_10411029
674 Ga0207659_10009652
675 Ga0207659_10027001
676 Ga0207659_10325032
677 Ga0207687_11796411
678 Ga0207690_11474408
679 Ga0207706_10042829
680 Ga0207686_10071915
681 Ga0207670_10159173
682 Ga0207669_10699057
683 Ga0207704_10127873
684 Ga0207704_10481149
685 Ga0207704_10575125
686 Ga0207665_10318157
687 Ga0207691_10109802
688 Ga0207711_10000008
689 Ga0207711_10000010
690 Ga0207711_10128129
691 Ga0207689_10052346
692 Ga0207689_10074042
693 Ga0207661_11473935
694 Ga0207667_10000199
695 Ga0207667_10839828
696 Ga0207651_10053693
697 Ga0207640_10324036
698 Ga0207640_11710175
699 Ga0207658_11851290
700 Ga0207677_10134924
701 Ga0207677_10954025
702 Ga0207703_11371192
703 Ga0207678_10289825
704 Ga0207678_10992114
705 Ga0207708_11023277
706 Ga0207702_10058970
707 Ga0207702_10164750
708 Ga0207641_12098185
709 Ga0207648_10202489
710 Ga0207676_10072427
711 Ga0207676_10968496
712 Ga0207674_10248109
713 Ga0207674_10459839
714 Ga0207675_100272280
715 Ga0207675_100317793
716 Ga0207683_10786562
717 Ga0207698_10202535
718 Ga0209995_1028917
719 Ga0209982_1053609
720 Ga0210002_1018343
721 Ga0209983_1041871
722 Ga0209971_1025616
723 Ga0209971_1039721
724 Ga0209966_1076109
725 Ga0209998_10065140
726 Ga0207428_10027423
727 Ga0207428_10036225
728 Ga0207428_10885947
729 Ga0268266_10427853
730 Ga0268266_10754561
731 Ga0268265_12705767
732 Ga0268264_10359065
733 Ga0265318_10051713
734 Ga0265318_10144811
735 Ga0265323_10023479
736 Ga0265323_10103057
737 Ga0265336_10002724
738 Ga0265336_10009419
739 Ga0265338_10001153
740 Ga0265338_10185159
741 Ga0265338_10319574
742 Ga0265338_10424031
743 Ga0265338_11198974
744 Ga0265330_10000369
745 Ga0265330_10021522
746 Ga0265330_10064387
747 Ga0265330_10070450
748 Ga0265330_10210757
749 Ga0265330_10274914
750 Ga0265332_10016963
751 Ga0265328_10013428
752 Ga0265328_10154555
753 Ga0265320_10032082
754 Ga0265320_10072219
755 Ga0265325_10000123
756 Ga0265325_10025668
757 Ga0265325_10071622
758 Ga0265325_10243064
759 Ga0265325_10381143
760 Ga0265325_10450967
761 Ga0265329_10027273
762 Ga0265329_10093942
763 Ga0265329_10183251
764 Ga0265340_10006216
765 Ga0265340_10034964
766 Ga0265340_10103823
767 Ga0265340_10128882
768 Ga0265340_10525487
769 Ga0265339_10000041
770 Ga0265339_10002921
771 Ga0265339_10025877
772 Ga0265339_10036025
773 Ga0265339_10047270
774 Ga0265339_10091294
775 Ga0265339_10126117
776 Ga0265339_10201103
777 Ga0265331_10142234
778 Ga0265331_10143520
779 Ga0265331_10188389
780 Ga0265331_10358849
781 Ga0265316_10000756
782 Ga0265316_10003681
783 Ga0265316_10013340
784 Ga0265316_10032292
785 Ga0265316_10045507
786 Ga0265316_10182214
787 Ga0265316_10226651
788 Ga0265316_10229342
789 Ga0265316_10480490
790 Ga0265316_10833885
791 Ga0265313_10006754
792 Ga0265313_10017356
793 Ga0265313_10191279
794 Ga0265313_10315520
795 Ga0265314_10000326
796 Ga0265314_10002442
797 Ga0265314_10085874
798 Ga0265314_10147550
799 Ga0265314_10184519
800 Ga0265342_10001067
801 Ga0265342_10001635
802 Ga0265342_10002773
803 Ga0265342_10129957
804 Ga0265342_10160974
805 Ga0265342_10259773
806 Ga0307411_10367538
807 Ga0316583_10133320
808 Ga0373934_0064705
809 Ga0373944_0109238
810 Ga0373923_0147793
811 Ga0373954_0120169
812 Ga0373957_0042246
813 Ga0373943_0029958
814 Ga0373946_0385109
815 Ga0373955_0042682
816 Ga0373924_0038282
817 Ga0373935_0781418
818 Ga0373927_0761742
819 Ga0373933_0055786
820 Ga0373933_0450355
821 Ga0373947_0154576
822 Ga0373947_0160851
823 Ga0373937_0004849
824 Ga0373937_0527698
825 Ga0373937_0837164
826 Ga0373925_0248730
827 Ga0395900_0232868
828 Ga0436363_0815912
829 Ga0439436_0262637
830 Ga0450923_092166
831 Ga0450900_077326
832 Ga0439435_0004352
833 Ga0439460_0105115
834 Ga0451576_1680307
835 Ga0495603_0203712
836 Ga0495603_0353601
837 Ga0495629_0107608
838 Ga0495629_0325728
839 Ga0495641_0241812
840 Ga0495580_0221747
841 Ga0495582_0262789
842 Ga0495582_0323334
843 Ga0495639_0178810
844 Ga0495662_0240611
845 Ga0495664_0337620
846 Ga0495618_0106558
847 Ga0495628_0135045
848 Ga0495630_0227735
849 Ga0495630_0341578
850 Ga0495644_0142752
851 Ga0495586_0207776
852 Ga0495598_0033748
853 Ga0495598_0037340
854 Ga0495645_0388776
855 Ga0495656_0033927
856 Ga0495635_0095208
857 Ga0495659_0363188
858 Ga0495657_0761471
859 Ga0495647_0110658
860 Ga0495647_0505078
861 Ga0495658_0042474
862 Ga0495658_0147194
863 Ga0495669_0164510
864 Ga0495613_0513432
865 Ga0495613_0617759
866 Ga0495670_0408618
867 Ga0495670_0619675
868 Ga0495600_0205323
869 Ga0495636_0088111
870 Ga0495680_0631655
871 Ga0495684_0195538
872 Ga0495684_0252774
873 Ga0495602_0624542
874 Ga0495614_0444700
875 Ga0496102_1128083
876 Ga0496102_1465224
877 Ga0496104_0169296
878 Ga0496104_0260065
879 Ga0496105_0149696
880 Ga0496105_0277263
881 Ga0496105_0831082
882 Ga0496108_0227865
883 Ga0496109_0050155
884 Ga0496113_0184383
885 Ga0496114_0375889
886 Ga0501299_079383
887 Ga0501032_0237429
888 Ga0501037_0540770
889 Ga0501039_0717487
890 Ga0501040_0234665
891 Ga0501040_0489604
892 Ga0501041_0011118
893 Ga0501042_0096829
894 Ga0501043_0264114
895 Ga0501048_0034767
896 Ga0501071_0123055
897 Ga0501072_0009032
898 Ga0501074_1150156
899 Ga0501075_0640295
900 Ga0501076_0226734
901 Ga0501076_1086319
902 Ga0501077_0239562
903 Ga0501077_0333815
904 Ga0501239_078110
905 Ga0501249_014147
906 Ga0501225_0112240
907 Ga0501079_0040237
908 Ga0501080_0055383
909 Ga0501081_0200933
910 Ga0501081_0530731
911 Ga0501083_0122458
912 Ga0501272_019106
913 Ga0501273_029496
914 Ga0501283_013187
915 nmdc:mga05p37_1067569_c1
916 nmdc:mga05p37_1798_c1
917 nmdc:mga05p37_51655_c1
918 nmdc:mga05p37_710621_c1
919 nmdc:mga09592_537984_c1
920 nmdc:mga0qj67_429910_c1
921 nmdc:mga06r32_1177392_c1
922 nmdc:mga06r32_265688_c1
923 nmdc:mga06r32_558445_c1
924 nmdc:mga08y16_12953_c1
925 nmdc:mga08y16_195_c1
926 nmdc:mga08y16_4556_c1
927 nmdc:mga08y16_469030_c1
928 nmdc:mga0n895_500697_c1
929 nmdc:mga0rr50_415168_c1
930 nmdc:mga0a205_150130_c1
931 nmdc:mga0a205_176936_c1
932 nmdc:mga0a205_637199_c1
933 Ga0495612_0266022
934 Ga0495595_0275527
935 Ga0495619_0103164
936 Ga0495619_0387703
937 Ga0495619_1166583
938 Ga0500644_0079040
939 Ga0500595_013481
940 Ga0500658_0059512
941 Ga0501084_0042315
942 Ga0590071_000119
943 Ga0590074_000082
944 Ga0590075_000216
945 Ga0590077_000315
946 Ga0501082_0149958
947 Ga0501082_0663670
948 Ga0530510_0172761

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02575

YbaB_DNA_bd

YbaB/EbfC DNA-binding family

24

117

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g3d-assembly1.cif.gz_3T 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.7548 12 37
3bu2-assembly1.cif.gz_D crystal structure of a trna-binding protein from staphylococcus saprophyticus subsp. saprophyticus. northeast structural genomics consortium target syr77 0.685 12 38
8d3q-assembly1.cif.gz_A type i-c cas4-cas1-cas2 complex bound to a pam/nopam prespacer 0.6552 11 35
5efi-assembly1.cif.gz_A crystal structure of mouse cd1d in complex with the p99p lipopeptide 0.6366 20 68
8egk-assembly1.cif.gz_A re-refinement of crystal structure of nosget3d, the all4481 protein from nostoc sp. pcc 7120 0.6316 9 41
ID Description Score Start End Superfamily
af_Q9VYT5_290_393_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8247 10 34 2.60.40.790
af_C7G007_3_287_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.7412 12 35 2.70.98.10
af_Q4D015_9_98_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7309 10 34 2.60.40.790
af_I1JVV8_800_1053_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.7116 11 39 2.70.98.10
af_Q2FXI8_18_89_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7075 12 34 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7Y0L4L9-F1-model_v4 Glycoside hydrolase family 38 central domain-containing protein 0.8076 11 35 GO:0004559
GO:0006013
GO:0009313
GO:0030246
GO:0046872
AF-A8S4L2-F1-model_v4 Uncharacterized protein 0.7655 1 38
AF-A0A7X8K3G2-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.7319 2 83 GO:0003677
AF-A0A7X8K3G2-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.7156 2 83 GO:0003677
AF-A0A554L1E9-F1-model_v4 Nucleoid-associated protein 0.6881 3 78

Map