F451143

General Info

Members Datasets Scaffolds Average Seq Length
474 316 401 277

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100023496|Ga0070711_1000234963
Length 297
Sequence MDKPSLSPAVKYLPGEDIMFEMKKKLRPFRDYDARHFSWTTDDTGRVGTITLNRPDKKNPLTFDSYEELRDLFRDLAYASDVRAIVLTGAEGNFCSGGDVFEIIEPLTRMAMPDLLAFTRMTGDVVKAMRKCPQIIVAAIDGICAGAGAMLALASDLRLATPQAKTAFLFTRVGLAGADMGACGLLPRVIGQGRAAELLYTGRAMSAEEGLAWGFHNRLVPAAELAGASQELACSLADGPWFAHGVTKTMFNQEWAMGVDEMIESEAQAQAICMVTGDFRRAFEAFAAKQKPVFEGN

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
9 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
10 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
11 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
12 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
13 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
14 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
15 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
16 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
17 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
18 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
19 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
20 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
21 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
22 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
23 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
24 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
25 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
26 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
27 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
28 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
29 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
30 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
31 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
32 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
33 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
34 2854911287 Brucella lupini LUP21 Isolate Unclassified
35 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
36 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
37 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
38 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
39 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
40 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
41 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
42 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
43 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
44 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
45 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
46 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
47 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
48 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
49 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
50 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
51 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
52 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
53 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
54 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
55 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
56 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
57 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
58 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
59 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
60 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
61 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
62 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
63 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
64 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
65 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
66 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
67 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
68 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
69 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
70 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
99 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
100 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
148 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
150 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
151 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
200 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
224 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
246 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
256 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
257 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
258 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
274 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
275 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
276 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
284 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
306 639633007 Azoarcus olearius BH72 Isolate Unclassified
307 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
308 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
309 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
310 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
311 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
312 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
313 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
314 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
315 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
316 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.14
Metatranscriptomes 0
Isolates 14.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.96
Nodule 9.28
Rhizoplane 2.95
Rhizosphere 68.14
Stem 0
Stem Tuber 0
Unclassified 12.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10028832 3300001979 Bacteria 1829
2 JGI24737J22298_10088084 3300001990 Bacteria 922
3 JGI25162J39368_1000418 3300002737 Bacteria 34635
4 JGI25162J39368_1000908 3300002737 Bacteria 19122
5 JGI25165J46597_1000375 3300003214 Bacteria 49445
6 JGI25165J46597_1001183 3300003214 Bacteria 15928
7 rootL2_10075222 3300003322 Bacteria 3240
8 JGI25160J50197_1000001 3300003354 Bacteria 782301
9 JGI25161J50226_1000047 3300003374 Bacteria 113472
10 Ga0055524_1000025 3300003775 Bacteria 216427
11 Ga0055530_10001346 3300003791 Bacteria 18344
12 Ga0055543_1000007 3300004625 Bacteria 204042
13 Ga0065165_1000464 3300005262 Bacteria 63619
14 Ga0070658_10024489 3300005327 Bacteria 4841
15 Ga0070658_10076915 3300005327 Bacteria 2737
16 Ga0070658_10505256 3300005327 Bacteria 1044
17 Ga0070677_10002765 3300005333 Bacteria 5615
18 Ga0070680_100056726 3300005336 Bacteria 3202
19 Ga0070675_100005354 3300005354 Bacteria 9811
20 Ga0070673_100098676 3300005364 Bacteria 2401
21 Ga0070714_100003446 3300005435 Bacteria 11790
22 Ga0070714_100012941 3300005435 Bacteria 6671
23 Ga0070714_100068628 3300005435 Bacteria 3059
24 Ga0070711_100023496 3300005439 Bacteria 4010
25 Ga0070711_100098394 3300005439 Bacteria 2124
26 Ga0070700_100073620 3300005441 Bacteria 2187
27 Ga0070662_100002820 3300005457 Bacteria 10782
28 Ga0070681_10157113 3300005458 Bacteria 2198
29 Ga0070706_100001300 3300005467 Bacteria 26618
30 Ga0070698_100013230 3300005471 Bacteria 8732
31 Ga0070679_100003224 3300005530 Bacteria 14897
32 Ga0070697_100000723 3300005536 Bacteria 24580
33 Ga0070695_100072788 3300005545 Bacteria 2254
34 Ga0070696_100008670 3300005546 Bacteria 6803
35 Ga0068864_100002148 3300005618 Bacteria 16299
36 Ga0068863_100004237 3300005841 Bacteria 14162
37 Ga0068863_100610966 3300005841 Bacteria 1080
38 Ga0070717_10017541 3300006028 Bacteria 5573
39 Ga0075364_10116018 3300006051 Bacteria 1790
40 Ga0070716_100143864 3300006173 Bacteria 1525
41 Ga0070712_100166917 3300006175 Bacteria 1705
42 Ga0075428_100000047 3300006844 Bacteria 96882
43 Ga0075428_100026392 3300006844 Bacteria 6430
44 Ga0075428_100351946 3300006844 Bacteria 1581
45 Ga0075430_100011828 3300006846 Bacteria 7427
46 Ga0075430_100057362 3300006846 Bacteria 3276
47 Ga0075430_100215548 3300006846 Bacteria 1593
48 Ga0075431_100024212 3300006847 Bacteria 6218
49 Ga0075431_100028944 3300006847 Bacteria 5697
50 Ga0075431_100508654 3300006847 Bacteria 1195
51 Ga0075433_10289230 3300006852 Bacteria 1452
52 Ga0075429_100000047 3300006880 Bacteria 56773
53 Ga0075429_100066915 3300006880 Bacteria 3127
54 Ga0099825_1033904 3300006941 Bacteria 1941
55 Ga0099824_1008419 3300006942 Bacteria 13200
56 Ga0099822_1004408 3300006943 Bacteria 18339
57 Ga0079104_1000103 3300006946 Bacteria 124578
58 Ga0105240_10071163 3300009093 Bacteria 4302
59 Ga0105240_10117669 3300009093 Bacteria 3203
60 Ga0111539_10026137 3300009094 Bacteria 7145
61 Ga0111539_10767054 3300009094 Bacteria 1122
62 Ga0114129_10000040 3300009147 Bacteria 107971
63 Ga0105241_10049417 3300009174 Bacteria 3203
64 Ga0105238_10044320 3300009551 Bacteria 4498
65 Ga0105238_10388932 3300009551 Bacteria 1387
66 Ga0105239_10017886 3300010375 Bacteria 7840
67 Ga0105239_10321322 3300010375 Bacteria 1745
68 Ga0157371_10044760 3300013102 Bacteria 3151
69 Ga0157372_10293059 3300013307 Bacteria 1892
70 Ga0163163_10164572 3300014325 Bacteria 2264
71 Ga0182008_10006847 3300014497 Bacteria 6341
72 Ga0182006_1000004 3300015261 Bacteria 622190
73 Ga0182007_10000017 3300015262 Bacteria 199097
74 Ga0182005_1000030 3300015265 Bacteria 213092
75 Ga0163161_10139928 3300017792 Bacteria 1832
76 Ga0213875_10012926 3300021388 Bacteria 4111
77 Ga0213875_10026533 3300021388 Bacteria 2756
78 Ga0209437_100058 3300025233 Bacteria 357279
79 Ga0209437_100060 3300025233 Bacteria 355034
80 Ga0209646_1007576 3300025246 Bacteria 1768
81 Ga0209233_1000240 3300025261 Bacteria 90758
82 Ga0209233_1000275 3300025261 Bacteria 72941
83 Ga0209233_1015054 3300025261 Bacteria 2165
84 Ga0209565_1010423 3300025263 Bacteria 2305
85 Ga0209455_1012089 3300025272 Bacteria 2085
86 Ga0209130_1000145 3300025284 Bacteria 113201
87 Ga0209675_1028545 3300025291 Bacteria 1355
88 Ga0209676_1016588 3300025292 Bacteria 2649
89 Ga0209676_1040895 3300025292 Bacteria 1301
90 Ga0209564_1048564 3300025295 Bacteria 1059
91 Ga0209050_1013898 3300025298 Bacteria 3526
92 Ga0209256_1000040 3300025299 Bacteria 366839
93 Ga0207426_1000011 3300025302 Bacteria 791203
94 Ga0209051_1003857 3300025303 Bacteria 9585
95 Ga0207682_10004425 3300025893 Bacteria 5880
96 Ga0207684_10000756 3300025910 Bacteria 37726
97 Ga0207684_10300533 3300025910 Bacteria 1384
98 Ga0207654_10069774 3300025911 Bacteria 2084
99 Ga0207707_10039517 3300025912 Bacteria 4123
100 Ga0207695_10018985 3300025913 Bacteria 7929
101 Ga0207693_10030616 3300025915 Bacteria 4251
102 Ga0207663_10014509 3300025916 Bacteria 4316
103 Ga0207649_10108273 3300025920 Bacteria 1852
104 Ga0207652_10008542 3300025921 Bacteria 8243
105 Ga0207694_10141868 3300025924 Bacteria 1932
106 Ga0207650_10000295 3300025925 Bacteria 50101
107 Ga0207650_10061622 3300025925 Bacteria 2801
108 Ga0207664_10006370 3300025929 Bacteria 8115
109 Ga0207706_10001865 3300025933 Bacteria 20654
110 Ga0207691_10167784 3300025940 Bacteria 1923
111 Ga0207702_10269300 3300026078 Bacteria 1606
112 Ga0207702_10687301 3300026078 Bacteria 1008
113 Ga0207641_10003370 3300026088 Bacteria 14184
114 Ga0207676_10003767 3300026095 Bacteria 10719
115 Ga0209281_1000512 3300027111 Bacteria 50723
116 Ga0209371_1004388 3300027312 Bacteria 6180
117 Ga0209589_1000001 3300027357 Bacteria 794224
118 Ga0209489_100001 3300027361 Bacteria 794224
119 Ga0209700_100001 3300027363 Bacteria 794224
120 Ga0207428_10001680 3300027907 Bacteria 22860
121 Ga0268264_10322817 3300028381 Bacteria 1460
122 Ga0307515_10000110 3300028794 Bacteria 195560
123 Ga0307515_10000367 3300028794 Bacteria 111166
124 Ga0307515_10092307 3300028794 Bacteria 3770
125 Ga0265338_10064774 3300028800 Bacteria 3176
126 Ga0268256_1004130 3300030500 Bacteria 6180
127 Ga0265313_10003573 3300031595 Bacteria 12504
128 Ga0307508_10124709 3300031616 Bacteria 2178
129 Ga0307405_10355099 3300031731 Bacteria 1132
130 Ga0307410_10057217 3300031852 Bacteria 2654
131 Ga0307410_10127310 3300031852 Bacteria 1866
132 Ga0307412_10044543 3300031911 Bacteria 2895
133 Ga0307416_100103763 3300032002 Bacteria 2483
134 Ga0307414_10218099 3300032004 Bacteria 1564
135 Ga0307414_10277099 3300032004 Bacteria 1408
136 Ga0307415_100034134 3300032126 Bacteria 3308
137 Ga0307415_100149943 3300032126 Bacteria 1793
138 Ga0315911_1000002 3300033442 Bacteria 926833
139 Ga0373926_0002441 3300035083 Bacteria 5891
140 Ga0373936_0018464 3300035113 Bacteria 2693
141 Ga0373943_0017370 3300035170 Bacteria 3291
142 Ga0373946_0008231 3300035171 Bacteria 3827
143 Ga0373946_0060384 3300035171 Bacteria 1611
144 Ga0373924_0056823 3300035410 Bacteria 1631
145 Ga0373935_0004485 3300035692 Bacteria 8199
146 Ga0373935_0124809 3300035692 Bacteria 1723
147 Ga0373935_0203160 3300035692 Bacteria 1370
148 Ga0373927_0002164 3300035695 Bacteria 14426
149 Ga0373927_0013556 3300035695 Bacteria 5413
150 Ga0373927_0038490 3300035695 Bacteria 3105
151 Ga0373927_0105796 3300035695 Bacteria 1832
152 Ga0373947_0045348 3300035725 Bacteria 2630
153 Ga0373947_0047509 3300035725 Bacteria 2572
154 Ga0373937_0135813 3300036401 Bacteria 2300
155 Ga0373937_0242094 3300036401 Bacteria 1700
156 Ga0373925_0003842 3300037068 Bacteria 11510
157 Ga0373925_0078708 3300037068 Bacteria 2503
158 Ga0395899_0134626 3300037312 Bacteria 1762
159 Ga0395899_0191224 3300037312 Bacteria 1432
160 Ga0395900_0000025 3300037418 Bacteria 321217
161 Ga0395900_0024716 3300037418 Bacteria 6149
162 Ga0395898_0001112 3300037466 Bacteria 41418
163 Ga0395898_0075997 3300037466 Bacteria 3244
164 Ga0395898_0085768 3300037466 Bacteria 3035
165 Ga0395905_0002883 3300037471 Bacteria 18791
166 Ga0395905_0003850 3300037471 Bacteria 15827
167 Ga0395905_0010865 3300037471 Bacteria 8818
168 Ga0395905_0022142 3300037471 Bacteria 6013
169 Ga0395905_0023594 3300037471 Bacteria 5811
170 Ga0395905_0031321 3300037471 Bacteria 5007
171 Ga0395905_0033976 3300037471 Bacteria 4790
172 Ga0395905_0038270 3300037471 Bacteria 4500
173 Ga0395905_0181123 3300037471 Bacteria 1978
174 Ga0395905_0237517 3300037471 Bacteria 1703
175 Ga0395905_0300975 3300037471 Bacteria 1491
176 Ga0436364_0566071 3300037853 Bacteria 889
177 Ga0436364_0610132 3300037853 Bacteria 30546
178 Ga0436364_1248113 3300037853 Bacteria 11178
179 Ga0436364_1503331 3300037853 Bacteria 31628
180 Ga0436364_1538817 3300037853 Bacteria 1046
181 Ga0395901_0225534 3300038443 Bacteria 1957
182 Ga0436363_0170175 3300039450 Bacteria 1317
183 Ga0436363_1083045 3300039450 Bacteria 965
184 Ga0436363_1102998 3300039450 Bacteria 1078
185 Ga0450899_005566 3300042135 Bacteria 1355
186 Ga0466969_0000075 3300044656 Bacteria 52007
187 Ga0466969_0124092 3300044656 Bacteria 1200
188 Ga0466972_0009648 3300044658 Bacteria 4843
189 Ga0466965_0041679 3300044683 Bacteria 2263
190 Ga0466965_0055752 3300044683 Bacteria 1967
191 Ga0466966_0008728 3300044684 Bacteria 6708
192 Ga0466966_0091047 3300044684 Bacteria 1893
193 Ga0466961_0002234 3300044693 Bacteria 12061
194 Ga0466963_0025036 3300044694 Bacteria 3802
195 Ga0466963_0025877 3300044694 Bacteria 3746
196 Ga0466964_0031642 3300044706 Bacteria 2099
197 Ga0453684_0194788 3300044712 Bacteria 2368
198 Ga0466971_0004052 3300044719 Bacteria 6302
199 Ga0466971_0010490 3300044719 Bacteria 4049
200 Ga0466971_0126468 3300044719 Bacteria 1185
201 Ga0466970_0065321 3300044765 Bacteria 1952
202 Ga0466957_0202100 3300044842 Bacteria 1305
203 Ga0466959_0000818 3300045049 Bacteria 18349
204 Ga0466959_0168250 3300045049 Bacteria 1538
205 Ga0451576_0007735 3300045051 Bacteria 12763
206 Ga0451576_0015646 3300045051 Bacteria 8396
207 Ga0451576_0059995 3300045051 Bacteria 3969
208 Ga0451576_0084763 3300045051 Bacteria 3296
209 Ga0466958_0208172 3300045836 Bacteria 1245
210 Ga0466967_0043164 3300045976 Bacteria 3902
211 Ga0466967_0390854 3300045976 Bacteria 1352
212 Ga0495617_000538 3300046452 Bacteria 19628
213 Ga0495627_016881 3300046453 Bacteria 2491
214 Ga0495603_0012016 3300046455 Bacteria 5241
215 Ga0495603_0064844 3300046455 Bacteria 2153
216 Ga0495590_0018857 3300046457 Bacteria 2465
217 Ga0495629_0082011 3300046459 Bacteria 2250
218 Ga0495638_0005116 3300046460 Bacteria 9821
219 Ga0495638_0033642 3300046460 Bacteria 3277
220 Ga0495638_0083592 3300046460 Bacteria 1933
221 Ga0495651_0237988 3300046462 Bacteria 1250
222 Ga0495650_0000140 3300046471 Bacteria 169317
223 Ga0495580_0020689 3300046472 Bacteria 4866
224 Ga0495580_0050890 3300046472 Bacteria 2928
225 Ga0495580_0120307 3300046472 Bacteria 1823
226 Ga0495582_0064085 3300046473 Bacteria 2029
227 Ga0495605_0033350 3300046474 Bacteria 2613
228 Ga0495605_0059761 3300046474 Bacteria 1829
229 Ga0495639_0008293 3300046475 Bacteria 4459
230 Ga0495639_0008501 3300046475 Bacteria 4402
231 Ga0495662_0035498 3300046476 Bacteria 2405
232 Ga0495662_0110018 3300046476 Bacteria 1350
233 Ga0495584_0000245 3300046491 Bacteria 39368
234 Ga0495585_0000005 3300046492 Bacteria 328103
235 Ga0495585_0000049 3300046492 Bacteria 119546
236 Ga0495585_0000162 3300046492 Bacteria 71606
237 Ga0495585_0000608 3300046492 Bacteria 33524
238 Ga0495585_0005013 3300046492 Bacteria 8455
239 Ga0495585_0006540 3300046492 Bacteria 7214
240 Ga0495585_0020736 3300046492 Bacteria 3778
241 Ga0495585_0029921 3300046492 Bacteria 3098
242 Ga0495585_0036125 3300046492 Bacteria 2789
243 Ga0495585_0150192 3300046492 Bacteria 1215
244 Ga0495594_0143572 3300046499 Bacteria 1354
245 Ga0495596_0001380 3300046500 Bacteria 13935
246 Ga0495596_0006046 3300046500 Bacteria 5642
247 Ga0495607_0024573 3300046501 Bacteria 3754
248 Ga0495607_0031837 3300046501 Bacteria 3225
249 Ga0495607_0053857 3300046501 Bacteria 2321
250 Ga0495583_0000016 3300046506 Bacteria 312691
251 Ga0495583_0000480 3300046506 Bacteria 58370
252 Ga0495583_0022273 3300046506 Bacteria 3236
253 Ga0495606_0000256 3300046507 Bacteria 93906
254 Ga0495606_0002184 3300046507 Bacteria 23486
255 Ga0495606_0039375 3300046507 Bacteria 3187
256 Ga0495606_0123356 3300046507 Bacteria 1548
257 Ga0495610_0041891 3300046512 Bacteria 2294
258 Ga0495616_0000736 3300046513 Bacteria 24068
259 Ga0495616_0165053 3300046513 Bacteria 993
260 Ga0495620_0001714 3300046515 Bacteria 12947
261 Ga0495630_0075368 3300046517 Bacteria 2542
262 Ga0495637_0020895 3300046520 Bacteria 3004
263 Ga0495644_0012695 3300046523 Bacteria 3238
264 Ga0495644_0014161 3300046523 Bacteria 3055
265 Ga0495644_0043915 3300046523 Bacteria 1681
266 Ga0495648_0000033 3300046524 Bacteria 199184
267 Ga0495648_0047939 3300046524 Bacteria 2634
268 Ga0495666_0032011 3300046526 Bacteria 2576
269 Ga0495642_0010392 3300046528 Bacteria 3565
270 Ga0495642_0053667 3300046528 Bacteria 1661
271 Ga0495665_0059177 3300046531 Bacteria 2022
272 Ga0495586_0068434 3300046535 Bacteria 1937
273 Ga0495586_0239996 3300046535 Bacteria 1033
274 Ga0495609_0004264 3300046538 Bacteria 7890
275 Ga0495609_0023254 3300046538 Bacteria 2849
276 Ga0495609_0029719 3300046538 Bacteria 2487
277 Ga0495609_0049618 3300046538 Bacteria 1872
278 Ga0495622_0011945 3300046557 Bacteria 4017
279 Ga0495622_0026387 3300046557 Bacteria 2713
280 Ga0495622_0037193 3300046557 Bacteria 2268
281 Ga0495633_0000253 3300046558 Bacteria 63420
282 Ga0495633_0001630 3300046558 Bacteria 16931
283 Ga0495633_0003867 3300046558 Bacteria 9786
284 Ga0495633_0013490 3300046558 Bacteria 4304
285 Ga0495633_0068904 3300046558 Bacteria 1651
286 Ga0495633_0084266 3300046558 Bacteria 1478
287 Ga0495656_0080294 3300046615 Bacteria 1470
288 Ga0495668_0027886 3300046616 Bacteria 3198
289 Ga0495611_0004737 3300046648 Bacteria 5844
290 Ga0495611_0023112 3300046648 Bacteria 2695
291 Ga0495611_0054542 3300046648 Bacteria 1807
292 Ga0495625_0006164 3300046660 Bacteria 10741
293 Ga0495625_0020687 3300046660 Bacteria 5072
294 Ga0495625_0286398 3300046660 Bacteria 1058
295 Ga0495635_0098088 3300046663 Bacteria 2003
296 Ga0495659_0011850 3300046664 Bacteria 2812
297 Ga0495661_0060148 3300046665 Bacteria 2258
298 Ga0495661_0222458 3300046665 Bacteria 977
299 Ga0495588_0004925 3300046674 Bacteria 5925
300 Ga0495588_0016320 3300046674 Bacteria 3588
301 Ga0495588_0072869 3300046674 Bacteria 1787
302 Ga0495647_0021471 3300046681 Bacteria 2324
303 Ga0495647_0168965 3300046681 Bacteria 946
304 Ga0495658_0006458 3300046683 Bacteria 5761
305 Ga0495658_0065612 3300046683 Bacteria 2094
306 Ga0495613_0068924 3300046689 Bacteria 2579
307 Ga0495670_0001639 3300046691 Bacteria 10956
308 Ga0495670_0002474 3300046691 Bacteria 9116
309 Ga0495670_0011029 3300046691 Bacteria 4442
310 Ga0495670_0025559 3300046691 Bacteria 2921
311 Ga0495649_0083028 3300046694 Bacteria 1712
312 Ga0495589_0047509 3300046794 Bacteria 2127
313 Ga0495600_0012132 3300046809 Bacteria 5382
314 Ga0495660_0020846 3300046810 Bacteria 3757
315 Ga0495581_0020912 3300047315 Bacteria 3797
316 Ga0495581_0039991 3300047315 Bacteria 2714
317 Ga0495636_0013845 3300047318 Bacteria 3202
318 Ga0495676_0135306 3300047321 Bacteria 1773
319 Ga0495680_0017468 3300047322 Bacteria 6126
320 Ga0495683_0000072 3300047323 Bacteria 104027
321 Ga0495683_0015297 3300047323 Bacteria 3994
322 Ga0495683_0182269 3300047323 Bacteria 958
323 Ga0495687_000956 3300047443 Bacteria 29643
324 Ga0495687_014359 3300047443 Bacteria 4081
325 Ga0495687_025742 3300047443 Bacteria 2775
326 Ga0495687_071686 3300047443 Bacteria 1387
327 Ga0495677_0009330 3300047445 Bacteria 3625
328 Ga0495677_0069207 3300047445 Bacteria 1315
329 Ga0495685_000035 3300047447 Bacteria 55942
330 Ga0495673_0014197 3300047469 Bacteria 4148
331 Ga0495673_0022023 3300047469 Bacteria 3131
332 Ga0495681_0056103 3300047470 Bacteria 1834
333 Ga0495684_0009579 3300047471 Bacteria 7467
334 Ga0495593_0022042 3300047673 Bacteria 3554
335 Ga0495593_0041301 3300047673 Bacteria 2480
336 Ga0495614_0123979 3300048089 Bacteria 1141
337 Ga0495626_0064704 3300048091 Bacteria 1656
338 Ga0496101_0113167 3300048904 Bacteria 2045
339 Ga0496104_0000242 3300048907 Bacteria 48242
340 Ga0496104_0283754 3300048907 Bacteria 1569
341 Ga0496105_0003376 3300048908 Bacteria 11802
342 Ga0496108_0003157 3300048911 Bacteria 13260
343 Ga0496109_0002572 3300048912 Bacteria 15196
344 Ga0496110_0000700 3300048913 Bacteria 23141
345 Ga0496111_0020570 3300048914 Bacteria 4595
346 Ga0496112_0052131 3300048915 Bacteria 4015
347 Ga0496112_0082850 3300048915 Bacteria 3172
348 Ga0496113_0002049 3300048916 Bacteria 11582
349 Ga0496115_0056828 3300048918 Bacteria 3146
350 Ga0496116_0068480 3300048919 Bacteria 2261
351 Ga0496116_0147617 3300048919 Bacteria 1312
352 Ga0496117_0000011 3300048920 Bacteria 610930
353 Ga0496118_0000010 3300048921 Bacteria 610930
354 Ga0496118_0059059 3300048921 Bacteria 2860
355 Ga0496120_0019312 3300048923 Bacteria 4362
356 Ga0496121_0003356 3300048924 Bacteria 22972
357 Ga0496121_0009435 3300048924 Bacteria 11215
358 Ga0496121_0013494 3300048924 Bacteria 8770
359 Ga0496121_0042671 3300048924 Bacteria 3941
360 Ga0496121_0079889 3300048924 Bacteria 2595
361 Ga0496122_0004818 3300048925 Bacteria 16453
362 Ga0496122_0006148 3300048925 Bacteria 13961
363 Ga0496123_0029412 3300048926 Bacteria 4045
364 Ga0496124_0028496 3300048927 Bacteria 4995
365 Ga0496125_0000419 3300048928 Bacteria 78983
366 Ga0496125_0053094 3300048928 Bacteria 3326
367 Ga0496126_0009464 3300048929 Bacteria 10341
368 Ga0496126_0133964 3300048929 Bacteria 2139
369 Ga0496126_0147580 3300048929 Bacteria 2018
370 Ga0495678_021801 3300049459 Bacteria 2814
371 Ga0495678_028625 3300049459 Bacteria 2349
372 Ga0495682_0001028 3300049460 Bacteria 16463
373 Ga0495682_0002004 3300049460 Bacteria 10060
374 Ga0501038_0140754 3300049574 Bacteria 1974
375 Ga0501039_0049230 3300049575 Bacteria 3258
376 Ga0501040_0027572 3300049576 Bacteria 3825
377 Ga0501047_0028196 3300049581 Bacteria 5411
378 Ga0501067_0048116 3300049583 Bacteria 2365
379 Ga0501068_0416801 3300049584 Bacteria 867
380 Ga0501227_031505 3300049665 Bacteria 1275
381 Ga0501035_0180595 3300049822 Bacteria 1818
382 Ga0501044_0086357 3300049823 Bacteria 3169
383 nmdc:mga00v17_125646_c1 3300050491 Bacteria 1636
384 nmdc:mga00v17_26457_c1 3300050491 Bacteria 3381
385 nmdc:mga0yw44_92560_c1 3300050492 Bacteria 1913
386 nmdc:mga0k408_141519_c1 3300050493 Bacteria 1431
387 nmdc:mga05p37_548_c1 3300050507 Bacteria 41310
388 nmdc:mga09592_335_c1 3300050508 Bacteria 34453
389 nmdc:mga09592_341252_c1 3300050508 Bacteria 1297
390 nmdc:mga0qj67_35269_c1 3300050509 Bacteria 3910
391 nmdc:mga0qj67_65096_c1 3300050509 Bacteria 2901
392 nmdc:mga06r32_15302_c2 3300050510 Bacteria 4863
393 nmdc:mga06r32_281350_c1 3300050510 Bacteria 1650
394 nmdc:mga06r32_91095_c1 3300050510 Bacteria 2979
395 nmdc:mga08y16_108282_c1 3300050511 Bacteria 2893
396 nmdc:mga08y16_4082_c1 3300050511 Bacteria 15245
397 Ga0495619_0025023 3300053085 Bacteria 3830
398 Ga0500556_0033204 3300053104 Bacteria 1769
399 Ga0500559_0008200 3300053136 Bacteria 4593
400 Ga0466962_0008903 3300061719 Bacteria 4812
401 Ga0466962_0034292 3300061719 Bacteria 2429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006051 Ga0075364_10116018 Ga0075364_101160182 244
2 3300050491 nmdc:mga00v17_125646_c1 nmdc:mga00v17_125646_c1_606_1463 244
3 3300037853 Ga0436364_1538817 Ga0436364_1538817_25_771 246
4 3300039450 Ga0436363_1083045 Ga0436363_1083045_111_932 253
5 3300050510 nmdc:mga06r32_15302_c2 nmdc:mga06r32_15302_c2_15_824 257
6 3300021388 Ga0213875_10026533 Ga0213875_100265332 258
7 3300037853 Ga0436364_0610132 Ga0436364_0610132_1214_2032 258
8 3300005354 Ga0070675_100005354 Ga0070675_1000053548 259
9 3300005364 Ga0070673_100098676 Ga0070673_1000986763 259
10 3300006847 Ga0075431_100028944 Ga0075431_1000289441 259
11 3300006880 Ga0075429_100066915 Ga0075429_1000669152 259
12 3300025940 Ga0207691_10167784 Ga0207691_101677842 259
13 3300047443 Ga0495687_071686 Ga0495687_071686_208_1062 259
14 3300050508 nmdc:mga09592_341252_c1 nmdc:mga09592_341252_c1_429_1238 259
15 3300050511 nmdc:mga08y16_108282_c1 nmdc:mga08y16_108282_c1_1637_2446 259
16 3300046492 Ga0495585_0006540 Ga0495585_0006540_5829_6683 260
17 3300046515 Ga0495620_0001714 Ga0495620_0001714_2130_2984 260
18 3300046528 Ga0495642_0010392 Ga0495642_0010392_2321_3175 260
19 3300046648 Ga0495611_0054542 Ga0495611_0054542_186_1040 260
20 3300046810 Ga0495660_0020846 Ga0495660_0020846_1269_2123 260
21 3300047470 Ga0495681_0056103 Ga0495681_0056103_692_1546 260
22 3300003791 Ga0055530_10001346 Ga0055530_100013469 261
23 3300006844 Ga0075428_100351946 Ga0075428_1003519462 261
24 3300006846 Ga0075430_100011828 Ga0075430_1000118286 261
25 3300006847 Ga0075431_100508654 Ga0075431_1005086542 261
26 3300050509 nmdc:mga0qj67_35269_c1 nmdc:mga0qj67_35269_c1_727_1515 261
27 3300050510 nmdc:mga06r32_281350_c1 nmdc:mga06r32_281350_c1_86_874 261
28 3300005536 Ga0070697_100000723 Ga0070697_1000007237 262
29 3300005545 Ga0070695_100072788 Ga0070695_1000727882 262
30 3300005546 Ga0070696_100008670 Ga0070696_1000086703 262
31 3300005618 Ga0068864_100002148 Ga0068864_1000021483 262
32 3300005841 Ga0068863_100004237 Ga0068863_1000042378 262
33 3300005841 Ga0068863_100610966 Ga0068863_1006109662 262
34 3300006844 Ga0075428_100000047 Ga0075428_10000004749 262
35 3300006846 Ga0075430_100057362 Ga0075430_1000573625 262
36 3300006847 Ga0075431_100024212 Ga0075431_1000242125 262
37 3300006852 Ga0075433_10289230 Ga0075433_102892301 262
38 3300006880 Ga0075429_100000047 Ga0075429_10000004710 262
39 3300009094 Ga0111539_10026137 Ga0111539_100261379 262
40 3300009147 Ga0114129_10000040 Ga0114129_1000004093 262
41 3300014325 Ga0163163_10164572 Ga0163163_101645722 262
42 3300025910 Ga0207684_10300533 Ga0207684_103005332 262
43 3300025925 Ga0207650_10061622 Ga0207650_100616222 262
44 3300026088 Ga0207641_10003370 Ga0207641_100033707 262
45 3300026095 Ga0207676_10003767 Ga0207676_100037678 262
46 3300027907 Ga0207428_10001680 Ga0207428_1000168025 262
47 3300035083 Ga0373926_0002441 Ga0373926_0002441_29_820 262
48 3300035113 Ga0373936_0018464 Ga0373936_0018464_751_1542 262
49 3300035170 Ga0373943_0017370 Ga0373943_0017370_1769_2560 262
50 3300035171 Ga0373946_0008231 Ga0373946_0008231_212_1003 262
51 3300035410 Ga0373924_0056823 Ga0373924_0056823_391_1182 262
52 3300035692 Ga0373935_0004485 Ga0373935_0004485_3721_4512 262
53 3300035695 Ga0373927_0013556 Ga0373927_0013556_2990_3781 262
54 3300035725 Ga0373947_0045348 Ga0373947_0045348_992_1783 262
55 3300037068 Ga0373925_0078708 Ga0373925_0078708_918_1709 262
56 3300045049 Ga0466959_0168250 Ga0466959_0168250_543_1361 262
57 3300045051 Ga0451576_0084763 Ga0451576_0084763_1428_2219 262
58 3300046455 Ga0495603_0012016 Ga0495603_0012016_762_1553 262
59 3300046472 Ga0495580_0020689 Ga0495580_0020689_1740_2531 262
60 3300046475 Ga0495639_0008501 Ga0495639_0008501_2370_3161 262
61 3300046507 Ga0495606_0000256 Ga0495606_0000256_56823_57689 262
62 3300046526 Ga0495666_0032011 Ga0495666_0032011_1740_2531 262
63 3300046535 Ga0495586_0068434 Ga0495586_0068434_1108_1899 262
64 3300046674 Ga0495588_0016320 Ga0495588_0016320_1579_2370 262
65 3300046683 Ga0495658_0006458 Ga0495658_0006458_4220_5011 262
66 3300046691 Ga0495670_0002474 Ga0495670_0002474_6844_7698 262
67 3300047315 Ga0495581_0020912 Ga0495581_0020912_2183_2974 262
68 3300047321 Ga0495676_0135306 Ga0495676_0135306_511_1302 262
69 3300049459 Ga0495678_028625 Ga0495678_028625_153_947 262
70 3300049574 Ga0501038_0140754 Ga0501038_0140754_479_1270 262
71 3300049575 Ga0501039_0049230 Ga0501039_0049230_1811_2602 262
72 3300049576 Ga0501040_0027572 Ga0501040_0027572_1467_2258 262
73 3300050507 nmdc:mga05p37_548_c1 nmdc:mga05p37_548_c1_11366_12157 262
74 3300050508 nmdc:mga09592_335_c1 nmdc:mga09592_335_c1_32819_33610 262
75 3300050510 nmdc:mga06r32_91095_c1 nmdc:mga06r32_91095_c1_1104_1895 262
76 3300050511 nmdc:mga08y16_4082_c1 nmdc:mga08y16_4082_c1_12988_13779 262
77 iso_pu_bacteria 3005474847 3005480954 262
78 3300005333 Ga0070677_10002765 Ga0070677_100027653 263
79 3300025893 Ga0207682_10004425 Ga0207682_100044256 263
80 3300049665 Ga0501227_031505 Ga0501227_031505_156_992 263
81 3300002737 JGI25162J39368_1000418 JGI25162J39368_100041817 264
82 3300002737 JGI25162J39368_1000908 JGI25162J39368_100090820 264
83 3300003214 JGI25165J46597_1000375 JGI25165J46597_100037531 264
84 3300003214 JGI25165J46597_1001183 JGI25165J46597_100118310 264
85 3300005435 Ga0070714_100003446 Ga0070714_1000034468 264
86 3300005439 Ga0070711_100098394 Ga0070711_1000983943 264
87 3300005441 Ga0070700_100073620 Ga0070700_1000736202 264
88 3300005457 Ga0070662_100002820 Ga0070662_1000028204 264
89 3300005467 Ga0070706_100001300 Ga0070706_10000130019 264
90 3300005471 Ga0070698_100013230 Ga0070698_1000132304 264
91 3300006028 Ga0070717_10017541 Ga0070717_100175413 264
92 3300006173 Ga0070716_100143864 Ga0070716_1001438642 264
93 3300006941 Ga0099825_1033904 Ga0099825_10339042 264
94 3300006942 Ga0099824_1008419 Ga0099824_10084192 264
95 3300006943 Ga0099822_1004408 Ga0099822_100440813 264
96 3300006946 Ga0079104_1000103 Ga0079104_100010359 264
97 3300009093 Ga0105240_10117669 Ga0105240_101176694 264
98 3300009094 Ga0111539_10767054 Ga0111539_107670542 264
99 3300009174 Ga0105241_10049417 Ga0105241_100494172 264
100 3300009551 Ga0105238_10044320 Ga0105238_100443202 264
101 3300013102 Ga0157371_10044760 Ga0157371_100447603 264
102 3300021388 Ga0213875_10012926 Ga0213875_100129262 264
103 3300025261 Ga0209233_1015054 Ga0209233_10150543 264
104 3300025910 Ga0207684_10000756 Ga0207684_100007565 264
105 3300025911 Ga0207654_10069774 Ga0207654_100697742 264
106 3300025913 Ga0207695_10018985 Ga0207695_100189852 264
107 3300025920 Ga0207649_10108273 Ga0207649_101082732 264
108 3300025924 Ga0207694_10141868 Ga0207694_101418682 264
109 3300025929 Ga0207664_10006370 Ga0207664_100063704 264
110 3300025933 Ga0207706_10001865 Ga0207706_1000186514 264
111 3300026078 Ga0207702_10687301 Ga0207702_106873011 264
112 3300027111 Ga0209281_1000512 Ga0209281_100051250 264
113 3300027357 Ga0209589_1000001 Ga0209589_1000001672 264
114 3300027361 Ga0209489_100001 Ga0209489_100001672 264
115 3300027363 Ga0209700_100001 Ga0209700_100001672 264
116 3300028381 Ga0268264_10322817 Ga0268264_103228172 264
117 3300028794 Ga0307515_10000110 Ga0307515_100001101 264
118 3300028794 Ga0307515_10000367 Ga0307515_1000036761 264
119 3300028800 Ga0265338_10064774 Ga0265338_100647742 264
120 3300031616 Ga0307508_10124709 Ga0307508_101247092 264
121 3300031852 Ga0307410_10057217 Ga0307410_100572172 264
122 3300031911 Ga0307412_10044543 Ga0307412_100445432 264
123 3300032002 Ga0307416_100103763 Ga0307416_1001037632 264
124 3300032126 Ga0307415_100034134 Ga0307415_1000341343 264
125 3300033442 Ga0315911_1000002 Ga0315911_1000002434 264
126 3300035171 Ga0373946_0060384 Ga0373946_0060384_314_1132 264
127 3300035692 Ga0373935_0124809 Ga0373935_0124809_258_1076 264
128 3300035692 Ga0373935_0203160 Ga0373935_0203160_275_1114 264
129 3300035695 Ga0373927_0002164 Ga0373927_0002164_2909_3727 264
130 3300035695 Ga0373927_0038490 Ga0373927_0038490_1222_2061 264
131 3300035695 Ga0373927_0105796 Ga0373927_0105796_956_1774 264
132 3300035725 Ga0373947_0047509 Ga0373947_0047509_1604_2443 264
133 3300036401 Ga0373937_0135813 Ga0373937_0135813_980_1801 264
134 3300036401 Ga0373937_0242094 Ga0373937_0242094_636_1466 264
135 3300037068 Ga0373925_0003842 Ga0373925_0003842_4564_5382 264
136 3300037418 Ga0395900_0000025 Ga0395900_0000025_289682_290512 264
137 3300037466 Ga0395898_0001112 Ga0395898_0001112_18824_19654 264
138 3300037471 Ga0395905_0010865 Ga0395905_0010865_1513_2343 264
139 3300037471 Ga0395905_0031321 Ga0395905_0031321_4153_4983 264
140 3300037471 Ga0395905_0033976 Ga0395905_0033976_3477_4292 264
141 3300037471 Ga0395905_0300975 Ga0395905_0300975_540_1370 264
142 3300037853 Ga0436364_0566071 Ga0436364_0566071_10_834 264
143 3300037853 Ga0436364_1248113 Ga0436364_1248113_7522_8343 264
144 3300037853 Ga0436364_1503331 Ga0436364_1503331_28887_29708 264
145 3300039450 Ga0436363_1102998 Ga0436363_1102998_102_923 264
146 3300042135 Ga0450899_005566 Ga0450899_005566_107_943 264
147 3300044656 Ga0466969_0000075 Ga0466969_0000075_20960_21790 264
148 3300044656 Ga0466969_0124092 Ga0466969_0124092_315_1145 264
149 3300044658 Ga0466972_0009648 Ga0466972_0009648_3785_4615 264
150 3300044683 Ga0466965_0041679 Ga0466965_0041679_1067_1897 264
151 3300044683 Ga0466965_0055752 Ga0466965_0055752_180_1010 264
152 3300044684 Ga0466966_0008728 Ga0466966_0008728_3351_4181 264
153 3300044684 Ga0466966_0091047 Ga0466966_0091047_709_1539 264
154 3300044693 Ga0466961_0002234 Ga0466961_0002234_1293_2123 264
155 3300044694 Ga0466963_0025877 Ga0466963_0025877_890_1720 264
156 3300044706 Ga0466964_0031642 Ga0466964_0031642_219_1049 264
157 3300044712 Ga0453684_0194788 Ga0453684_0194788_235_1065 264
158 3300044719 Ga0466971_0004052 Ga0466971_0004052_339_1169 264
159 3300044719 Ga0466971_0126468 Ga0466971_0126468_266_1096 264
160 3300044765 Ga0466970_0065321 Ga0466970_0065321_855_1685 264
161 3300044842 Ga0466957_0202100 Ga0466957_0202100_444_1274 264
162 3300045049 Ga0466959_0000818 Ga0466959_0000818_10020_10850 264
163 3300045051 Ga0451576_0015646 Ga0451576_0015646_3495_4325 264
164 3300045051 Ga0451576_0059995 Ga0451576_0059995_1611_2441 264
165 3300045836 Ga0466958_0208172 Ga0466958_0208172_384_1214 264
166 3300045976 Ga0466967_0043164 Ga0466967_0043164_1366_2196 264
167 3300046455 Ga0495603_0064844 Ga0495603_0064844_633_1472 264
168 3300046459 Ga0495629_0082011 Ga0495629_0082011_1083_1901 264
169 3300046462 Ga0495651_0237988 Ga0495651_0237988_374_1192 264
170 3300046471 Ga0495650_0000140 Ga0495650_0000140_135452_136255 264
171 3300046472 Ga0495580_0050890 Ga0495580_0050890_478_1296 264
172 3300046472 Ga0495580_0120307 Ga0495580_0120307_603_1433 264
173 3300046475 Ga0495639_0008293 Ga0495639_0008293_1180_1998 264
174 3300046476 Ga0495662_0035498 Ga0495662_0035498_1004_1822 264
175 3300046499 Ga0495594_0143572 Ga0495594_0143572_269_1087 264
176 3300046517 Ga0495630_0075368 Ga0495630_0075368_447_1265 264
177 3300046531 Ga0495665_0059177 Ga0495665_0059177_959_1777 264
178 3300046535 Ga0495586_0239996 Ga0495586_0239996_90_908 264
179 3300046663 Ga0495635_0098088 Ga0495635_0098088_836_1654 264
180 3300046681 Ga0495647_0021471 Ga0495647_0021471_484_1302 264
181 3300046681 Ga0495647_0168965 Ga0495647_0168965_58_876 264
182 3300046683 Ga0495658_0065612 Ga0495658_0065612_1031_1849 264
183 3300046689 Ga0495613_0068924 Ga0495613_0068924_1016_1834 264
184 3300046809 Ga0495600_0012132 Ga0495600_0012132_2767_3585 264
185 3300047315 Ga0495581_0039991 Ga0495581_0039991_828_1646 264
186 3300047322 Ga0495680_0017468 Ga0495680_0017468_4969_5787 264
187 3300047471 Ga0495684_0009579 Ga0495684_0009579_4693_5511 264
188 3300047673 Ga0495593_0041301 Ga0495593_0041301_739_1557 264
189 3300048915 Ga0496112_0082850 Ga0496112_0082850_96_911 264
190 3300048921 Ga0496118_0059059 Ga0496118_0059059_213_1043 264
191 3300048929 Ga0496126_0009464 Ga0496126_0009464_764_1594 264
192 3300048929 Ga0496126_0147580 Ga0496126_0147580_528_1358 264
193 3300049584 Ga0501068_0416801 Ga0501068_0416801_46_846 264
194 3300049822 Ga0501035_0180595 Ga0501035_0180595_777_1607 264
195 3300050493 nmdc:mga0k408_141519_c1 nmdc:mga0k408_141519_c1_280_1116 264
196 3300050509 nmdc:mga0qj67_65096_c1 nmdc:mga0qj67_65096_c1_1664_2494 264
197 3300053085 Ga0495619_0025023 Ga0495619_0025023_2206_3024 264
198 3300061719 Ga0466962_0008903 Ga0466962_0008903_1287_2117 264
199 3300061719 Ga0466962_0034292 Ga0466962_0034292_280_1110 264
200 iso_pu_bacteria 2513237096 2513653792 264
201 iso_pu_bacteria 2513237098 2513675152 264
202 iso_pu_bacteria 2513237137 2513856229 264
203 iso_pu_bacteria 2513237145 2513918132 264
204 iso_pu_bacteria 2517572143 2517891631 264
205 iso_pu_bacteria 2524023210 2524468534 264
206 iso_pu_bacteria 2524023228 2524536769 264
207 iso_pu_bacteria 2574179768 2574433049 264
208 iso_pu_bacteria 2582581315 2585322784 264
209 iso_pu_bacteria 2585427608 2585898736 264
210 iso_pu_bacteria 2615840698 2616554733 264
211 iso_pu_bacteria 2617270742 2617383086 264
212 iso_pu_bacteria 2643221550 2643771499 264
213 iso_pu_bacteria 2643221563 2643832377 264
214 iso_pu_bacteria 2643221608 2644053828 264
215 iso_pu_bacteria 2643221643 2644242287 264
216 iso_pu_bacteria 2667528175 2671118599 264
217 iso_pu_bacteria 2721755763 2723876845 264
218 iso_pu_bacteria 2728368998 2728749387 264
219 iso_pu_bacteria 2775507266 2778175807 264
220 iso_pu_bacteria 2791355197 2793066995 264
221 iso_pu_bacteria 2818991448 2819609806 264
222 iso_pu_bacteria 2821123053 2821128807 264
223 iso_pu_bacteria 2838029111 2838034029 264
224 iso_pu_bacteria 2838736955 2838742011 264
225 iso_pu_bacteria 2841840854 2841845860 264
226 iso_pu_bacteria 2842140634 2842145564 264
227 iso_pu_bacteria 2842475841 2842480803 264
228 iso_pu_bacteria 2842482326 2842483593 264
229 iso_pu_bacteria 2842502639 2842507386 264
230 iso_pu_bacteria 2842509118 2842510516 264
231 iso_pu_bacteria 2852387548 2852390947 264
232 iso_pu_bacteria 2854911287 2854916156 264
233 iso_pu_bacteria 2857531043 2857534040 264
234 iso_pu_bacteria 2885374607 2885378535 264
235 iso_pu_bacteria 2885383462 2885387211 264
236 iso_pu_bacteria 2899803654 2899805159 264
237 iso_pu_bacteria 2903748898 2903753213 264
238 iso_pu_bacteria 2903768456 2903773826 264
239 iso_pu_bacteria 2904690495 2904697826 264
240 iso_pu_bacteria 2904699407 2904704642 264
241 iso_pu_bacteria 2906610324 2906616804 264
242 iso_pu_bacteria 2906635258 2906640119 264
243 iso_pu_bacteria 2906660503 2906667132 264
244 iso_pu_bacteria 2908739725 2908741982 264
245 iso_pu_bacteria 2908756301 2908759650 264
246 iso_pu_bacteria 2915650412 2915652315 264
247 iso_pu_bacteria 2919171160 2919175632 264
248 iso_pu_bacteria 2922425934 2922431134 264
249 iso_pu_bacteria 2935630451 2935633775 264
250 iso_pu_bacteria 2941507105 2941510922 264
251 iso_pu_bacteria 2941515067 2941518306 264
252 iso_pu_bacteria 2941523033 2941526823 264
253 iso_pu_bacteria 3005409236 3005416180 264
254 iso_pu_bacteria 3005416602 3005418694 264
255 iso_pu_bacteria 3005718088 3005721184 264
256 iso_pu_bacteria 639633007 639787080 264
257 iso_pu_bacteria 8005314921 8005318414 264
258 iso_pu_bacteria 8005645114 8005645917 264
259 iso_pu_bacteria 8006933436 8006939760 264
260 iso_pu_bacteria 8006973647 8006979528 264
261 iso_pu_bacteria 8019555841 8019565663 264
262 iso_pu_bacteria 8046767195 8046772509 264
263 iso_pu_bacteria 8056681323 8056682301 264
264 iso_pu_bacteria 8056689827 8056692597 264
265 iso_pu_bacteria 8056875544 8056879815 264
266 iso_pu_bacteria 8057575449 8057577032 264
267 3300006844 Ga0075428_100026392 Ga0075428_1000263925 265
268 3300048907 Ga0496104_0000242 Ga0496104_0000242_31559_32401 265
269 3300048908 Ga0496105_0003376 Ga0496105_0003376_6273_7115 265
270 3300048911 Ga0496108_0003157 Ga0496108_0003157_3721_4563 265
271 3300048912 Ga0496109_0002572 Ga0496109_0002572_12004_12846 265
272 3300048913 Ga0496110_0000700 Ga0496110_0000700_9591_10433 265
273 3300048915 Ga0496112_0052131 Ga0496112_0052131_2028_2870 265
274 3300048916 Ga0496113_0002049 Ga0496113_0002049_7396_8238 265
275 iso_pu_bacteria 2600255292 2601669614 265
276 iso_pu_bacteria 2857547612 2857549736 265
277 iso_pu_bacteria 2885080285 2885086077 265
278 iso_pu_bacteria 2932410948 2932415817 265
279 iso_pu_bacteria 2932416698 2932421807 265
280 3300006846 Ga0075430_100215548 Ga0075430_1002155482 266
281 3300031731 Ga0307405_10355099 Ga0307405_103550992 266
282 3300031852 Ga0307410_10127310 Ga0307410_101273102 266
283 3300032004 Ga0307414_10218099 Ga0307414_102180992 266
284 3300032004 Ga0307414_10277099 Ga0307414_102770991 266
285 3300032126 Ga0307415_100149943 Ga0307415_1001499432 266
286 3300045051 Ga0451576_0007735 Ga0451576_0007735_9147_9992 266
287 3300003322 rootL2_10075222 rootL2_100752223 267
288 3300003354 JGI25160J50197_1000001 JGI25160J50197_100000145 267
289 3300003374 JGI25161J50226_1000047 JGI25161J50226_100004759 267
290 3300004625 Ga0055543_1000007 Ga0055543_1000007150 267
291 3300005262 Ga0065165_1000464 Ga0065165_100046446 267
292 3300005336 Ga0070680_100056726 Ga0070680_1000567264 267
293 3300009093 Ga0105240_10071163 Ga0105240_100711633 267
294 3300010375 Ga0105239_10017886 Ga0105239_100178865 267
295 3300010375 Ga0105239_10321322 Ga0105239_103213222 267
296 3300015261 Ga0182006_1000004 Ga0182006_1000004464 267
297 3300025233 Ga0209437_100058 Ga0209437_100058221 267
298 3300025233 Ga0209437_100060 Ga0209437_10006045 267
299 3300025246 Ga0209646_1007576 Ga0209646_10075762 267
300 3300025261 Ga0209233_1000240 Ga0209233_100024059 267
301 3300025261 Ga0209233_1000275 Ga0209233_100027530 267
302 3300025272 Ga0209455_1012089 Ga0209455_10120893 267
303 3300025284 Ga0209130_1000145 Ga0209130_100014545 267
304 3300025292 Ga0209676_1016588 Ga0209676_10165883 267
305 3300025298 Ga0209050_1013898 Ga0209050_10138983 267
306 3300025302 Ga0207426_1000011 Ga0207426_100001145 267
307 3300025303 Ga0209051_1003857 Ga0209051_10038573 267
308 3300025925 Ga0207650_10000295 Ga0207650_1000029527 267
309 3300027312 Ga0209371_1004388 Ga0209371_10043886 267
310 3300028794 Ga0307515_10092307 Ga0307515_100923073 267
311 3300030500 Ga0268256_1004130 Ga0268256_10041306 267
312 3300031595 Ga0265313_10003573 Ga0265313_100035735 267
313 3300037471 Ga0395905_0002883 Ga0395905_0002883_9817_10668 267
314 3300037471 Ga0395905_0003850 Ga0395905_0003850_10171_11019 267
315 3300037471 Ga0395905_0023594 Ga0395905_0023594_979_1830 267
316 3300037471 Ga0395905_0038270 Ga0395905_0038270_1683_2534 267
317 3300039450 Ga0436363_0170175 Ga0436363_0170175_298_1131 267
318 3300045976 Ga0466967_0390854 Ga0466967_0390854_344_1195 267
319 3300046453 Ga0495627_016881 Ga0495627_016881_874_1725 267
320 3300046460 Ga0495638_0033642 Ga0495638_0033642_759_1610 267
321 3300046460 Ga0495638_0083592 Ga0495638_0083592_985_1836 267
322 3300046473 Ga0495582_0064085 Ga0495582_0064085_95_949 267
323 3300046476 Ga0495662_0110018 Ga0495662_0110018_351_1184 267
324 3300046501 Ga0495607_0053857 Ga0495607_0053857_1201_2052 267
325 3300046506 Ga0495583_0022273 Ga0495583_0022273_842_1693 267
326 3300046507 Ga0495606_0039375 Ga0495606_0039375_1831_2682 267
327 3300046512 Ga0495610_0041891 Ga0495610_0041891_479_1330 267
328 3300046520 Ga0495637_0020895 Ga0495637_0020895_1401_2252 267
329 3300046557 Ga0495622_0011945 Ga0495622_0011945_1653_2504 267
330 3300046660 Ga0495625_0006164 Ga0495625_0006164_8304_9155 267
331 3300046674 Ga0495588_0004925 Ga0495588_0004925_3466_4317 267
332 3300047443 Ga0495687_014359 Ga0495687_014359_58_909 267
333 3300047443 Ga0495687_025742 Ga0495687_025742_516_1367 267
334 3300048907 Ga0496104_0283754 Ga0496104_0283754_629_1480 267
335 3300048919 Ga0496116_0147617 Ga0496116_0147617_308_1159 267
336 3300048923 Ga0496120_0019312 Ga0496120_0019312_1413_2264 267
337 3300048924 Ga0496121_0013494 Ga0496121_0013494_6299_7150 267
338 3300048924 Ga0496121_0042671 Ga0496121_0042671_2783_3637 267
339 3300048924 Ga0496121_0079889 Ga0496121_0079889_754_1605 267
340 3300048925 Ga0496122_0006148 Ga0496122_0006148_5831_6682 267
341 3300048927 Ga0496124_0028496 Ga0496124_0028496_844_1695 267
342 3300048928 Ga0496125_0000419 Ga0496125_0000419_46009_46860 267
343 3300048929 Ga0496126_0133964 Ga0496126_0133964_1204_2046 267
344 3300049583 Ga0501067_0048116 Ga0501067_0048116_911_1753 267
345 3300050492 nmdc:mga0yw44_92560_c1 nmdc:mga0yw44_92560_c1_874_1722 267
346 3300053104 Ga0500556_0033204 Ga0500556_0033204_309_1160 267
347 3300053136 Ga0500559_0008200 Ga0500559_0008200_1398_2249 267
348 3300001979 JGI24740J21852_10028832 JGI24740J21852_100288322 269
349 3300001990 JGI24737J22298_10088084 JGI24737J22298_100880842 269
350 3300003775 Ga0055524_1000025 Ga0055524_100002586 269
351 3300005327 Ga0070658_10024489 Ga0070658_100244893 269
352 3300005327 Ga0070658_10076915 Ga0070658_100769151 269
353 3300005327 Ga0070658_10505256 Ga0070658_105052561 269
354 3300005435 Ga0070714_100012941 Ga0070714_1000129412 269
355 3300005435 Ga0070714_100068628 Ga0070714_1000686284 269
356 3300005439 Ga0070711_100023496 Ga0070711_1000234963 269
357 3300005458 Ga0070681_10157113 Ga0070681_101571133 269
358 3300005530 Ga0070679_100003224 Ga0070679_10000322410 269
359 3300006175 Ga0070712_100166917 Ga0070712_1001669173 269
360 3300009551 Ga0105238_10388932 Ga0105238_103889322 269
361 3300013307 Ga0157372_10293059 Ga0157372_102930592 269
362 3300014497 Ga0182008_10006847 Ga0182008_100068474 269
363 3300015262 Ga0182007_10000017 Ga0182007_1000001781 269
364 3300015265 Ga0182005_1000030 Ga0182005_100003096 269
365 3300017792 Ga0163161_10139928 Ga0163161_101399282 269
366 3300025263 Ga0209565_1010423 Ga0209565_10104232 269
367 3300025291 Ga0209675_1028545 Ga0209675_10285452 269
368 3300025292 Ga0209676_1040895 Ga0209676_10408952 269
369 3300025295 Ga0209564_1048564 Ga0209564_10485642 269
370 3300025299 Ga0209256_1000040 Ga0209256_100004099 269
371 3300025912 Ga0207707_10039517 Ga0207707_100395173 269
372 3300025915 Ga0207693_10030616 Ga0207693_100306163 269
373 3300025916 Ga0207663_10014509 Ga0207663_100145093 269
374 3300025921 Ga0207652_10008542 Ga0207652_100085425 269
375 3300026078 Ga0207702_10269300 Ga0207702_102693002 269
376 3300037312 Ga0395899_0134626 Ga0395899_0134626_570_1379 269
377 3300037312 Ga0395899_0191224 Ga0395899_0191224_238_1047 269
378 3300037418 Ga0395900_0024716 Ga0395900_0024716_1536_2345 269
379 3300037466 Ga0395898_0075997 Ga0395898_0075997_1859_2668 269
380 3300037466 Ga0395898_0085768 Ga0395898_0085768_1990_2799 269
381 3300037471 Ga0395905_0022142 Ga0395905_0022142_2664_3542 269
382 3300037471 Ga0395905_0181123 Ga0395905_0181123_815_1624 269
383 3300037471 Ga0395905_0237517 Ga0395905_0237517_419_1228 269
384 3300038443 Ga0395901_0225534 Ga0395901_0225534_1036_1845 269
385 3300044694 Ga0466963_0025036 Ga0466963_0025036_319_1128 269
386 3300044719 Ga0466971_0010490 Ga0466971_0010490_2604_3413 269
387 3300046452 Ga0495617_000538 Ga0495617_000538_16053_16907 269
388 3300046457 Ga0495590_0018857 Ga0495590_0018857_551_1405 269
389 3300046460 Ga0495638_0005116 Ga0495638_0005116_7033_7887 269
390 3300046474 Ga0495605_0033350 Ga0495605_0033350_1338_2192 269
391 3300046474 Ga0495605_0059761 Ga0495605_0059761_494_1348 269
392 3300046491 Ga0495584_0000245 Ga0495584_0000245_33493_34347 269
393 3300046492 Ga0495585_0000005 Ga0495585_0000005_241652_242506 269
394 3300046492 Ga0495585_0000049 Ga0495585_0000049_82026_82880 269
395 3300046492 Ga0495585_0000162 Ga0495585_0000162_41036_41890 269
396 3300046492 Ga0495585_0000608 Ga0495585_0000608_21681_22535 269
397 3300046492 Ga0495585_0005013 Ga0495585_0005013_6258_7112 269
398 3300046492 Ga0495585_0020736 Ga0495585_0020736_639_1493 269
399 3300046492 Ga0495585_0029921 Ga0495585_0029921_1340_2194 269
400 3300046492 Ga0495585_0036125 Ga0495585_0036125_420_1274 269
401 3300046492 Ga0495585_0150192 Ga0495585_0150192_86_940 269
402 3300046500 Ga0495596_0001380 Ga0495596_0001380_8069_8923 269
403 3300046500 Ga0495596_0006046 Ga0495596_0006046_4266_5120 269
404 3300046501 Ga0495607_0024573 Ga0495607_0024573_2282_3136 269
405 3300046501 Ga0495607_0031837 Ga0495607_0031837_690_1544 269
406 3300046506 Ga0495583_0000016 Ga0495583_0000016_303542_304396 269
407 3300046506 Ga0495583_0000480 Ga0495583_0000480_43255_44109 269
408 3300046507 Ga0495606_0002184 Ga0495606_0002184_14126_14980 269
409 3300046507 Ga0495606_0123356 Ga0495606_0123356_292_1146 269
410 3300046513 Ga0495616_0000736 Ga0495616_0000736_16448_17302 269
411 3300046513 Ga0495616_0165053 Ga0495616_0165053_86_940 269
412 3300046523 Ga0495644_0012695 Ga0495644_0012695_717_1571 269
413 3300046523 Ga0495644_0014161 Ga0495644_0014161_1657_2511 269
414 3300046523 Ga0495644_0043915 Ga0495644_0043915_724_1578 269
415 3300046524 Ga0495648_0000033 Ga0495648_0000033_112737_113591 269
416 3300046524 Ga0495648_0047939 Ga0495648_0047939_1231_2085 269
417 3300046528 Ga0495642_0053667 Ga0495642_0053667_61_915 269
418 3300046538 Ga0495609_0004264 Ga0495609_0004264_1764_2618 269
419 3300046538 Ga0495609_0023254 Ga0495609_0023254_486_1340 269
420 3300046538 Ga0495609_0029719 Ga0495609_0029719_1335_2189 269
421 3300046538 Ga0495609_0049618 Ga0495609_0049618_570_1424 269
422 3300046557 Ga0495622_0026387 Ga0495622_0026387_157_1011 269
423 3300046557 Ga0495622_0037193 Ga0495622_0037193_698_1552 269
424 3300046558 Ga0495633_0000253 Ga0495633_0000253_8742_9596 269
425 3300046558 Ga0495633_0001630 Ga0495633_0001630_2641_3495 269
426 3300046558 Ga0495633_0003867 Ga0495633_0003867_6259_7113 269
427 3300046558 Ga0495633_0013490 Ga0495633_0013490_2950_3804 269
428 3300046558 Ga0495633_0068904 Ga0495633_0068904_302_1156 269
429 3300046558 Ga0495633_0084266 Ga0495633_0084266_343_1197 269
430 3300046615 Ga0495656_0080294 Ga0495656_0080294_422_1276 269
431 3300046616 Ga0495668_0027886 Ga0495668_0027886_1543_2397 269
432 3300046648 Ga0495611_0004737 Ga0495611_0004737_1368_2222 269
433 3300046648 Ga0495611_0023112 Ga0495611_0023112_528_1382 269
434 3300046660 Ga0495625_0020687 Ga0495625_0020687_2988_3842 269
435 3300046660 Ga0495625_0286398 Ga0495625_0286398_26_880 269
436 3300046664 Ga0495659_0011850 Ga0495659_0011850_494_1348 269
437 3300046665 Ga0495661_0060148 Ga0495661_0060148_564_1418 269
438 3300046665 Ga0495661_0222458 Ga0495661_0222458_77_931 269
439 3300046674 Ga0495588_0072869 Ga0495588_0072869_900_1754 269
440 3300046691 Ga0495670_0001639 Ga0495670_0001639_6928_7782 269
441 3300046691 Ga0495670_0011029 Ga0495670_0011029_2684_3538 269
442 3300046691 Ga0495670_0025559 Ga0495670_0025559_1474_2328 269
443 3300046694 Ga0495649_0083028 Ga0495649_0083028_350_1204 269
444 3300046794 Ga0495589_0047509 Ga0495589_0047509_597_1451 269
445 3300047318 Ga0495636_0013845 Ga0495636_0013845_1569_2423 269
446 3300047323 Ga0495683_0000072 Ga0495683_0000072_59294_60148 269
447 3300047323 Ga0495683_0015297 Ga0495683_0015297_803_1657 269
448 3300047323 Ga0495683_0182269 Ga0495683_0182269_31_885 269
449 3300047443 Ga0495687_000956 Ga0495687_000956_10303_11157 269
450 3300047445 Ga0495677_0009330 Ga0495677_0009330_2758_3612 269
451 3300047445 Ga0495677_0069207 Ga0495677_0069207_448_1302 269
452 3300047447 Ga0495685_000035 Ga0495685_000035_10583_11437 269
453 3300047469 Ga0495673_0014197 Ga0495673_0014197_520_1374 269
454 3300047469 Ga0495673_0022023 Ga0495673_0022023_1457_2311 269
455 3300047673 Ga0495593_0022042 Ga0495593_0022042_1999_2853 269
456 3300048089 Ga0495614_0123979 Ga0495614_0123979_261_1115 269
457 3300048091 Ga0495626_0064704 Ga0495626_0064704_772_1626 269
458 3300048904 Ga0496101_0113167 Ga0496101_0113167_61_954 269
459 3300048914 Ga0496111_0020570 Ga0496111_0020570_3036_3890 269
460 3300048918 Ga0496115_0056828 Ga0496115_0056828_848_1702 269
461 3300048919 Ga0496116_0068480 Ga0496116_0068480_707_1561 269
462 3300048920 Ga0496117_0000011 Ga0496117_0000011_508721_509575 269
463 3300048921 Ga0496118_0000010 Ga0496118_0000010_101356_102210 269
464 3300048924 Ga0496121_0003356 Ga0496121_0003356_19278_20132 269
465 3300048924 Ga0496121_0009435 Ga0496121_0009435_2866_3720 269
466 3300048925 Ga0496122_0004818 Ga0496122_0004818_1800_2654 269
467 3300048926 Ga0496123_0029412 Ga0496123_0029412_1268_2122 269
468 3300048928 Ga0496125_0053094 Ga0496125_0053094_2272_3126 269
469 3300049459 Ga0495678_021801 Ga0495678_021801_542_1396 269
470 3300049460 Ga0495682_0001028 Ga0495682_0001028_707_1561 269
471 3300049460 Ga0495682_0002004 Ga0495682_0002004_7697_8551 269
472 3300049581 Ga0501047_0028196 Ga0501047_0028196_2636_3712 269
473 3300049823 Ga0501044_0086357 Ga0501044_0086357_112_1152 269
474 3300050491 nmdc:mga00v17_26457_c1 nmdc:mga00v17_26457_c1_2129_2986 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

42

297

0.93

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

47

292

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g64-assembly1.cif.gz_A crystal structure of putative enoyl-coa hydratase from streptomyces coelicolor a3(2) 0.964 7 269
4izd-assembly1.cif.gz_B crystal structure of dmdd e121a in complex with mmpa-coa 0.9417 9 260
7eum-assembly1.cif.gz_E crystal structure of apo nmar_1308 protein at cryogenic temperature 0.9409 12 252
5zai-assembly1.cif.gz_D crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula 0.9405 8 268
3g64-assembly1.cif.gz_A crystal structure of putative enoyl-coa hydratase from streptomyces coelicolor a3(2) 0.9394 7 269
ID Description Score Start End Superfamily
2ej5B02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9633 214 269 1.10.12.10
2ej5A02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9577 214 269 1.10.12.10
3hrxB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9492 214 269 1.10.12.10
af_P77467_205_262_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.948 214 269 1.10.12.10
3hrxA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9477 214 269 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A4Q3MI73-F1-model_v4 deleted 0.9899 35 269
AF-A0A3D1A1Y6-F1-model_v4 Enoyl-CoA hydratase family protein 0.9868 20 269 GO:0003824
AF-A0A7G9L0R4-F1-model_v4 Enoyl-CoA hydratase family protein 0.9867 2 269 GO:0003824
AF-A0A7H0LG70-F1-model_v4 Enoyl-CoA hydratase family protein 0.9866 3 269 GO:0003824
AF-A0A7X6BN12-F1-model_v4 Enoyl-CoA hydratase/carnithine racemase 0.9861 3 269 GO:0003824

Feature Viewer

pLDDT pTM Quality
91.25 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map